{ "uniprot_canonical_ac": "A0A287ASV6-1", "uniprot_ac": "A0A287ASV6", "uniprot_id": "A0A287ASV6_PIG", "mass": { "chemical_mass": 34628.0, "monoisotopic_mass": 34628.0 }, "refseq": { "ac": "XP_003358659", "name": "E3 ubiquitin-protein ligase SIAH2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003358659" }, "gene_names": [ { "name": "SIAH2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A287ASV6", "id": "A0A287ASV6" }, { "name": "SIAH2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003358659", "id": "XP_003358659" } ], "protein_names": [ { "name": "E3 ubiquitin-protein ligase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A287ASV6/entry#names_and_taxonomy", "id": "A0A287ASV6" }, { "name": "2.3.2.27", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287ASV6/entry#names_and_taxonomy", "id": "A0A287ASV6" }, { "name": "E3 ubiquitin-protein ligase SIAH2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003358659", "id": "XP_003358659" } ], "function": [ { "annotation": "E3 ubiquitin-protein ligase that mediates ubiquitination and subsequent proteasomal degradation of target proteins. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6#function" }, { "database": "UniProtKB", "id": "RU201113", "url": "https://www.uniprot.org/uniprot/RU201113#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "SIAH2", "url": "https://www.uniprot.org/uniprot/A0A287ASV6", "locus": { "chromosome": "13", "start_pos": 90949021, "end_pos": 90971411, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000031388", "url": "https://www.ensembl.org/id/ENSSSCG00000031388" } ] } } ], "crossref": [ { "id": "ENSSSCG00000031388", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000031388", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03829", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03829", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd16752", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16752", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100622531", "url": "https://www.ncbi.nlm.nih.gov/gene/100622531", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001841", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001841", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008974", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008974", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013010", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013010", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018121", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018121", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR049548", "url": "https://www.ebi.ac.uk/interpro/entry/IPR049548", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ssc:100622531", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100622531", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "AGHLVCK", "url": "https://omabrowser.org/oma/group/AGHLVCK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "222086at2759", "url": "http://www.orthodb.org/?query=222086at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45877", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45877", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45877:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45877:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03145", "url": "http://pfam.xfam.org/family/PF03145", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF21361", "url": "http://pfam.xfam.org/family/PF21361", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF21362", "url": "http://pfam.xfam.org/family/PF21362", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-5689880", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-5689880", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_003358659", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_003358659", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A287ASV6-1", "url": "https://www.uniprot.org/uniprot/A0A287ASV6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRPSSTGPSANKPCNKQPPPQPQHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVSAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP", "length": 324, "header": "tr|A0A287ASV6-1|A0A287ASV6_PIG Isoform 1 of E3 ubiquitin-protein ligase OS=Sus scrofa OX=9823 GN=SIAH2 PE=3 SV=1 CANONICAL=A0A287ASV6-1" }, "isoforms": [ { "isoform_ac": "A0A287ASV6-1", "url": "https://www.uniprot.org/uniprotkb/A0A287ASV6/entry#A0A287ASV6-1", "sequence": { "sequence": "MSRPSSTGPSANKPCNKQPPPQPQHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVSAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP", "length": 324, "header": "tr|A0A287ASV6-1|A0A287ASV6_PIG Isoform 1 of E3 ubiquitin-protein ligase OS=Sus scrofa OX=9823 GN=SIAH2 PE=3 SV=1 CANONICAL=A0A287ASV6-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Genes of the pig, Sus scrofa, reconstructed with EvidentialGene.", "journal": "PeerJ", "date": "2019", "authors": "Gilbert Donald G", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "reference": [ { "type": "PubMed", "id": "30723633", "url": "https://glygen.org/publication/PubMed/30723633" } ] } ], "pathway": [ { "id": "ssc:100622531", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100622531", "resource": "KEGG Pathway" }, { "id": "R-SSC-5689880", "name": "Ub-specific processing proteases", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-5689880", "resource": "Reactome", "description": "Ub-specific processing proteases" }, { "id": "R-SSC-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [ { "uniprot_canonical_ac": "E1C3Q9-1", "protein_name": "E3 ubiquitin-protein ligase", "gene_name": "SIAH2", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MSRPSSAGPGASKPCGKQPPPHASAPAAAAPAPAAATIAASGAGSSAVPAAAAVLSGPGGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCKQCRQKLSLCPTCRGSLTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGATCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVNAAIVNSDCLVFDTAIAHLFADNGNLGINVTISTCCP", "length": 319 }, "evidence": [ { "id": "A0A287ASV6", "url": "https://omabrowser.org/oma/group/A0A287ASV6/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "O43255-1", "protein_name": "E3 ubiquitin-protein ligase SIAH2", "gene_name": "SIAH2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP", "length": 324 }, "evidence": [ { "id": "A0A287ASV6", "url": "https://omabrowser.org/oma/group/A0A287ASV6/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q06986-1", "protein_name": "E3 ubiquitin-protein ligase SIAH2", "gene_name": "Siah2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGADPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ", "length": 325 }, "evidence": [ { "id": "A0A287ASV6", "url": "https://omabrowser.org/oma/group/A0A287ASV6/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8R4T2-1", "protein_name": "E3 ubiquitin-protein ligase SIAH2", "gene_name": "Siah2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSRPSSTGPSANKPCSKQPPPPQTPHAPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGAGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCQ", "length": 325 }, "evidence": [ { "id": "A0A287ASV6", "url": "https://omabrowser.org/oma/group/A0A287ASV6/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "ubiquitin protein ligase activity", "id": "GO:0061630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061630", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "ubiquitin conjugating enzyme binding", "id": "GO:0031624", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031624", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "negative regulation of canonical Wnt signaling pathway", "id": "GO:0090090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090090", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "proteasome-mediated ubiquitin-dependent protein catabolic process", "id": "GO:0043161", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043161", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "regulation of circadian rhythm", "id": "GO:0042752", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042752", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "rhythmic process", "id": "GO:0048511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048511", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "canonical Wnt signaling pathway", "id": "GO:0060070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060070", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001237", "evidence": [ { "database": "UniProtKB", "id": "A0A287ASV6", "url": "https://www.uniprot.org/uniprot/A0A287ASV6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 316, "end_pos": 318, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-SSC-6781899", "name": "USP13 binds SIAH2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-6781899", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-6781899" } ] }, { "id": "R-SSC-983140", "name": "Transfer of Ub from E2 to substrate and release of E2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-983140", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-983140" } ] }, { "id": "R-SSC-983147", "name": "Release of E3 from polyubiquitinated substrate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-983147", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-983147" } ] }, { "id": "R-SSC-983156", "name": "Polyubiquitination of substrate", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-983156", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-983156" } ] }, { "id": "R-SSC-983157", "name": "Interaction of E3 with substrate and E2-Ub complex", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-983157", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-983157" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 316, "end_pos": 318 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }