{ "uniprot_canonical_ac": "A0A8W4FII8-1", "uniprot_ac": "A0A8W4FII8", "uniprot_id": "A0A8W4FII8_PIG", "mass": { "chemical_mass": 9651.0, "monoisotopic_mass": 9651.0 }, "refseq": {}, "gene_names": [ { "name": "PDE6G", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8", "id": "A0A8W4FII8" } ], "protein_names": [ { "name": "Rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A8W4FII8/entry#names_and_taxonomy", "id": "A0A8W4FII8" }, { "name": "3.1.4.35", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A8W4FII8/entry#names_and_taxonomy", "id": "A0A8W4FII8" } ], "function": [ { "annotation": "Participates in processes of transmission and amplification of the visual signal. cGMP-PDEs are the effector molecules in G-protein-mediated phototransduction in vertebrate rods and cones.", "evidence": [ { "database": "UniProtKB", "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8#function" }, { "database": "UniProtKB", "id": "PIRNR000969", "url": "https://www.uniprot.org/uniprot/PIRNR000969#function" }, { "database": "UniProtKB", "id": "ARBA00025377", "url": "https://www.uniprot.org/uniprot/ARBA00025377#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "PDE6G", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8", "locus": { "chromosome": "12", "start_pos": 1239306, "end_pos": 1236210, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000053315", "url": "https://www.ensembl.org/id/ENSSSCG00000053315" } ] } } ], "crossref": [ { "id": "IPR006952", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006952", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR12122", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12122", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12122:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12122:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04868", "url": "http://pfam.xfam.org/family/PF04868", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-2485179", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2485179", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-2514859", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2514859", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-4086398", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "16957", "url": "https://www.rhea-db.org/rhea/16957", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8W4FII8-1", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNLEPPKAEIRSATRVIGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII", "length": 87, "header": "tr|A0A8W4FII8-1|A0A8W4FII8_PIG Isoform 1 of Rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma OS=Sus scrofa OX=9823 GN=PDE6G PE=3 SV=1 CANONICAL=A0A8W4FII8-1" }, "isoforms": [ { "isoform_ac": "A0A8W4FII8-1", "url": "https://www.uniprot.org/uniprotkb/A0A8W4FII8/entry#A0A8W4FII8-1", "sequence": { "sequence": "MNLEPPKAEIRSATRVIGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPWEAFNHLELHELAQYGII", "length": 87, "header": "tr|A0A8W4FII8-1|A0A8W4FII8_PIG Isoform 1 of Rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit gamma OS=Sus scrofa OX=9823 GN=PDE6G PE=3 SV=1 CANONICAL=A0A8W4FII8-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-SSC-2485179", "name": "Activation of the phototransduction cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2485179", "resource": "Reactome", "description": "Activation of the phototransduction cascade" }, { "id": "R-SSC-2514859", "name": "Inactivation, recovery and regulation of the phototransduction cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2514859", "resource": "Reactome", "description": "Inactivation, recovery and regulation of the phototransduction cascade" }, { "id": "R-SSC-4086398", "name": "Ca2+ pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-4086398", "resource": "Reactome", "description": "Ca2+ pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "positive regulation of MAPK cascade", "id": "GO:0043410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043410", "evidence": [ { "database": "UniProtKB", "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8" } ], "pmid": "" }, { "name": "positive regulation of G protein-coupled receptor signaling pathway", "id": "GO:0045745", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045745", "evidence": [ { "database": "UniProtKB", "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8" } ], "pmid": "" }, { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8" } ], "pmid": "" }, { "name": "positive regulation of epidermal growth factor receptor signaling pathway", "id": "GO:0045742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045742", "evidence": [ { "database": "UniProtKB", "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8" } ], "pmid": "" }, { "name": "response to stimulus", "id": "GO:0050896", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050896", "evidence": [ { "database": "UniProtKB", "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "cGMP binding", "id": "GO:0030553", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030553", "evidence": [ { "database": "UniProtKB", "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8" } ], "pmid": "" }, { "name": "3',5'-cyclic-nucleotide phosphodiesterase activity", "id": "GO:0004114", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004114", "evidence": [ { "database": "UniProtKB", "id": "A0A8W4FII8", "url": "https://www.uniprot.org/uniprot/A0A8W4FII8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16957", "name": "", "equation": "3',5'-cyclic GMP + H2O = GMP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "16957", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16957" } ] }, { "id": "R-SSC-2584246", "name": "GNAT1-GTP hydrolyses its bound GTP to GDP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, photoreceptor disc membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-2584246", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-2584246" } ] }, { "id": "R-SSC-4086392", "name": "PDE6 hydrolyses cGMP to GMP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-30991" ], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-4086392", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-4086392" } ] }, { "id": "R-SSC-74059", "name": "PDE6 hydrolyses cGMP to GMP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol, photoreceptor disc membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-74059", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-74059" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-30991", "participant_name": "cGMP [cytosol]", "crossref": [ { "id": "C00942", "database": "COMPOUND", "url": "" }, { "id": "16356", "database": "ChEBI", "url": "" }, { "id": "000004095501", "database": "ZINC", "url": "" }, { "id": "2347", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001314", "database": "HMDB Metabolite", "url": "" }, { "id": "C00942", "database": "COMPOUND", "url": "" }, { "id": "16356", "database": "ChEBI", "url": "" }, { "id": "000004095501", "database": "ZINC", "url": "" }, { "id": "2347", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001314", "database": "HMDB Metabolite", "url": "" }, { "id": "C00942", "database": "COMPOUND", "url": "" }, { "id": "16356", "database": "ChEBI", "url": "" }, { "id": "000004095501", "database": "ZINC", "url": "" }, { "id": "2347", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001314", "database": "HMDB Metabolite", "url": "" }, { "id": "C00942", "database": "COMPOUND", "url": "" }, { "id": "16356", "database": "ChEBI", "url": "" }, { "id": "000004095501", "database": "ZINC", "url": "" }, { "id": "2347", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001314", "database": "HMDB Metabolite", "url": "" }, { "id": "C00942", "database": "COMPOUND", "url": "" }, { "id": "16356", "database": "ChEBI", "url": "" }, { "id": "000004095501", "database": "ZINC", "url": "" }, { "id": "2347", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001314", "database": "HMDB Metabolite", "url": "" }, { "id": "C00942", "database": "COMPOUND", "url": "" }, { "id": "16356", "database": "ChEBI", "url": "" }, { "id": "000004095501", "database": "ZINC", "url": "" }, { "id": "2347", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001314", "database": "HMDB Metabolite", "url": "" }, { "id": "C00942", "database": "COMPOUND", "url": "" }, { "id": "16356", "database": "ChEBI", "url": "" }, { "id": "000004095501", "database": "ZINC", "url": "" }, { "id": "2347", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001314", "database": "HMDB Metabolite", "url": "" }, { "id": "C00942", "database": "COMPOUND", "url": "" }, { "id": "16356", "database": "ChEBI", "url": "" }, { "id": "000004095501", "database": "ZINC", "url": "" }, { "id": "2347", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "HMDB0001314", "database": "HMDB Metabolite", "url": "" } ] } ], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }