{ "uniprot_canonical_ac": "A0A287AS29-1", "uniprot_ac": "A0A287AS29", "uniprot_id": "A0A287AS29_PIG", "mass": { "chemical_mass": 17109.0, "monoisotopic_mass": 17109.0 }, "refseq": { "ac": "NP_001191688", "name": "nucleoside diphosphate kinase A", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191688" }, "gene_names": [ { "name": "NME1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A287AS29", "id": "A0A287AS29" }, { "name": "NME1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191688", "id": "NP_001191688" } ], "protein_names": [ { "name": "Nucleoside diphosphate kinase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A287AS29/entry#names_and_taxonomy", "id": "A0A287AS29" }, { "name": "2.7.4.6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287AS29/entry#names_and_taxonomy", "id": "A0A287AS29" }, { "name": "non-metastatic cells 1, protein (NM23A) expressed in", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191688", "id": "NP_001191688" }, { "name": "nucleoside diphosphate kinase A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191688", "id": "NP_001191688" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "NME1", "url": "https://www.uniprot.org/uniprot/A0A287AS29", "locus": { "chromosome": "12", "start_pos": 27436140, "end_pos": 27416346, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000038348", "url": "https://www.ensembl.org/id/ENSSSCG00000038348" } ] } } ], "crossref": [ { "id": "ENSSSCG00000038348", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000038348", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd04413", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04413", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100142626", "url": "https://www.ncbi.nlm.nih.gov/gene/100142626", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001564", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001564", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023005", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023005", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034907", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034907", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ssc:100142626", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100142626", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "QHYGEHK", "url": "https://omabrowser.org/oma/group/QHYGEHK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3075753at2759", "url": "http://www.orthodb.org/?query=3075753at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11349", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11349", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11349:SF69", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11349:SF69", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00334", "url": "http://pfam.xfam.org/family/PF00334", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-499943", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-499943", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9748787", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-9755088", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9755088", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001191688", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191688", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "18113", "url": "https://www.rhea-db.org/rhea/18113", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "44640", "url": "https://www.rhea-db.org/rhea/44640", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A287AS29-1", "url": "https://www.uniprot.org/uniprot/A0A287AS29-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A5G2QTY2", "url": "https://www.uniprot.org/uniprot/A0A5G2QTY2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A5G2QTY2-1", "url": "https://www.uniprot.org/uniprot/A0A5G2QTY2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8W4FLZ5", "url": "https://www.uniprot.org/uniprot/A0A8W4FLZ5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8W4FLZ5-1", "url": "https://www.uniprot.org/uniprot/A0A8W4FLZ5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFMQASEDLLKEHYIDLKDRPFFAGLVTYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYKSCAQAWIYE", "length": 152, "header": "tr|A0A287AS29-1|A0A287AS29_PIG Isoform 1 of Nucleoside diphosphate kinase OS=Sus scrofa OX=9823 GN=NME1 PE=1 SV=1 CANONICAL=A0A287AS29-1" }, "isoforms": [ { "isoform_ac": "A0A287AS29-1", "url": "https://www.uniprot.org/uniprotkb/A0A287AS29/entry#A0A287AS29-1", "sequence": { "sequence": "MASSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFMQASEDLLKEHYIDLKDRPFFAGLVTYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEIGLWFHPEELVDYKSCAQAWIYE", "length": 152, "header": "tr|A0A287AS29-1|A0A287AS29_PIG Isoform 1 of Nucleoside diphosphate kinase OS=Sus scrofa OX=9823 GN=NME1 PE=1 SV=1 CANONICAL=A0A287AS29-1" }, "locus": {} }, { "isoform_ac": "A0A5G2QTY2-1", "url": "https://www.uniprot.org/uniprotkb/A0A287AS29/entry#A0A5G2QTY2-1", "sequence": { "sequence": "MASSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFMQASEDLLKEHYIDLKDRPFFAGLVTYMHSGPVVAMFLLR", "length": 80, "header": "tr|A0A5G2QTY2-1|A0A287AS29_PIG Computationally mapped isoform of Nucleoside diphosphate kinase OS=Sus scrofa OX=9823 GN=NME1 PE=1 SV=1 CANONICAL=A0A287AS29-1" }, "locus": { "chromosome": "12", "start_pos": 27434099, "end_pos": 27426830, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000088028.2", "url": "https://www.ensembl.org/id/ENSSSCT00000088028.2" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000065455.1", "url": "https://www.ensembl.org/id/ENSSSCP00000065455.1" } ] } }, { "isoform_ac": "A0A8W4FLZ5-1", "url": "https://www.uniprot.org/uniprotkb/A0A287AS29/entry#A0A8W4FLZ5-1", "sequence": { "sequence": "MASSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFMQASEDLLKEHYIDLKDRPFFAGLVTYMHSGPVVAMVSGHVS", "length": 82, "header": "tr|A0A8W4FLZ5-1|A0A8W4FLZ5_PIG Computationally mapped isoform of nucleoside-diphosphate kinase OS=Sus scrofa OX=9823 GN=NME1 PE=1 SV=1 CANONICAL=A0A287AS29-1" }, "locus": { "chromosome": "12", "start_pos": 27432264, "end_pos": 27426830, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000103926.1", "url": "https://www.ensembl.org/id/ENSSSCT00000103926.1" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000079323.1", "url": "https://www.ensembl.org/id/ENSSSCP00000079323.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "ssc:100142626", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100142626", "resource": "KEGG Pathway" }, { "id": "R-SSC-499943", "name": "Interconversion of nucleotide di- and triphosphates", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-499943", "resource": "Reactome", "description": "Interconversion of nucleotide di- and triphosphates" }, { "id": "R-SSC-9748787", "name": "Azathioprine ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9748787", "resource": "Reactome", "description": "Azathioprine ADME" }, { "id": "R-SSC-9755088", "name": "Ribavirin ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9755088", "resource": "Reactome", "description": "Ribavirin ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "P08879-1", "protein_name": "Nucleoside diphosphate kinase", "gene_name": "awd", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MAANKERTFIMVKPDGVQRGLVGKIIERFEQKGFKLVALKFTWASKELLEKHYADLSARPFFPGLVNYMNSGPVVPMVWEGLNVVKTGRQMLGATNPADSLPGTIRGDFCIQVGRNIIHGSDAVESAEKEIALWFNEKELVTWTPAAKDWIYE", "length": 153 }, "evidence": [ { "id": "A0A287AS29", "url": "https://omabrowser.org/oma/group/A0A287AS29/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P15532-1", "protein_name": "Nucleoside diphosphate kinase A", "gene_name": "Nme1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFLQASEDLLKEHYTDLKDRPFFTGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFQPEELVEYKSCAQNWIYE", "length": 152 }, "evidence": [ { "id": "A0A287AS29", "url": "https://omabrowser.org/oma/group/A0A287AS29/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P22887-1", "protein_name": "Nucleoside diphosphate kinase, cytosolic", "gene_name": "ndkC-1", "tax_id": 44689, "organism": "Dictyostelium discoideum", "sequence": { "sequence": "MSTNKVNKERTFLAVKPDGVARGLVGEIIARYEKKGFVLVGLKQLVPTKDLAESHYAEHKERPFFGGLVSFITSGPVVAMVFEGKGVVASARLMIGVTNPLASAPGSIRGDFGVDVGRNIIHGSDSVESANREIALWFKPEELLTEVKPNPNLYE", "length": 155 }, "evidence": [ { "id": "A0A287AS29", "url": "https://omabrowser.org/oma/group/A0A287AS29/", "database": "OMA" } ], "glygen_name": "Cellular slime mold", "common_name": "Social amoeba" }, { "uniprot_canonical_ac": "P36010-1", "protein_name": "Nucleoside diphosphate kinase", "gene_name": "YNK1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSSQTERTFIAVKPDGVQRGLVSQILSRFEKKGYKLVAIKLVKADDKLLEQHYAEHVGKPFFPKMVSFMKSGPILATVWEGKDVVRQGRTILGATNPLGSAPGTIRGDFGIDLGRNVCHGSDSVDSAEREINLWFKKEELVDWESNQAKWIYE", "length": 153 }, "evidence": [ { "id": "A0A287AS29", "url": "https://omabrowser.org/oma/group/A0A287AS29/", "database": "OMA" } ], "glygen_name": "Yeast", "common_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05982-1", "protein_name": "Nucleoside diphosphate kinase A", "gene_name": "Nme1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFIQASEDLLKEHYIDLKDRPFFSGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVESAEKEISLWFQPEELVDYKSCAQNWIYE", "length": 152 }, "evidence": [ { "id": "A0A287AS29", "url": "https://omabrowser.org/oma/group/A0A287AS29/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "nucleoside diphosphate kinase activity", "id": "GO:0004550", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004550", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "GTP binding", "id": "GO:0005525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005525", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "ribosomal small subunit binding", "id": "GO:0043024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043024", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "3'-5' exonuclease activity", "id": "GO:0008408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008408", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "DNA nuclease activity", "id": "GO:0004536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004536", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 9, "go_terms": [ { "name": "GTP biosynthetic process", "id": "GO:0006183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006183", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "UTP biosynthetic process", "id": "GO:0006228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006228", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "CTP biosynthetic process", "id": "GO:0006241", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006241", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "endocytosis", "id": "GO:0006897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006897", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "cell differentiation", "id": "GO:0030154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030154", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "phosphorylation", "id": "GO:0016310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016310", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "lactation", "id": "GO:0007595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007595", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "positive regulation of epithelial cell proliferation", "id": "GO:0050679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050679", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" }, { "name": "ruffle membrane", "id": "GO:0032587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032587", "evidence": [ { "database": "UniProtKB", "id": "A0A287AS29", "url": "https://www.uniprot.org/uniprot/A0A287AS29" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "18113", "name": "", "equation": "a ribonucleoside 5'-diphosphate + ATP = a ribonucleoside 5'-triphosphate + ADP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "18113", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/18113" } ] }, { "id": "44640", "name": "", "equation": "a 2'-deoxyribonucleoside 5'-diphosphate + ATP = a 2'-deoxyribonucleoside 5'-triphosphate + ADP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "44640", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/44640" } ] }, { "id": "R-SSC-482619", "name": "(d)NDP + ATP <=> (d)NTP + ADP (NME1,2,3)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-482619", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-482619" } ] }, { "id": "R-SSC-482621", "name": "(d)NTP + ADP <=> (d)NDP + ATP (NME1,2,3)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-482621", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-482621" } ] }, { "id": "R-SSC-6806877", "name": "NME1:NME3 heterohexamer, NME2P1 phosphorylate NDPs to NTPs", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [ "R-ALL-6806881" ], "enzyme_list": [], "evidence": [ { "id": "R-SSC-6806877", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-6806877" } ] }, { "id": "R-SSC-9748969", "name": "NME1:2 hexamer phosphorylates 6TdGDP to 6TdGTP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9749033" ], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-9748969", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9748969" } ] }, { "id": "R-SSC-9748999", "name": "NME1:2 hexamer phosphorylates 6TGDP to 6TGTP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9748960" ], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-9748999", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9748999" } ] }, { "id": "R-SSC-9755013", "name": "NME1,2 hexamers phosphorylate RBV-DP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9754985" ], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-9755013", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9755013" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-6806881", "participant_name": "NTP(4-) [cytosol]", "crossref": [ { "id": "61557", "database": "ChEBI", "url": "" }, { "id": "61557", "database": "ChEBI", "url": "" }, { "id": "61557", "database": "ChEBI", "url": "" }, { "id": "61557", "database": "ChEBI", "url": "" }, { "id": "61557", "database": "ChEBI", "url": "" }, { "id": "61557", "database": "ChEBI", "url": "" }, { "id": "61557", "database": "ChEBI", "url": "" }, { "id": "61557", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9748960", "participant_name": "6TGDP [cytosol]", "crossref": [ { "id": "53936469", "database": "PubChem Compound", "url": "" }, { "id": "180687", "database": "ChEBI", "url": "" }, { "id": "180687", "database": "ChEBI", "url": "" }, { "id": "53936469", "database": "PubChem Compound", "url": "" }, { "id": "53936469", "database": "PubChem Compound", "url": "" }, { "id": "180687", "database": "ChEBI", "url": "" }, { "id": "53936469", "database": "PubChem Compound", "url": "" }, { "id": "180687", "database": "ChEBI", "url": "" }, { "id": "53936469", "database": "PubChem Compound", "url": "" }, { "id": "180687", "database": "ChEBI", "url": "" }, { "id": "180687", "database": "ChEBI", "url": "" }, { "id": "53936469", "database": "PubChem Compound", "url": "" }, { "id": "53936469", "database": "PubChem Compound", "url": "" }, { "id": "180687", "database": "ChEBI", "url": "" }, { "id": "53936469", "database": "PubChem Compound", "url": "" }, { "id": "180687", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9749033", "participant_name": "6TdGDP [cytosol]", "crossref": [ { "id": "180690", "database": "ChEBI", "url": "" }, { "id": "180690", "database": "ChEBI", "url": "" }, { "id": "180690", "database": "ChEBI", "url": "" }, { "id": "180690", "database": "ChEBI", "url": "" }, { "id": "180690", "database": "ChEBI", "url": "" }, { "id": "180690", "database": "ChEBI", "url": "" }, { "id": "180690", "database": "ChEBI", "url": "" }, { "id": "180690", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9754985", "participant_name": "RBV-DP [cytosol]", "crossref": [ { "id": "189092", "database": "ChEBI", "url": "" }, { "id": "189092", "database": "ChEBI", "url": "" }, { "id": "189092", "database": "ChEBI", "url": "" }, { "id": "189092", "database": "ChEBI", "url": "" }, { "id": "189092", "database": "ChEBI", "url": "" }, { "id": "189092", "database": "ChEBI", "url": "" }, { "id": "189092", "database": "ChEBI", "url": "" }, { "id": "189092", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }