{ "uniprot_canonical_ac": "A0A287AI92-1", "uniprot_ac": "A0A287AI92", "uniprot_id": "A0A287AI92_PIG", "mass": { "chemical_mass": 28975.0, "monoisotopic_mass": 28975.0 }, "refseq": { "ac": "XP_001924218", "name": "carbonic anhydrase 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001924218" }, "gene_names": [ { "name": "CA1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/A0A287AI92", "id": "A0A287AI92" }, { "name": "LOC100153915", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001924218", "id": "XP_001924218" }, { "name": "LOC100153915", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/A0A287AI92", "id": "A0A287AI92" } ], "protein_names": [ { "name": "Carbonic anhydrase", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprotkb/A0A287AI92/entry#names_and_taxonomy", "id": "A0A287AI92" }, { "name": "4.2.1.1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprotkb/A0A287AI92/entry#names_and_taxonomy", "id": "A0A287AI92" }, { "name": "carbonic anhydrase 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001924218", "id": "XP_001924218" } ], "function": [ { "annotation": "Reversible hydration of carbon dioxide.", "evidence": [ { "database": "UniProtKB", "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92#function" }, { "database": "UniProtKB", "id": "RU367011", "url": "https://www.uniprot.org/uniprot/RU367011#function" }, { "database": "UniProtKB", "id": "A0A4X1UEN0", "url": "https://www.uniprot.org/uniprot/A0A4X1UEN0#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Sus scrofa", "taxid": 9823, "evidence": [ { "database": "UniProtKB", "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92" } ], "common_name": "Pig", "glygen_name": "Pig", "reference_species": "Sus scrofa [9823]" } ], "gene": [ { "name": "CA1", "url": "https://www.uniprot.org/uniprot/A0A287AI92", "locus": { "chromosome": "4", "start_pos": 51353126, "end_pos": 51302406, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSSSCG00000040770", "url": "https://www.ensembl.org/id/ENSSSCG00000040770" } ] } } ], "crossref": [ { "id": "ENSSSCG00000040770", "url": "https://bgee.org/?page=gene&gene_id=ENSSSCG00000040770", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "100153915", "url": "https://www.ncbi.nlm.nih.gov/gene/100153915", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001148", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001148", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018338", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018338", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023561", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023561", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036398", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036398", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ssc:100153915", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100153915", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NGPEQWG", "url": "https://omabrowser.org/oma/group/NGPEQWG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "49814at2759", "url": "http://www.orthodb.org/?query=49814at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR18952", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18952", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR18952:SF271", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18952:SF271", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00194", "url": "http://pfam.xfam.org/family/PF00194", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-1237044", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1237044", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-1247673", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1247673", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-SSC-1475029", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1475029", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_001924218", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_001924218", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "10748", "url": "https://www.rhea-db.org/rhea/10748", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "23056", "url": "https://www.rhea-db.org/rhea/23056", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A287AI92-1", "url": "https://www.uniprot.org/uniprot/A0A287AI92-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A4X1UCW9", "url": "https://www.uniprot.org/uniprot/A0A4X1UCW9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A4X1UCW9-1", "url": "https://www.uniprot.org/uniprot/A0A4X1UCW9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A4X1UEN0", "url": "https://www.uniprot.org/uniprot/A0A4X1UEN0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A4X1UEN0-1", "url": "https://www.uniprot.org/uniprot/A0A4X1UEN0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A5G2QAD6", "url": "https://www.uniprot.org/uniprot/A0A5G2QAD6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A5G2QAD6-1", "url": "https://www.uniprot.org/uniprot/A0A5G2QAD6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTSPAWGYDGEYGPEHWSKVYPIANGNNQSPIDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKDGPLSESYRLLQFHFHWGKTDDYGSEHLVDGAKYSAELHIVHWNSAKYSSAAEAASHADGLAIIGVLVKVGQANPNLQKVLDALKGIKYKGKKAPFTNFDPSVLLPSSLDYWTYFGSLTHPPLHESVNWIILKENISISSDQLAQFRSLLSNAEGDKDVPIKHNNRPPQPLKGRIVKASF", "length": 261, "header": "tr|A0A287AI92-1|A0A287AI92_PIG Isoform 1 of Carbonic anhydrase OS=Sus scrofa OX=9823 GN=CA1 PE=1 SV=1 CANONICAL=A0A287AI92-1" }, "isoforms": [ { "isoform_ac": "A0A287AI92-1", "url": "https://www.uniprot.org/uniprotkb/A0A287AI92/entry#A0A287AI92-1", "sequence": { "sequence": "MTSPAWGYDGEYGPEHWSKVYPIANGNNQSPIDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKDGPLSESYRLLQFHFHWGKTDDYGSEHLVDGAKYSAELHIVHWNSAKYSSAAEAASHADGLAIIGVLVKVGQANPNLQKVLDALKGIKYKGKKAPFTNFDPSVLLPSSLDYWTYFGSLTHPPLHESVNWIILKENISISSDQLAQFRSLLSNAEGDKDVPIKHNNRPPQPLKGRIVKASF", "length": 261, "header": "tr|A0A287AI92-1|A0A287AI92_PIG Isoform 1 of Carbonic anhydrase OS=Sus scrofa OX=9823 GN=CA1 PE=1 SV=1 CANONICAL=A0A287AI92-1" }, "locus": {} }, { "isoform_ac": "A0A4X1UCW9-1", "url": "https://www.uniprot.org/uniprotkb/A0A287AI92/entry#A0A4X1UCW9-1", "sequence": { "sequence": "MMVNMLHIVHWNSAKYSSAAEAASHADGLAIIGVLVKGKKAPFTNFDPSVLLPSSLDYWTYFGSLTHPPLHESVNWIILKENISISSDQLAQFRSLLSNAEGDKDVPIKHNNRPPQPLKGRIVKASF", "length": 127, "header": "tr|A0A4X1UCW9-1|A0A287AI92_PIG Computationally mapped isoform of Carbonic anhydrase OS=Sus scrofa OX=9823 GN=CA1 PE=1 SV=1 CANONICAL=A0A287AI92-1" }, "locus": {} }, { "isoform_ac": "A0A4X1UEN0-1", "url": "https://www.uniprot.org/uniprotkb/A0A287AI92/entry#A0A4X1UEN0-1", "sequence": { "sequence": "MTSPAWGYDGEYGPEHWSKVYPIANGNNQSPIDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKDGPLSESYRLLQFHFHWGKTDDYGSEHLVDGAKYSAELHIVHWNSAKYSSAAEAASHADGLAIIGVLVKGKKAPFTNFDPSVLLPSSLDYWTYFGSLTHPPLHESVNWIILKENISISSDQLAQFRSLLSNAEGDKDVPIKHNNRPPQPLKGRIVKASF", "length": 240, "header": "tr|A0A4X1UEN0-1|A0A287AI92_PIG Computationally mapped isoform of Carbonic anhydrase OS=Sus scrofa OX=9823 GN=CA1 PE=1 SV=1 CANONICAL=A0A287AI92-1" }, "locus": {} }, { "isoform_ac": "A0A5G2QAD6-1", "url": "https://www.uniprot.org/uniprotkb/A0A287AI92/entry#A0A5G2QAD6-1", "sequence": { "sequence": "VMLHIVHWNSAKYSSAAEAASHADGLAIIGVLVKGKKAPFTNFDPSVLLPSSLDYWTYFGSLTHPPLHESVNWIILKENISISSDQLAQFRSLLSNAEGDKDVPIKHNNRPPQPLKGRIVKASF", "length": 124, "header": "tr|A0A5G2QAD6-1|A0A287AI92_PIG Computationally mapped isoform of Carbonic anhydrase OS=Sus scrofa OX=9823 GN=CA1 PE=1 SV=2 CANONICAL=A0A287AI92-1" }, "locus": { "chromosome": "4", "start_pos": 51352792, "end_pos": 51348961, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSSSCT00000085334.2", "url": "https://www.ensembl.org/id/ENSSSCT00000085334.2" }, { "database": "Ensembl Peptide", "id": "ENSSSCP00000060966.2", "url": "https://www.ensembl.org/id/ENSSSCP00000060966.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Genes of the pig, Sus scrofa, reconstructed with EvidentialGene.", "journal": "PeerJ", "date": "2019", "authors": "Gilbert Donald G", "evidence": [ { "database": "UniProtKB", "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92" } ], "reference": [ { "type": "PubMed", "id": "30723633", "url": "https://glygen.org/publication/PubMed/30723633" } ] } ], "pathway": [ { "id": "ssc:100153915", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ssc:100153915", "resource": "KEGG Pathway" }, { "id": "R-SSC-1237044", "name": "Erythrocytes take up carbon dioxide and release oxygen", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1237044", "resource": "Reactome", "description": "Erythrocytes take up carbon dioxide and release oxygen" }, { "id": "R-SSC-1247673", "name": "Erythrocytes take up oxygen and release carbon dioxide", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1247673", "resource": "Reactome", "description": "Erythrocytes take up oxygen and release carbon dioxide" }, { "id": "R-SSC-1475029", "name": "Reversible hydration of carbon dioxide", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1475029", "resource": "Reactome", "description": "Reversible hydration of carbon dioxide" } ], "orthologs": [ { "uniprot_canonical_ac": "B0BNN3-1", "protein_name": "Carbonic anhydrase 1", "gene_name": "Ca1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF", "length": 261 }, "evidence": [ { "id": "A0A287AI92", "url": "https://omabrowser.org/oma/group/A0A287AI92/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P00915-1", "protein_name": "Carbonic anhydrase 1", "gene_name": "CA1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF", "length": 261 }, "evidence": [ { "id": "A0A287AI92", "url": "https://omabrowser.org/oma/group/A0A287AI92/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P13634-1", "protein_name": "Carbonic anhydrase 1", "gene_name": "Ca1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASADWGYGSENGPDQWSKLYPIANGNNQSPIDIKTSEANHDSSLKPLSISYNPATAKEIVNVGHSFHVIFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGTRYSGELHLVHWNSAKYSSASEAISKADGLAILGVLMKVGPANPSLQKVLDALNSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF", "length": 261 }, "evidence": [ { "id": "A0A287AI92", "url": "https://omabrowser.org/oma/group/A0A287AI92/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92" } ], "pmid": "" }, { "name": "carbonate dehydratase activity", "id": "GO:0004089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004089", "evidence": [ { "database": "UniProtKB", "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92" } ], "pmid": "" }, { "name": "arylesterase activity", "id": "GO:0004064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004064", "evidence": [ { "database": "UniProtKB", "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92" } ], "pmid": "" }, { "name": "hydro-lyase activity", "id": "GO:0016836", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016836", "evidence": [ { "database": "UniProtKB", "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92" } ], "pmid": "" }, { "name": "cyanamide hydratase activity", "id": "GO:0018820", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018820", "evidence": [ { "database": "UniProtKB", "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "one-carbon metabolic process", "id": "GO:0006730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006730", "evidence": [ { "database": "UniProtKB", "id": "A0A287AI92", "url": "https://www.uniprot.org/uniprot/A0A287AI92" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 216, "end_pos": 218, "annotation": "n_glycosylation_sequon" }, { "start_pos": 28, "end_pos": 30, "annotation": "n_glycosylation_sequon" }, { "start_pos": 76, "end_pos": 78, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10748", "name": "", "equation": "H(+) + hydrogencarbonate = CO2 + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "10748", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10748" } ] }, { "id": "23056", "name": "", "equation": "urea = cyanamide + H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "23056", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/23056" } ] }, { "id": "R-SSC-1475022", "name": "Carbonic anhydrase dehydrates bicarbonate (cytosol)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-111627" ], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-1475022", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1475022" } ] }, { "id": "R-SSC-1475026", "name": "Carbonic anhydrase hydrates carbon dioxide (cytosol)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-1475026", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1475026" } ] }, { "id": "R-SSC-1475435", "name": "CA1:Zn2+,CA2:Zn2+ hydrate CO2 to HCO3-", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-1475435", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1475435" } ] }, { "id": "R-SSC-1475436", "name": "CA1:Zn2+,CA2:Zn2+ dehydrate HCO3- to CO2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-1475436", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-1475436" } ] }, { "id": "R-SSC-9707419", "name": "CA1:Zn2+,CA2:Zn2+ bind CA inhibitors", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "R-SSC-9707419", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-SSC-9707419" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-111627", "participant_name": "HCO3- [cytosol]", "crossref": [ { "id": "C00288", "database": "COMPOUND", "url": "" }, { "id": "17544", "database": "ChEBI", "url": "" }, { "id": "000006827693", "database": "ZINC", "url": "" }, { "id": "11533114", "database": "PubChem Substance", "url": "" }, { "id": "C00288", "database": "COMPOUND", "url": "" }, { "id": "17544", "database": "ChEBI", "url": "" }, { "id": "000006827693", "database": "ZINC", "url": "" }, { "id": "11533114", "database": "PubChem Substance", "url": "" }, { "id": "C00288", "database": "COMPOUND", "url": "" }, { "id": "17544", "database": "ChEBI", "url": "" }, { "id": "000006827693", "database": "ZINC", "url": "" }, { "id": "11533114", "database": "PubChem Substance", "url": "" }, { "id": "C00288", "database": "COMPOUND", "url": "" }, { "id": "17544", "database": "ChEBI", "url": "" }, { "id": "000006827693", "database": "ZINC", "url": "" }, { "id": "11533114", "database": "PubChem Substance", "url": "" }, { "id": "C00288", "database": "COMPOUND", "url": "" }, { "id": "17544", "database": "ChEBI", "url": "" }, { "id": "000006827693", "database": "ZINC", "url": "" }, { "id": "11533114", "database": "PubChem Substance", "url": "" }, { "id": "C00288", "database": "COMPOUND", "url": "" }, { "id": "17544", "database": "ChEBI", "url": "" }, { "id": "000006827693", "database": "ZINC", "url": "" }, { "id": "11533114", "database": "PubChem Substance", "url": "" }, { "id": "C00288", "database": "COMPOUND", "url": "" }, { "id": "17544", "database": "ChEBI", "url": "" }, { "id": "000006827693", "database": "ZINC", "url": "" }, { "id": "11533114", "database": "PubChem Substance", "url": "" }, { "id": "C00288", "database": "COMPOUND", "url": "" }, { "id": "17544", "database": "ChEBI", "url": "" }, { "id": "000006827693", "database": "ZINC", "url": "" }, { "id": "11533114", "database": "PubChem Substance", "url": "" } ] } ], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 216, "end_pos": 218 }, { "start_pos": 28, "end_pos": 30 }, { "start_pos": 76, "end_pos": 78 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }