{ "uniprot_canonical_ac": "A0A2Z2CLU7-1", "uniprot_ac": "A0A2Z2CLU7", "uniprot_id": "A0A2Z2CLU7_CHICK", "mass": { "chemical_mass": 11890.0, "monoisotopic_mass": 11890.0 }, "refseq": {}, "gene_names": [ { "name": "CRH2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7", "id": "A0A2Z2CLU7" }, { "name": "LOC107054855", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7", "id": "A0A2Z2CLU7" } ], "protein_names": [ { "name": "Corticotropin-releasing hormone 2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A2Z2CLU7/entry#names_and_taxonomy", "id": "A0A2Z2CLU7" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Gallus gallus", "taxid": 9031, "evidence": [ { "database": "UniProtKB", "id": "A0A2Z2CLU7", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7" } ], "common_name": "Chicken", "glygen_name": "Chicken", "reference_species": "Gallus gallus [9031]" } ], "gene": [ { "name": "CRH2", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7", "locus": {} } ], "crossref": [ { "id": "ENSGALG00000051589", "url": "https://bgee.org/?page=gene&gene_id=ENSGALG00000051589", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR000187", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000187", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003620", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003620", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "CSPLQWP", "url": "https://omabrowser.org/oma/group/CSPLQWP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4321855at2759", "url": "http://www.orthodb.org/?query=4321855at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15035", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15035", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15035:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15035:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00473", "url": "http://pfam.xfam.org/family/PF00473", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "A0A2Z2CLU7", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2Z2CLU7-1", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRLRMISAASVLVLLFLPSESCSPLQPRWEPTAARPPHGLCRPRGAAPGPDPPRASRALQAGKRREGKPNSLDLTFHLLREFLEMSREERLAQKALSNKLLLQSIGK", "length": 107, "header": "tr|A0A2Z2CLU7-1|A0A2Z2CLU7_CHICK Isoform 1 of Corticotropin-releasing hormone 2 OS=Gallus gallus OX=9031 GN=CRH2 PE=2 SV=1 CANONICAL=A0A2Z2CLU7-1" }, "isoforms": [ { "isoform_ac": "A0A2Z2CLU7-1", "url": "https://www.uniprot.org/uniprotkb/A0A2Z2CLU7/entry#A0A2Z2CLU7-1", "sequence": { "sequence": "MRLRMISAASVLVLLFLPSESCSPLQPRWEPTAARPPHGLCRPRGAAPGPDPPRASRALQAGKRREGKPNSLDLTFHLLREFLEMSREERLAQKALSNKLLLQSIGK", "length": 107, "header": "tr|A0A2Z2CLU7-1|A0A2Z2CLU7_CHICK Isoform 1 of Corticotropin-releasing hormone 2 OS=Gallus gallus OX=9031 GN=CRH2 PE=2 SV=1 CANONICAL=A0A2Z2CLU7-1" }, "locus": { "chromosome": "20", "start_pos": 9855659, "end_pos": 9855339, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSGALT00010061067.1", "url": "https://www.ensembl.org/id/ENSGALT00010061067.1" }, { "database": "Ensembl Peptide", "id": "ENSGALP00010037788.1", "url": "https://www.ensembl.org/id/ENSGALP00010037788.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A2Z2CLU7", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "negative regulation of epinephrine secretion", "id": "GO:0032811", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032811", "evidence": [ { "database": "UniProtKB", "id": "A0A2Z2CLU7", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7" } ], "pmid": "" }, { "name": "negative regulation of glucagon secretion", "id": "GO:0070093", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070093", "evidence": [ { "database": "UniProtKB", "id": "A0A2Z2CLU7", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7" } ], "pmid": "" }, { "name": "positive regulation of cortisol secretion", "id": "GO:0051464", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051464", "evidence": [ { "database": "UniProtKB", "id": "A0A2Z2CLU7", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "corticotropin-releasing hormone activity", "id": "GO:0017045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017045", "evidence": [ { "database": "UniProtKB", "id": "A0A2Z2CLU7", "url": "https://www.uniprot.org/uniprot/A0A2Z2CLU7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }