{ "uniprot_canonical_ac": "A0A287BMP7-1", "uniprot_ac": "A0A287BMP7", "uniprot_id": "A0A287BMP7_PIG", "mass": { "chemical_mass": 40731.0, "monoisotopic_mass": 40731.0 }, "refseq": {}, "gene_names": [ { "name": "AKR1A1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A287BMP7", "id": "A0A287BMP7" } ], "protein_names": [ { "name": "Aldo-keto reductase family 1 member A1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" }, { "name": "1.1.1.19", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" }, { "name": "1.1.1.20", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" }, { "name": "1.1.1.2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" }, { "name": "1.1.1.372", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" }, { "name": "1.1.1.54", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" }, { "name": "Alcohol dehydrogenase [NADP(+)]", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" }, { "name": "Aldehyde reductase", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" }, { "name": "Glucuronate reductase", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" }, { "name": "Glucuronolactone reductase", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#names_and_taxonomy", "id": "A0A287BMP7" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "AKR1A1", "url": "https://www.uniprot.org/uniprot/A0A287BMP7", "locus": { "chromosome": "6", "start_pos": 165811247, "end_pos": 165824896, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000029256", "url": "https://www.ensembl.org/id/ENSSSCG00000029256" } ] } } ], "crossref": [ { "id": "ENSSSCG00000029256", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000029256", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd19106", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19106", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR018170", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018170", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020471", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020471", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023210", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023210", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036812", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036812", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044481", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044481", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "890110at2759", "url": "http://www.orthodb.org/?query=890110at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11732", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11732", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11732:SF544", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11732:SF544", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00248", "url": "http://pfam.xfam.org/family/PF00248", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-156590", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-5661270", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-5661270", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "12168", "url": "https://www.rhea-db.org/rhea/12168", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "14909", "url": "https://www.rhea-db.org/rhea/14909", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "15937", "url": "https://www.rhea-db.org/rhea/15937", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "18925", "url": "https://www.rhea-db.org/rhea/18925", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "23592", "url": "https://www.rhea-db.org/rhea/23592", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "27986", "url": "https://www.rhea-db.org/rhea/27986", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38111", "url": "https://www.rhea-db.org/rhea/38111", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58668", "url": "https://www.rhea-db.org/rhea/58668", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A287A3Y9", "url": "https://www.uniprot.org/uniprot/A0A287A3Y9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A287A3Y9-1", "url": "https://www.uniprot.org/uniprot/A0A287A3Y9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A287BMP7-1", "url": "https://www.uniprot.org/uniprot/A0A287BMP7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A5S6GLX4", "url": "https://www.uniprot.org/uniprot/A0A5S6GLX4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A5S6GLX4-1", "url": "https://www.uniprot.org/uniprot/A0A5S6GLX4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLNPGLSSSSGRGGASASPPDLSEVPASRRKLGFPAAHPSREPRPVESLAGHTTDLRNQEKLLSARAEVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY", "length": 365, "header": "tr|A0A287BMP7-1|A0A287BMP7_PIG Isoform 1 of Aldo-keto reductase family 1 member A1 OS=Sus scrofa OX=9823 GN=AKR1A1 PE=3 SV=1 CANONICAL=A0A287BMP7-1" }, "isoforms": [ { "isoform_ac": "A0A287A3Y9-1", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#A0A287A3Y9-1", "sequence": { "sequence": "MQQQCAQAFCVWEEPEVVAEGAMAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY", "length": 347, "header": "tr|A0A287A3Y9-1|A0A287BMP7_PIG Computationally mapped isoform of Aldo-keto reductase family 1 member A1 OS=Sus scrofa OX=9823 GN=AKR1A1 PE=3 SV=1 CANONICAL=A0A287BMP7-1" }, "locus": {} }, { "isoform_ac": "A0A287BMP7-1", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#A0A287BMP7-1", "sequence": { "sequence": "MLNPGLSSSSGRGGASASPPDLSEVPASRRKLGFPAAHPSREPRPVESLAGHTTDLRNQEKLLSARAEVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY", "length": 365, "header": "tr|A0A287BMP7-1|A0A287BMP7_PIG Isoform 1 of Aldo-keto reductase family 1 member A1 OS=Sus scrofa OX=9823 GN=AKR1A1 PE=3 SV=1 CANONICAL=A0A287BMP7-1" }, "locus": { "chromosome": "6", "start_pos": 165824822, "end_pos": 165811323, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000042479.3", "url": "https://www.ensembl.org/id/ENSSSCT00000042479.3" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000057347.1", "url": "https://www.ensembl.org/id/ENSSSCP00000057347.1" } ] } }, { "isoform_ac": "A0A5S6GLX4-1", "url": "https://www.uniprot.org/uniprotkb/A0A287BMP7/entry#A0A5S6GLX4-1", "sequence": { "sequence": "MLPSPLSPHTPSPRLPSRTSPKRAMAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAIKYALTVGYRHIDCAAIYGNELEIGEALQETVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTIRYDATHYKDTWKALEALVAKGLVRALGLSNFSSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPNEPVLLEEPVVQALAEKYNRSPAQILLRWQVQRKVICIPKSVTPSRILQNIQVFDFTFSPEEMKQLDALNKNLRFIVPMLTVDGKRVPRDAGHPLYPFNDPY", "length": 349, "header": "tr|A0A5S6GLX4-1|A0A287BMP7_PIG Computationally mapped isoform of Aldo-keto reductase family 1 member A1 OS=Sus scrofa OX=9823 GN=AKR1A1 PE=3 SV=1 CANONICAL=A0A287BMP7-1" }, "locus": { "chromosome": "6", "start_pos": 165820618, "end_pos": 165811323, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000030677.3", "url": "https://www.ensembl.org/id/ENSSSCT00000030677.3" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000020540.3", "url": "https://www.ensembl.org/id/ENSSSCP00000020540.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-SSC-156590", "name": "Glutathione conjugation", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-156590", "resource": "Reactome", "description": "Glutathione conjugation" }, { "id": "R-SSC-5661270", "name": "Formation of xylulose-5-phosphate", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-5661270", "resource": "Reactome", "description": "Formation of xylulose-5-phosphate" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "apical plasma membrane", "id": "GO:0016324", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016324", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "synapse", "id": "GO:0045202", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045202", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "aldehyde catabolic process", "id": "GO:0046185", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046185", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "daunorubicin metabolic process", "id": "GO:0044597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044597", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "doxorubicin metabolic process", "id": "GO:0044598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044598", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "glucuronate catabolic process to xylulose 5-phosphate", "id": "GO:0019640", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019640", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "L-ascorbic acid biosynthetic process", "id": "GO:0019853", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019853", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "D-glucuronate catabolic process", "id": "GO:0042840", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042840", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "cellular detoxification of aldehyde", "id": "GO:0110095", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0110095", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "alcohol dehydrogenase (NADP+) activity", "id": "GO:0008106", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008106", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "L-glucuronate reductase activity", "id": "GO:0047939", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047939", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "allyl-alcohol dehydrogenase activity", "id": "GO:0047655", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047655", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "glucuronolactone reductase activity", "id": "GO:0047941", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047941", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "alditol:NADP+ 1-oxidoreductase activity", "id": "GO:0004032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004032", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" }, { "name": "oxidoreductase activity, acting on NAD(P)H, nitrogenous group as acceptor", "id": "GO:0016657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016657", "evidence": [ { "database": "UniProtKB", "id": "A0A287BMP7", "url": "https://www.uniprot.org/uniprot/A0A287BMP7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 203, "end_pos": 205, "annotation": "n_glycosylation_sequon" }, { "start_pos": 282, "end_pos": 284, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "12168", "name": "", "equation": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "12168", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12168" } ] }, { "id": "14909", "name": "", "equation": "L-gulonate + NADP(+) = aldehydo-D-glucuronate + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "14909", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/14909" } ] }, { "id": "15937", "name": "", "equation": "a primary alcohol + NADP(+) = an aldehyde + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "15937", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/15937" } ] }, { "id": "18925", "name": "", "equation": "L-gulono-1,4-lactone + NADP(+) = D-glucurono-3,6-lactone + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "18925", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/18925" } ] }, { "id": "23592", "name": "", "equation": "glycerol + NADP(+) = D-glyceraldehyde + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "23592", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/23592" } ] }, { "id": "27986", "name": "", "equation": "hydroxyacetone + NADP(+) = H(+) + methylglyoxal + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "27986", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/27986" } ] }, { "id": "38111", "name": "", "equation": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "38111", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38111" } ] }, { "id": "58668", "name": "", "equation": "3-deoxyfructose + NADP(+) = 3-deoxyglucosone + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "58668", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58668" } ] }, { "id": "R-SSC-5661256", "name": "AKR1A1 reduces D-glucuronate to L-gulonate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-5661264" ], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-5661256", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-5661256" } ] }, { "id": "R-SSC-5692232", "name": "AKR1A1 oxidises BaPtDHD to BaP-7,8-dione", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-5692212" ], "output_participant_list": [ "R-ALL-5692216" ], "enzyme_list": [], "evidence": [ { "id": "R-SSC-5692232", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-5692232" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-5661264", "participant_name": "D-glucuronate [cytosol]", "crossref": [ { "id": "15748", "database": "ChEBI", "url": "" }, { "id": "15748", "database": "ChEBI", "url": "" }, { "id": "15748", "database": "ChEBI", "url": "" }, { "id": "15748", "database": "ChEBI", "url": "" }, { "id": "15748", "database": "ChEBI", "url": "" }, { "id": "15748", "database": "ChEBI", "url": "" }, { "id": "15748", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-5692212", "participant_name": "BaPtDHD [cytosol]", "crossref": [ { "id": "81626", "database": "ChEBI", "url": "" }, { "id": "C18275", "database": "COMPOUND", "url": "" }, { "id": "81626", "database": "ChEBI", "url": "" }, { "id": "C18275", "database": "COMPOUND", "url": "" }, { "id": "81626", "database": "ChEBI", "url": "" }, { "id": "C18275", "database": "COMPOUND", "url": "" }, { "id": "81626", "database": "ChEBI", "url": "" }, { "id": "C18275", "database": "COMPOUND", "url": "" }, { "id": "81626", "database": "ChEBI", "url": "" }, { "id": "C18275", "database": "COMPOUND", "url": "" }, { "id": "81626", "database": "ChEBI", "url": "" }, { "id": "C18275", "database": "COMPOUND", "url": "" }, { "id": "81626", "database": "ChEBI", "url": "" }, { "id": "C18275", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-5692216", "participant_name": "BaP-7,8-dione [cytosol]", "crossref": [ { "id": "000006094768", "database": "ZINC", "url": "" }, { "id": "87752", "database": "ChEBI", "url": "" }, { "id": "000006094768", "database": "ZINC", "url": "" }, { "id": "87752", "database": "ChEBI", "url": "" }, { "id": "000006094768", "database": "ZINC", "url": "" }, { "id": "87752", "database": "ChEBI", "url": "" }, { "id": "000006094768", "database": "ZINC", "url": "" }, { "id": "87752", "database": "ChEBI", "url": "" }, { "id": "000006094768", "database": "ZINC", "url": "" }, { "id": "87752", "database": "ChEBI", "url": "" }, { "id": "87752", "database": "ChEBI", "url": "" }, { "id": "000006094768", "database": "ZINC", "url": "" }, { "id": "000006094768", "database": "ZINC", "url": "" }, { "id": "87752", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 203, "end_pos": 205 }, { "start_pos": 282, "end_pos": 284 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }