{ "bcoid": "GLY_000444", "title": "SARS-CoV2 Protein Site Annotation", "description": "The SARS coronavirus (SARS-CoV-2 or 2019-nCov) Protein Site Annotation (UniProtKB) dataset contains sarscov2 ...", "filename": "sarscov2_protein_site_annotation_uniprotkb.csv", "filetype": "csv", "categories": { "species": [ "Severe acute respiratory syndrome coronavirus 2" ], "molecule": [ "Protein" ], "tag": [ "site annotation" ], "file_type": [ "csv" ], "status": [ "Reviewed" ], "scope": [ "internal" ] }, "minitable": { "content": [ [ "P0DTC7-1...", "..." ], [ "P0DTC7-1...", "..." ] ], "headers": [ "uniprotkb_ca...", "gene_symbol..." ], "colwidth": [ "40%", "20%" ] }, "sampledata": { "type": "table", "data": [ [ { "type": "string", "label": "uniprotkb_canonical_ac" }, { "type": "string", "label": "gene_symbol" }, { "type": "string", "label": "ann_type" }, { "type": "string", "label": "start_pos" }, { "type": "string", "label": "end_pos" }, { "type": "string", "label": "annotation" }, { "type": "string", "label": "ecoid" }, { "type": "string", "label": "ref_aa" }, { "type": "string", "label": "alt_aa" }, { "type": "string", "label": "xref_key" }, { "type": "string", "label": "xref_id" } ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "85", "85", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "85", "85", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_pubmed", "33473190" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "53", "53", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "53", "53", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_pubmed", "33473190" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "119", "119", "Complete loss of ubiquitination. Partial loss of interferon pathway inhibition.", "ECO_0000269", "K", "A", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "119", "119", "Complete loss of ubiquitination. Partial loss of interferon pathway inhibition.", "ECO_0000269", "K", "A", "protein_xref_pubmed", "33473190" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "2", "2", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "2", "2", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_pubmed", "33473190" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "32", "32", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "32", "32", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_pubmed", "33473190" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "117", "117", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "117", "117", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_pubmed", "33473190" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "117", "119", "Complete loss of MHC-I retention in ER.", "ECO_0000269", "KRK", "ARA", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "117", "119", "Complete loss of MHC-I retention in ER.", "ECO_0000269", "KRK", "ARA", "protein_xref_pubmed", "36574644" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "72", "72", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Mutagenesis_Annotation", "72", "72", "No effect on ubiquitination.", "ECO_0000269", "K", "A", "protein_xref_pubmed", "33473190" ], [ "P0DTC7-1", "", "Natural_Variant_Annotation", "14", "14", "In strain: Alpha/B.1.1.7.", "ECO_0000305", "T", "I", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Natural_Variant_Annotation", "14", "14", "In strain: Alpha/B.1.1.7.", "ECO_0000305", "T", "I", "protein_xref_pubmed", "33413740" ], [ "P0DTC7-1", "", "Natural_Variant_Annotation", "120", "120", "In strain; Delta/B.1.617.2.", "", "T", "I", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC7-1", "", "Natural_Variant_Annotation", "82", "82", "In strain: Delta/B.1.617.2 and Kappa/B.1.617.1 .", "", "V", "A", "protein_xref_uniprotkb", "P0DTC7" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "61", "61", "Does not affect repression of reporter protein expression.", "ECO_0000269", "D", "DYP", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "61", "61", "Does not affect repression of reporter protein expression.", "ECO_0000269", "D", "DYP", "protein_xref_pubmed", "33849972" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "58", "58", "Complete loss of binding to the NUP98-RAE1 complex and IFN antagonistic function.", "ECO_0000269", "M", "R", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "58", "58", "Complete loss of binding to the NUP98-RAE1 complex and IFN antagonistic function.", "ECO_0000269", "M", "R", "protein_xref_pubmed", "35096974" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "58", "58", "Complete loss of binding to the NUP98-RAE1 complex and IFN antagonistic function.", "ECO_0000269", "M", "R", "protein_xref_pubmed", "33097660" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "58", "58", "Loss of interaction with human NUP98-RAE1 complex which suppresses the mRNA accumulation in the nucleus, the down-regulation of protein expression of newly transcribed genes in the host cell and blockade on nuclear import on a broad range of host factors.", "ECO_0000269", "M", "A", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "58", "58", "Loss of interaction with human NUP98-RAE1 complex which suppresses the mRNA accumulation in the nucleus, the down-regulation of protein expression of newly transcribed genes in the host cell and blockade on nuclear import on a broad range of host factors.", "ECO_0000269", "M", "A", "protein_xref_pubmed", "35096974" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "58", "58", "Loss of interaction with human NUP98-RAE1 complex which suppresses the mRNA accumulation in the nucleus, the down-regulation of protein expression of newly transcribed genes in the host cell and blockade on nuclear import on a broad range of host factors.", "ECO_0000269", "M", "A", "protein_xref_pubmed", "33849972" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "50", "61", "Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell.", "ECO_0000269", "SQLDEEQPMEID", "", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "50", "61", "Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell.", "ECO_0000269", "SQLDEEQPMEID", "", "protein_xref_pubmed", "33849972" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "38", "61", "Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell.", "ECO_0000269", "KNLSKSLTENKYSQLDEEQPMEID", "", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "38", "61", "Loss of interaction with human NUP98-RAE1 complex which suppresses the down-regulation of protein expression of newly transcribed genes in the host cell.", "ECO_0000269", "KNLSKSLTENKYSQLDEEQPMEID", "", "protein_xref_pubmed", "33849972" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "18", "24", "Complete loss of Golgi localization.", "ECO_0000269", "IMRTFKV", "", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "18", "24", "Complete loss of Golgi localization.", "ECO_0000269", "IMRTFKV", "", "protein_xref_pubmed", "35187564" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "1", "16", "Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell.", "ECO_0000269", "MFHLVDFQVTIAEILL", "", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "1", "16", "Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell.", "ECO_0000269", "MFHLVDFQVTIAEILL", "", "protein_xref_pubmed", "33849972" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "22", "30", "Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell.", "ECO_0000269", "FKVSIWNLD", "", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "22", "30", "Retains interaction with human NUP98-RAE1 complex. Increases down-regulation of protein expression of newly transcribed genes in host cell.", "ECO_0000269", "FKVSIWNLD", "", "protein_xref_pubmed", "33849972" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "18", "24", "Complete loss of Golgi localization.", "ECO_0000269", "IMRTFKV", "AAAAAAA", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Mutagenesis_Annotation", "18", "24", "Complete loss of Golgi localization.", "ECO_0000269", "IMRTFKV", "AAAAAAA", "protein_xref_pubmed", "35187564" ], [ "P0DTC6-1", "", "Natural_Variant_Annotation", "61", "61", "In strain: Omicron/BA.2, Omicron/BA.2.12.1, Omicron/BA.2.75, Omicron/BA.4, Omicron/BQ.1.1, Omicron/XBB.1.5.", "", "D", "L", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Natural_Variant_Annotation", "3", "3", "In strain: Eta/B.1.525.", "", "H", "", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC6-1", "", "Natural_Variant_Annotation", "2", "2", "In strain: Eta/B.1.525.", "", "F", "H", "protein_xref_uniprotkb", "P0DTC6" ], [ "P0DTC5-1", "", "Glycosylation_Annotation", "5", "5", "N-linked (GlcNAc...) asparagine; by host", "ECO_0000250", "N", "", "protein_xref_uniprotkb", "P0DTC5" ], [ "P0DTC5-1", "", "Glycosylation_Annotation", "5", "5", "N-linked (GlcNAc...) asparagine; by host", "ECO_0000250", "N", "", "protein_xref_pubmed", "P59596" ], [ "P0DTC5-1", "", "Natural_Variant_Annotation", "3", "3", "In strain: Omicron/BA.5, Omicron/BQ.1.1.", "", "D", "N", "protein_xref_uniprotkb", "P0DTC5" ], [ "P0DTC5-1", "", "Natural_Variant_Annotation", "19", "19", "In strain: Omicron/BA.1, Omicron/BA.2, Omicron/BA.2.12.1, Omicron/BA.2.75, Omicron/BA.4, Omicron/BA.5, Omicron/BQ.1.1, Omicron/XBB.1.5.", "", "Q", "E", "protein_xref_uniprotkb", "P0DTC5" ], [ "P0DTC5-1", "", "Natural_Variant_Annotation", "63", "63", "In strain: Omicron/BA.1, Omicron/BA.2, Omicron/BA.2.12.1, Omicron/BA.2.75, Omicron/BA.4, Omicron/BA.5, Omicron/BQ.1.1, Omicron/XBB.1.5.", "", "A", "T", "protein_xref_uniprotkb", "P0DTC5" ], [ "P0DTC5-1", "", "Natural_Variant_Annotation", "3", "3", "In strain: Omicron/BA.1.", "", "D", "G", "protein_xref_uniprotkb", "P0DTC5" ], [ "P0DTC5-1", "", "Natural_Variant_Annotation", "82", "82", "In strain: Eta/B.1.525 and Delta/B.1.617.2.", "", "I", "T", "protein_xref_uniprotkb", "P0DTC5" ], [ "P0DTC4-1", "E", "Mutagenesis_Annotation", "71", "71", "Complete loss of interaction with host PARD3 and MLLT4. Partial loss of interaction with host ZO1.", "ECO_0000269", "P", "L", "protein_xref_uniprotkb", "P0DTC4" ], [ "P0DTC4-1", "E", "Mutagenesis_Annotation", "71", "71", "Complete loss of interaction with host PARD3 and MLLT4. Partial loss of interaction with host ZO1.", "ECO_0000269", "P", "L", "protein_xref_pubmed", "35283834" ], [ "P0DTC4-1", "E", "Natural_Variant_Annotation", "11", "11", "In strain: Omicron/XBB.1.5.", "", "T", "A", "protein_xref_uniprotkb", "P0DTC4" ], [ "P0DTC4-1", "E", "Natural_Variant_Annotation", "21", "21", "In strain: Eta/B.1.525.", "", "L", "F", "protein_xref_uniprotkb", "P0DTC4" ], [ "P0DTC4-1", "E", "Natural_Variant_Annotation", "9", "9", "In strain: Omicron/BA.1, Omicron/BA.2, Omicron/BA.2.12.1, Omicron/BA.2.75, Omicron/BA.4, Omicron/BA.5, Omicron/BQ.1.1, Omicron/XBB.1.5.", "", "T", "I", "protein_xref_uniprotkb", "P0DTC4" ], [ "P0DTC4-1", "E", "Natural_Variant_Annotation", "71", "71", "In strain: Beta/B.1.351.", "", "P", "L", "protein_xref_uniprotkb", "P0DTC4" ], [ "P0DTC3-1", "", "Site_Annotation", "133", "133", "Involved in polymerization", "ECO_0000250", "C", "", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Site_Annotation", "133", "133", "Involved in polymerization", "ECO_0000250", "C", "", "protein_xref_pubmed", "P59632" ], [ "P0DTC3-1", "", "Glycosylation_Annotation", "32", "32", "O-linked (GalNAc...) threonine; by host", "ECO_0000250", "T", "", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Glycosylation_Annotation", "32", "32", "O-linked (GalNAc...) threonine; by host", "ECO_0000250", "T", "", "protein_xref_pubmed", "P59632" ], [ "P0DTC3-1", "", "Glycosylation_Annotation", "34", "34", "O-linked (GalNAc...) threonine; by host", "", "T", "", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Mutagenesis_Annotation", "57", "57", "No effect on ion permeability.", "ECO_0000269", "Q", "H", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Mutagenesis_Annotation", "57", "57", "No effect on ion permeability.", "ECO_0000269", "Q", "H", "protein_xref_pubmed", "34158638" ], [ "P0DTC3-1", "", "Mutagenesis_Annotation", "1", "41", "Partial loss of Ca(2+) and NMDG(+) permeability. Increased localization at host plasma membrane.", "ECO_0000269", "MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASL", "", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Mutagenesis_Annotation", "1", "41", "Partial loss of Ca(2+) and NMDG(+) permeability. Increased localization at host plasma membrane.", "ECO_0000269", "MDLFMRIFTIGTVTLKQGEIKDATPSDFVRATATIPIQASL", "", "protein_xref_pubmed", "34158638" ], [ "P0DTC3-1", "", "Mutagenesis_Annotation", "116", "116", "Partial loss of Ca(2+) and NMDG(+) permeability.", "ECO_0000269", "Q", "L", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Mutagenesis_Annotation", "116", "116", "Partial loss of Ca(2+) and NMDG(+) permeability.", "ECO_0000269", "Q", "L", "protein_xref_pubmed", "34158638" ], [ "P0DTC3-1", "", "Mutagenesis_Annotation", "57", "58", "Partial loss of Ca(2+) and NMDG(+) permeability.", "ECO_0000269", "QS", "EL", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Mutagenesis_Annotation", "57", "58", "Partial loss of Ca(2+) and NMDG(+) permeability.", "ECO_0000269", "QS", "EL", "protein_xref_pubmed", "34158638" ], [ "P0DTC3-1", "", "Natural_Variant_Annotation", "26", "26", "In strain: Delta/B.1.617.2 and Kappa/B.1.617.1.", "", "S", "L", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Natural_Variant_Annotation", "171", "171", "In strain: Beta/B.1.351.", "", "S", "L", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Natural_Variant_Annotation", "257", "257", "In strain: Mu/B.1.621.", "", "N", "", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Natural_Variant_Annotation", "42", "42", "In strain: Iota/B.1.526.", "", "P", "L", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Natural_Variant_Annotation", "57", "57", "In strain: Beta/B.1.351, Epsilon/B.1.429, Iota/B.1.526 and Mu/B.1.621.", "", "Q", "H", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Natural_Variant_Annotation", "223", "223", "In strain: Omicron/BA.2, Omicron/BA.2.12.1, Omicron/BA.2.75, Omicron/BA.4, Omicron/BA.5, Omicron/BQ.1.1, Omicron/XBB.1.5.", "", "T", "I", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC3-1", "", "Natural_Variant_Annotation", "253", "253", "In strain: Gamma/P.1.", "", "S", "P", "protein_xref_uniprotkb", "P0DTC3" ], [ "P0DTC2-1", "S", "Site_Annotation", "815", "816", "Cleavage; by host TMPRSS2 or CTSL", "ECO_0000255", "RS", "", "protein_xref_uniprotkb", "P0DTC2" ], [ "P0DTC2-1", "S", "Site_Annotation", "815", "816", "Cleavage; by host TMPRSS2 or CTSL", "ECO_0000255", "RS", "", "protein_xref_pubmed", "MF_04099" ], [ "P0DTC2-1", "S", "Site_Annotation", "815", "816", "Cleavage; by host TMPRSS2 or CTSL", "ECO_0000269", "RS", "", "protein_xref_uniprotkb", "P0DTC2" ], [ "P0DTC2-1", "S", "Site_Annotation", "815", "816", "Cleavage; by host TMPRSS2 or CTSL", "ECO_0000269", "RS", "", "protein_xref_pubmed", "32703818" ], [ "P0DTC2-1", "S", "Site_Annotation", "815", "816", "Cleavage; by host TMPRSS2 or CTSL", "ECO_0000269", "RS", "", "protein_xref_pubmed", "34159616" ], [ "P0DTC2-1", "S", "Site_Annotation", "685", "686", "Cleavage; by host furin", "ECO_0000269", "RS", "", "protein_xref_uniprotkb", "P0DTC2" ], [ "P0DTC2-1", "S", "Site_Annotation", "685", "686", "Cleavage; by host furin", "ECO_0000269", "RS", "", "protein_xref_pubmed", "34159616" ], [ "P0DTC2-1", "S", "Site_Annotation", "685", "686", "Cleavage; by host furin", "ECO_0000269", "RS", "", "protein_xref_pubmed", "32142651" ] ] }, "readme": "Name\n - SARS-CoV2 Protein Site Annotation\n\nVersion\n - v-2.2.1\n\nCreated on\n - 2020-04-03T11:59:02.009860\n\nModified on\n - 2022-09-26T09:05:56.488840\n\nCreated by\n - Jeet Vora [jeetvora@gwu.edu], Robel Kahsay [rykahsay@gwu.edu], Karina Martinez [karinamartinez@gwu.edu], Jingyue Wu [jingyue.wu@email.gwu.edu]\n\nAuthors\n - Maria Martin [martin@ebi.ac.uk], Preethi Vasudev [pvasudev@ebi.ac.uk]\n\nChecksum\n - \n\nUsability Domain\n - The SARS coronavirus (SARS-CoV-2 or 2019-nCov) Protein Site Annotation (UniProtKB) dataset contains sarscov2 [taxid:2697049] site annotations for UniProtKB canonical accessions. The dataset contains information about UniProtKB annotations with their amino acid range. The dataset is derived form 2019-09 UniprotKB release. If you use this dataset please give proper attribution to UniProtKB and GlyGen\n\nDescription Domain\n Keywords\n - site annotation\n - amino acid range\n - UniProtKB\n\n Pipeline Steps\n - Step-1: The script extracts the site annotation triples from the triplestore for the UniProtKB canonical sequences and extracts as a dataset in a csv format.\n\nExecution Domain\n Scripts - https://github.com/glygener/glygen-backend-integration/blob/master/dataset-maker/make-protein-dataset.py\n\n\n Software Prerequisites\n Name: Python\n Version: 2.7.5\n URI: https://www.python.org/download/releases/2.7.5/\n\nI/O Domain\n Input Subdomain\n Name: sarscov2_protein_masterlist.csv\n URI: https:/data.glygen.org/ln2releases/data/v-2.2.1/reviewed/sarscov2_protein_masterlist.csv\n Name: uniprot-proteome-sars-cov-2.nt\n URI: https:/data.glygen.org/ln2downloads/ebi/2023_10_30/uniprot-proteome-sars-cov-2.nt\n Output Subdomain\n Name: sarscov2_protein_site_annotation_uniprotkb.csv\n URI: https:/data.glygen.org/ln2releases/data/v-2.2.1/reviewed/sarscov2_protein_site_annotation_uniprotkb.csv\n Name: sarscov2_protein_site_annotation_uniprotkb.stat.csv\n URI: https:/data.glygen.org/ln2releases/data/v-2.2.1/reviewed/sarscov2_protein_site_annotation_uniprotkb.stat.csv\n\nFields\n Name: \"uniprotkb_canonical_ac\"\n Description: \"\"\n Unique Values: \"13\"\n Name: \"gene_symbol\"\n Description: \"\"Official gene name/symbol assigned to the gene. Human gene names/symbols are approved by the HUGO Gene Nomenclature Committee (HGNC)\"\n Unique Values: \"5\"\n Name: \"ann_type\"\n Description: \"Annotation Type\"\n Unique Values: \"7\"\n Name: \"start_pos\"\n Description: \"Start position of the gene on the chromosome\"\n Unique Values: \"288\"\n Name: \"end_pos\"\n Description: \"End position of the gene on the chromosome\"\n Unique Values: \"290\"\n Name: \"annotation\"\n Description: \"Function annotation from UniProtKB|RefSeq database\"\n Unique Values: \"178\"\n Name: \"ecoid\"\n Description: \"Evidence & Conclusion Ontology (ECO) identifier\"\n Unique Values: \"5\"\n Name: \"ref_aa\"\n Description: \"Reference amino acid residue\"\n Unique Values: \"61\"\n Name: \"alt_aa\"\n Description: \"Altered amino acid residue\"\n Unique Values: \"34\"\n Name: \"xref_key\"\n Description: \"Source key associated to the xref_id\"\n Unique Values: \"2\"\n Name: \"xref_id\"\n Description: \"ID of the X-ref\"\n Unique Values: \"80\"", "downloadurl": "/ln2data/releases/data/v-2.2.1/reviewed/sarscov2_protein_site_annotation_uniprotkb.csv" }