{ "uniprot_canonical_ac": "A0JPM9-1", "uniprot_ac": "A0JPM9", "uniprot_id": "EIF3J_RAT", "mass": { "chemical_mass": 29187.0, "monoisotopic_mass": 29187.0 }, "refseq": { "ac": "NP_001071138", "name": "eukaryotic translation initiation factor 3 subunit J", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071138" }, "gene_names": [ { "name": "Eif3j", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0JPM9", "id": "A0JPM9" }, { "name": "EIF3J", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0JPM9", "id": "A0JPM9" }, { "name": "EIF3S1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0JPM9", "id": "A0JPM9" }, { "name": "Eif3j", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071138", "id": "NP_001071138" }, { "name": "Eif3s1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0JPM9", "id": "A0JPM9" }, { "name": "eIF3 p35; Eif3s1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071138", "id": "NP_001071138" } ], "protein_names": [ { "name": "Eukaryotic translation initiation factor 3 subunit J", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0JPM9/entry#names_and_taxonomy", "id": "A0JPM9" }, { "name": "Eukaryotic translation initiation factor 3 subunit 1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0JPM9/entry#names_and_taxonomy", "id": "A0JPM9" }, { "name": "eIF-3-alpha", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0JPM9/entry#names_and_taxonomy", "id": "A0JPM9" }, { "name": "eIF3 p35", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0JPM9/entry#names_and_taxonomy", "id": "A0JPM9" }, { "name": "eIF3j", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0JPM9/entry#names_and_taxonomy", "id": "A0JPM9" }, { "name": "eukaryotic translation initiation factor 3 subunit J", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071138", "id": "NP_001071138" }, { "name": "eukaryotic translation initiation factor 3, subunit 1 alpha; eIF-3-alpha; eukaryotic translation initiation factor 3 subunit 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071138", "id": "NP_001071138" } ], "function": [ { "annotation": "Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. This subunit binds directly within the mRNA entry channel of the 40S ribosome to the aminoacyl (A) site. It may regulate the interaction between the 43S PIC and mRNA.", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9#function" }, { "database": "UniProtKB", "id": "MF_03009", "url": "https://www.uniprot.org/uniprot/MF_03009#function" }, { "database": "UniProtKB", "id": "A0A8I5ZZ82", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZ82#function" }, { "database": "UniProtKB", "id": "A0A8L2QCM4", "url": "https://www.uniprot.org/uniprot/A0A8L2QCM4#function" } ] }, { "annotation": "Knockdown of eIF-3-alpha enhances the expression of differentiation markers in PC12 cell.", "evidence": [ { "database": "RefSeq", "id": "NP_001071138", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071138" }, { "database": "PubMed", "id": "22025682", "url": "https://glygen.org/publication/PubMed/22025682" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Rattus norvegicus", "taxid": 10116, "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" } ], "common_name": "Rat", "glygen_name": "Rat", "reference_species": "Rattus norvegicus [10116]" } ], "gene": [ { "name": "Eif3j", "url": "https://www.uniprot.org/uniprot/A0JPM9", "locus": { "chromosome": "3", "start_pos": 109007953, "end_pos": 108985118, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSRNOG00000016459", "url": "https://www.ensembl.org/id/ENSRNOG00000016459" } ] } } ], "crossref": [ { "id": "ENSRNOG00000016459", "url": "https://bgee.org/?page=gene&gene_id=ENSRNOG00000016459", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "691947", "url": "https://www.ncbi.nlm.nih.gov/gene/691947", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013906", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013906", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023194", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023194", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "rno:691947", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:691947", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KPHYALW", "url": "https://omabrowser.org/oma/group/KPHYALW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2965239at2759", "url": "http://www.orthodb.org/?query=2965239at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21681", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21681", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21681:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21681:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08597", "url": "http://pfam.xfam.org/family/PF08597", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_A0JPM9", "url": "http://purl.obolibrary.org/obo/PR_A0JPM9", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-RNO-156827", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-156827", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-72649", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-72689", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-72689", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-72695", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-72695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-RNO-72702", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-72702", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001071138", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071138", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "1593338", "url": "http://rgd.mcw.edu/tools/genes/genes_view.cgi?id=1593338", "database": "RGD", "categories": [ "Organism-specific" ] }, { "id": "A0A8I5ZZ82", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZ82", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5ZZ82-1", "url": "https://www.uniprot.org/uniprot/A0A8I5ZZ82-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QCM4", "url": "https://www.uniprot.org/uniprot/A0A8L2QCM4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8L2QCM4-1", "url": "https://www.uniprot.org/uniprot/A0A8L2QCM4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0JPM9-1", "url": "https://www.uniprot.org/uniprot/A0JPM9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM", "length": 259, "header": "sp|A0JPM9-1|EIF3J_RAT Isoform 1 of Eukaryotic translation initiation factor 3 subunit J OS=Rattus norvegicus OX=10116 GN=Eif3j PE=1 SV=1 CANONICAL=A0JPM9-1" }, "isoforms": [ { "isoform_ac": "A0A8I5ZZ82-1", "url": "https://www.uniprot.org/uniprotkb/A0JPM9/entry#A0A8I5ZZ82-1", "sequence": { "sequence": "MEDPVRKVAGGGTAGGDRWEGEDEDEDDNWDDDDDENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM", "length": 236, "header": "tr|A0A8I5ZZ82-1|EIF3J_RAT Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit J OS=Rattus norvegicus OX=10116 GN=Eif3j PE=1 SV=1 CANONICAL=A0JPM9-1" }, "locus": { "chromosome": "3", "start_pos": 109006400, "end_pos": 108985345, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000097521.1", "url": "https://www.ensembl.org/id/ENSRNOT00000097521.1" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000085035.1", "url": "https://www.ensembl.org/id/ENSRNOP00000085035.1" } ] } }, { "isoform_ac": "A0A8L2QCM4-1", "url": "https://www.uniprot.org/uniprotkb/A0JPM9/entry#A0A8L2QCM4-1", "sequence": { "sequence": "MAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM", "length": 248, "header": "tr|A0A8L2QCM4-1|EIF3J_RAT Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit J OS=Rattus norvegicus OX=10116 GN=Eif3j PE=1 SV=1 CANONICAL=A0JPM9-1" }, "locus": { "chromosome": "3", "start_pos": 109006400, "end_pos": 108985199, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSRNOT00000022437.7", "url": "https://www.ensembl.org/id/ENSRNOT00000022437.7" }, { "database": "Ensembl Peptide", "id": "ENSRNOP00000022437.7", "url": "https://www.ensembl.org/id/ENSRNOP00000022437.7" } ] } }, { "isoform_ac": "A0JPM9-1", "url": "https://www.uniprot.org/uniprotkb/A0JPM9/entry#A0JPM9-1", "sequence": { "sequence": "MAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM", "length": 259, "header": "sp|A0JPM9-1|EIF3J_RAT Isoform 1 of Eukaryotic translation initiation factor 3 subunit J OS=Rattus norvegicus OX=10116 GN=Eif3j PE=1 SV=1 CANONICAL=A0JPM9-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 110, "end_pos": 110, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "A0JPM9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0JPM9" } ], "site_lbl": "Thr110" }, { "start_pos": 128, "end_pos": 128, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" }, { "database": "iPTMnet", "id": "A0JPM9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0JPM9" } ], "site_lbl": "Ser128" }, { "start_pos": 12, "end_pos": 12, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" }, { "database": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" }, { "database": "iPTMnet", "id": "A0JPM9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0JPM9" } ], "site_lbl": "Ser12" }, { "start_pos": 14, "end_pos": 14, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A8L2QCM4", "url": "https://www.uniprot.org/uniprot/A0A8L2QCM4" }, { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" }, { "database": "iPTMnet", "id": "A0JPM9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0JPM9" } ], "site_lbl": "Ser14" }, { "start_pos": 176, "end_pos": 176, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "A0JPM9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0JPM9" } ], "site_lbl": "Tyr176" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "A0A8L2QCM4", "url": "https://www.uniprot.org/uniprot/A0A8L2QCM4" }, { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" } ], "site_lbl": "Ser21" }, { "start_pos": 244, "end_pos": 244, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "A0JPM9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0JPM9" } ], "site_lbl": "Tyr244" }, { "start_pos": 251, "end_pos": 251, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "A0JPM9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0JPM9" } ], "site_lbl": "Tyr251" }, { "start_pos": 255, "end_pos": 255, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" }, { "database": "iPTMnet", "id": "A0JPM9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0JPM9" } ], "site_lbl": "Tyr255" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Eukaryotic translation initiation factor 3, subunit a, regulates the extracellular signal-regulated kinase pathway.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Xu TR, Lu RF, Romano D, Pitt A, Houslay MD, Milligan G, Kolch W", "evidence": [ { "database": "RefSeq", "id": "NP_001071138", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001071138" } ], "reference": [ { "type": "PubMed", "id": "22025682", "url": "https://glygen.org/publication/PubMed/22025682" } ] }, { "title": "Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues.", "journal": "Nature communications", "date": "2012", "authors": "Lundby A, Secher A, Lage K, Nordsborg NB, Dmytriyev A, Lundby C, Olsen JV", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" }, { "database": "iPTMnet", "id": "A0JPM9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/A0JPM9" } ], "reference": [ { "type": "PubMed", "id": "22673903", "url": "https://glygen.org/publication/PubMed/22673903" } ] } ], "pathway": [ { "id": "rno:691947", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+rno:691947", "resource": "KEGG Pathway" }, { "id": "R-RNO-156827", "name": "L13a-mediated translational silencing of Ceruloplasmin expression", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-156827", "resource": "Reactome", "description": "L13a-mediated translational silencing of Ceruloplasmin expression" }, { "id": "R-RNO-72649", "name": "Translation initiation complex formation", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-72649", "resource": "Reactome", "description": "Translation initiation complex formation" }, { "id": "R-RNO-72689", "name": "Formation of a pool of free 40S subunits", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-72689", "resource": "Reactome", "description": "Formation of a pool of free 40S subunits" }, { "id": "R-RNO-72695", "name": "Formation of the ternary complex, and subsequently, the 43S complex", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-72695", "resource": "Reactome", "description": "Formation of the ternary complex, and subsequently, the 43S complex" }, { "id": "R-RNO-72702", "name": "Ribosomal scanning and start codon recognition", "url": "https://www.reactome.org/PathwayBrowser/#R-RNO-72702", "resource": "Reactome", "description": "Ribosomal scanning and start codon recognition" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A5G2R3H6-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit J", "gene_name": "EIF3J", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MAAAAAAAAAGDSDSWDADTFSVDDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTIYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM", "length": 261 }, "evidence": [ { "id": "A0JPM9", "url": "https://omabrowser.org/oma/group/A0JPM9/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "O75822-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit J", "gene_name": "EIF3J", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEKKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNAVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGGYVQDYEDFM", "length": 258 }, "evidence": [ { "id": "46361754", "url": "http://www.informatics.jax.org/homology/46361754", "database": "MGI" }, { "id": "46361755", "url": "http://www.informatics.jax.org/homology/46361755", "database": "MGI" }, { "id": "A0JPM9", "url": "https://omabrowser.org/oma/group/A0JPM9/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q3UGC7-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit J-A", "gene_name": "Eif3j1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYEGGYVQDYEDFM", "length": 261 }, "evidence": [ { "id": "46361754", "url": "http://www.informatics.jax.org/homology/46361754", "database": "MGI" }, { "id": "A0JPM9", "url": "https://omabrowser.org/oma/group/A0JPM9/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q54KI0-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit J", "gene_name": "eif3J", "tax_id": 44689, "organism": "Dictyostelium discoideum", "sequence": { "sequence": "MSDWSDLQKDKWINENREVEEVDAWDASSEDEVEKVEEEIKEPPKPVVKQLTKKQALQRAIELKEKELKEPQGDFDIYLEEKRKKELQEASDLENSKNLFSGLSVKESSSGEPISTFIPKTEKDFEQYSQIVSDYLLKYDSSIHYATFFKSLMKKVLVNVSSSDMNDISKTLTVLINEKLKNEKSGKGGNKTKTKVAPKKIHMGNELQNYDDFDDDDFM", "length": 219 }, "evidence": [ { "id": "A0JPM9", "url": "https://omabrowser.org/oma/group/A0JPM9/", "database": "OMA" } ], "glygen_name": "Cellular slime mold", "common_name": "Social amoeba" }, { "uniprot_canonical_ac": "Q5ZKA4-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit J", "gene_name": "EIF3J", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MAAEADSWDADTFEVVEPVAKRLVPAGVAGDRWAGEDEEDDVKDNWDDEEEEEEVKEAEVKQEPKVSEKKKIAEKIKEKEKQQKKKQEELKKRLEAPEEHKELTPEEQLADKLRLKKLQEESDLELAKETFGVNNACGIDAMNPSSKDDFTEFGKLLKEKITQYEKSLHYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYDGEYVQEFEDFM", "length": 252 }, "evidence": [ { "id": "A0JPM9", "url": "https://omabrowser.org/oma/group/A0JPM9/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "Q66JS6-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit J-B", "gene_name": "Eif3j2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAAAAAAAAAAAGDSDSWDADTFSMEDPVRKVAGGGTAGGDRWEGEDEDEDVKDNWDDDDDENKEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEESKVLTPEEQLADKLRLKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASFLEALVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDDLADYGGYEGGYVQDYEDFM", "length": 263 }, "evidence": [ { "id": "46361755", "url": "http://www.informatics.jax.org/homology/46361755", "database": "MGI" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q7K550-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit J", "gene_name": "eIF3j", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MADDWESAADSEVVIRPTAAASVNKWEGEDEDEDIKDSWEDEEEKKDEEKPTKTEAPAKPKPNKALKAKLEQQALLEEEAEAKRLANLSPAEKLAEKLRLQKIQEASDLKHAQEAFGVTSTCGGLDAFNPETKEEFKEFGATLSWKVGQFRESEHFPQFVEDLVRSLCVNLSAADIKKVKMNVEILHSEKLKLEKANAKKPAGKGKGKVTLRTENDDIDGYQKYGNDFTEDYDDFM", "length": 236 }, "evidence": [ { "id": "A0JPM9", "url": "https://omabrowser.org/oma/group/A0JPM9/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" } ], "pmid": "" }, { "name": "translation initiation factor activity", "id": "GO:0003743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003743", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "eukaryotic 43S preinitiation complex", "id": "GO:0016282", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016282", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" } ], "pmid": "" }, { "name": "eukaryotic 48S preinitiation complex", "id": "GO:0033290", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033290", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" } ], "pmid": "" }, { "name": "eukaryotic translation initiation factor 3 complex", "id": "GO:0005852", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005852", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "formation of cytoplasmic translation initiation complex", "id": "GO:0001732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001732", "evidence": [ { "database": "UniProtKB", "id": "A0JPM9", "url": "https://www.uniprot.org/uniprot/A0JPM9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 140, "end_pos": 142, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 12, 14, 21, 110, 128, 176, 244, 251, 255 ], "sequon_annotation_sites": [ { "start_pos": 140, "end_pos": 142 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }