[ { "uniprot_canonical_ac": "P01266-1", "uniprot_ac": "P01266", "uniprot_id": "THYG_HUMAN", "mass": { "chemical_mass": 304790.0, "monoisotopic_mass": 304790.0 }, "refseq": { "ac": "NP_003226", "name": "thyroglobulin precursor", "summary": "Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis. [provided by RefSeq, Nov 2009].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" }, "gene_names": [ { "name": "TG", "type": "recommended", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" } ] }, { "name": "AITD3", "type": "synonym", "evidence": [ { "id": "NP_003226", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ] }, { "name": "TGN", "type": "synonym", "evidence": [ { "id": "NP_003226", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ] }, { "name": "TG", "type": "synonym", "evidence": [ { "id": "NP_003226", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ] } ], "protein_names": [ { "name": "Thyroglobulin", "type": "recommended", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#names_and_taxonomy" } ] }, { "name": "Tg", "type": "synonym", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#names_and_taxonomy" } ] }, { "name": "thyroglobulin precursor", "type": "synonym", "evidence": [ { "id": "NP_003226", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ] }, { "name": "thyroid hormones", "type": "synonym", "evidence": [ { "id": "NP_003226", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ] } ], "function": [ { "annotation": "Acts as a substrate for the production of iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3) (PubMed:17532758, PubMed:32025030). The synthesis of T3 and T4 involves iodination of selected tyrosine residues of TG/thyroglobulin followed by their oxidative coupling in the thyroid follicle lumen (PubMed:32025030). Following TG re-internalization and lysosomal-mediated proteolysis, T3 and T4 are released from the polypeptide backbone leading to their secretion into the bloodstream (PubMed:32025030). One dimer produces 7 thyroid hormone molecules (PubMed:32025030).", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266#function" }, { "database": "PubMed", "id": "17532758", "url": "https://glygen.org/publication/PubMed/17532758" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "annotation": "Diagnostic value of thyroglobulin washout in fine-needle aspiration samples for diagnosis and follow-up of differentiated thyroid cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" }, { "database": "PubMed", "id": "38065908", "url": "https://glygen.org/publication/PubMed/38065908" } ] }, { "annotation": "Lymph node ratio independently associated with postoperative thyroglobulin levels in papillary thyroid cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" }, { "database": "PubMed", "id": "37690364", "url": "https://glygen.org/publication/PubMed/37690364" } ] }, { "annotation": "Serum thyroglobulin as a biomarker of iodine excess and thyroid disease occurrence in adults.", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" }, { "database": "PubMed", "id": "37043922", "url": "https://glygen.org/publication/PubMed/37043922" } ] }, { "annotation": "The p.Cys1281Tyr variant in the hinge module/flap region of thyroglobulin causes intracellular transport disorder and congenital hypothyroidism.", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" }, { "database": "PubMed", "id": "37164149", "url": "https://glygen.org/publication/PubMed/37164149" } ] }, { "annotation": "Thyroglobulin (Tg) is a glycoprotein homodimer produced predominantly by the thryroid gland. It acts as a substrate for the synthesis of thyroxine and triiodothyronine as well as the storage of the inactive forms of thyroid hormone and iodine. Thyroglobulin is secreted from the endoplasmic reticulum to its site of iodination, and subsequent thyroxine biosynthesis, in the follicular lumen. Mutations in this gene cause thyroid dyshormonogenesis, manifested as goiter, and are associated with moderate to severe congenital hypothyroidism. Polymorphisms in this gene are associated with susceptibility to autoimmune thyroid diseases (AITD) such as Graves disease and Hashimoto thryoiditis. [provided by RefSeq, Nov 2009].", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ] }, { "annotation": "[Analysis of pre-ablative and preoperative thyroglobulin in differentiated thyroid cancer].", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" }, { "database": "PubMed", "id": "37906818", "url": "https://glygen.org/publication/PubMed/37906818" } ] } ], "disease": [ { "disease_id": "DOID:0050328", "recommended_name": { "id": "DOID:0050328", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0050328", "name": "congenital hypothyroidism", "description": "A hypothyroidism that is present at birth." }, "synonyms": [ { "id": "MONDO:0010142", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010142", "name": "hypothyroidism due to TSH receptor mutations", "description": "Hypothyroidism due to thyroid-stimulating hormone (TSH) receptor mutations is a type of primary congenital hypothyroidism, a permanent thyroid hormone deficiency that is present from birth due to thyroid resistance to TSH." }, { "id": "MONDO:0010142", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010142", "name": "CHNG1", "description": "" }, { "id": "MONDO:0010142", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010142", "name": "TSH resistance", "description": "" }, { "id": "MONDO:0010142", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010142", "name": "hypothyroidism, congenital, nongoitrous, type 1", "description": "" }, { "id": "MONDO:0010142", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010142", "name": "hypothyroidism, congenital, nongoitrous, 1", "description": "" }, { "id": "MIM:275200", "resource": "MIM", "url": "https://www.omim.org/entry/275200", "name": "Hypothyroidism, congenital, non-goitrous, 1", "description": "Hypothyroidism, congenital, non-goitrous, 1" } ], "unlinked_id_list": [ "DOID:0112183" ], "evidence": [ { "id": "0050328", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050328" } ] }, { "disease_id": "DOID:0060870", "recommended_name": { "id": "DOID:0060870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060870", "name": "isolated growth hormone deficiency", "description": "A hypopituitarism characterized by abnormally low levels, absence or impaired function of growth hormone in the absence of abnormalities in other pituitary hormones." }, "synonyms": [ { "id": "DOID:0060870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060870", "name": "IGHD", "description": "" }, { "id": "DOID:0060870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060870", "name": "congenital IGHD", "description": "" }, { "id": "DOID:0060870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060870", "name": "congenital isolated GH deficiency", "description": "" }, { "id": "DOID:0060870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060870", "name": "congenital isolated growth hormone deficiency", "description": "" }, { "id": "DOID:0060870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060870", "name": "familial isolated growth hormone deficiency", "description": "" }, { "id": "DOID:0060870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060870", "name": "non-acquired isolated growth hormone deficiency", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "0060870", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060870" } ] }, { "disease_id": "DOID:0080208", "recommended_name": { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated steatotic liver disease", "description": "A steatotic liver disease characterized by at least one of five specified cardiometabolic risk factors and no other discernible cause with normal to no alcohol use. The five cardiometabolic risk factors are: (1) higher than normal body mass index or waist circumference; (2) higher than normal serum glucose or glycated hemoglobin level, or type 2 diabetes; (3) higher than normal blood pressure or hypertensive treatment; (4) higher than normal plasma triglycerides or lipid lowering treatment; and (5) lower than normal plasma high-density lipoprotein cholesterol." }, "synonyms": [ { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080208", "name": "nonalcoholic fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080208", "name": "non-alcoholic fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080208", "name": "NAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-associated fatty liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080208", "name": "metabolic dysfunction-related steatotic liver disease", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080208", "name": "MAFLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080208", "name": "MASLD", "description": "" }, { "id": "DOID:0080208", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080208", "name": "metabolic-associated fatty liver disease", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "NAFLD2", "description": "" }, { "id": "MONDO:0013246", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013246", "name": "fatty liver disease, nonalcoholic, susceptibility to, 2", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "NAFLD1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "fatty liver disease, nonalcoholic, susceptibility to, 1", "description": "" }, { "id": "MONDO:0021105", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0021105", "name": "liver disease, alcoholic, susceptibility to, 1", "description": "" }, { "id": "MIM:613282", "resource": "MIM", "url": "https://www.omim.org/entry/613282", "name": "Non-alcoholic fatty liver disease 1", "description": "Non-alcoholic fatty liver disease 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0080208", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080208" } ] }, { "disease_id": "DOID:0112187", "recommended_name": { "id": "DOID:0112187", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0112187", "name": "thyroid dyshormonogenesis 3", "description": "A familial thyroid dyshormonogenesis that has_material_basis_in homozygous or compound heterozygous mutation in TG on chromosome 8q24.22." }, "synonyms": [ { "id": "DOID:0112187", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0112187", "name": "TDH3", "description": "" }, { "id": "DOID:0112187", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0112187", "name": "genetic defect in thyroid hormonogenesis 3", "description": "" }, { "id": "MONDO:0010135", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010135", "name": "thyroid dyshormonogenesis 3", "description": "Any familial thyroid dyshormonogenesis in which the cause of the disease is a mutation in the TG gene." }, { "id": "MONDO:0010135", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010135", "name": "TDH3", "description": "" }, { "id": "MONDO:0010135", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010135", "name": "TG familial thyroid dyshormonogenesis", "description": "" }, { "id": "MONDO:0010135", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010135", "name": "familial thyroid dyshormonogenesis caused by mutation in TG", "description": "" }, { "id": "MONDO:0010135", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010135", "name": "hypothyroidism, congenital, due to dyshormonogenesis, 3", "description": "" }, { "id": "MONDO:0010135", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010135", "name": "thyroid dyshormonogenesis 3", "description": "" }, { "id": "MONDO:0010135", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010135", "name": "thyroid dyshormonogenesis type 3", "description": "" }, { "id": "MONDO:0010135", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010135", "name": "thyroid hormonogenesis, genetic defect in, 3", "description": "" }, { "id": "MIM:274700", "resource": "MIM", "url": "https://www.omim.org/entry/274700", "name": "Thyroid dyshormonogenesis 3", "description": "Thyroid dyshormonogenesis 3" } ], "unlinked_id_list": [], "evidence": [ { "id": "274700", "database": "MIM", "url": "https://www.omim.org/entry/274700" }, { "id": "0112187", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0112187" } ] }, { "disease_id": "DOID:12176", "recommended_name": { "id": "DOID:12176", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:12176", "name": "goiter", "description": "A thyroid gland disease that involves an abnormal enlargement of the thyroid gland." }, "synonyms": [ { "id": "DOID:12176", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:12176", "name": "goitre", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "12176", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:12176" } ] }, { "disease_id": "DOID:12361", "recommended_name": { "id": "DOID:12361", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:12361", "name": "Graves' disease", "description": "An autoimmune disease of endocrine system that involves production of excessive amount of thyroid hormones, located_in thyroid gland." }, "synonyms": [ { "id": "DOID:12361", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:12361", "name": "Grave's disease", "description": "" }, { "id": "DOID:12361", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:12361", "name": "Graves disease", "description": "" }, { "id": "DOID:12361", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:12361", "name": "exophthalmic goiter", "description": "" }, { "id": "MONDO:0100489", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100489", "name": "Graves disease, susceptibility to, 1", "description": "" }, { "id": "MONDO:0100489", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100489", "name": "Graves disease, susceptibility to, 1", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "12361", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:12361" } ] }, { "disease_id": "DOID:14018", "recommended_name": { "id": "DOID:14018", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:14018", "name": "alcoholic liver cirrhosis", "description": "" }, "synonyms": [ { "id": "DOID:14018", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:14018", "name": "Alcoholic Cirrhosis", "description": "" }, { "id": "DOID:14018", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:14018", "name": "Alcoholic cirrhosis of liver", "description": "" }, { "id": "DOID:14018", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:14018", "name": "Laennec's cirrhosis", "description": "" }, { "id": "DOID:14018", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:14018", "name": "Laennec's cirrhosis, alcoholic", "description": "" }, { "id": "DOID:14018", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:14018", "name": "Portal cirrhosis", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "14018", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:14018" } ] }, { "disease_id": "DOID:1459", "recommended_name": { "id": "DOID:1459", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1459", "name": "hypothyroidism", "description": "A thyroid gland disease which involves an underproduction of thyroid hormone." }, "synonyms": [ { "id": "DOID:1459", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1459", "name": "Thyroid deficiency", "description": "" }, { "id": "DOID:1459", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1459", "name": "Thyroid insufficiency", "description": "" } ], "unlinked_id_list": [ "DOID:0112183" ], "evidence": [ { "id": "1459", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1459" } ] }, { "disease_id": "DOID:7188", "recommended_name": { "id": "DOID:7188", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:7188", "name": "autoimmune thyroiditis", "description": "An autoimmune disease of endocrine system that involves inflammation located_in thyroid gland caused by the immune system reacting against its own tissues." }, "synonyms": [ { "id": "DOID:7188", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:7188", "name": "Chronic Lymphocytic Thyroiditis", "description": "" }, { "id": "DOID:7188", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:7188", "name": "Hashimoto thyroiditis", "description": "" }, { "id": "DOID:7188", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:7188", "name": "Hashimoto's Disease", "description": "" }, { "id": "DOID:7188", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:7188", "name": "Hashimoto's syndrome", "description": "" }, { "id": "DOID:7188", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:7188", "name": "Hashimoto's thyroiditis", "description": "" }, { "id": "DOID:7188", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:7188", "name": "Lymphocytic Thyroiditis", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto thyroiditis", "description": "An autoimmune disorder caused by the production of autoantibodies against thyroid tissue. There is progressive destruction of the thyroid follicles leading to hypothyroidism." }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "lymphocytic thyroiditis", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto disease", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto hypothyroidism", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto thyroiditis", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto's disease", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto's syndrome", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto's thyroiditis", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "chronic lymphocytic thyroiditis", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "HT", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto struma", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto syndrome", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto thyroiditides", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto's struma", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimoto's syndromes", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimotos disease", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "Hashimotos syndrome", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "chronic lymphocytic thyroiditides", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "disease, Hashimoto", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "disease, Hashimoto's", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "hypothyroidism, autoimmune thyroid autoantibodies, included", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "lymphocytic thyroiditides, chronic", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "lymphocytic thyroiditis, chronic", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "syndrome, Hashimoto's", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "syndromes, Hashimoto's", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "thyroiditides, Hashimoto", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "thyroiditides, chronic lymphocytic", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "thyroiditis, Hashimoto", "description": "" }, { "id": "MONDO:0007699", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007699", "name": "thyroiditis, chronic lymphocytic", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "7188", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:7188" } ] }, { "disease_id": "MONDO:0011982", "recommended_name": { "id": "MONDO:0011982", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011982", "name": "autoimmune thyroid disease, susceptibility to, 3", "description": "" }, "synonyms": [ { "id": "MONDO:0011982", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011982", "name": "autoimmune thyroid disease, susceptibility to, 3", "description": "" }, { "id": "MONDO:0011982", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011982", "name": "autoimmune thyroid disease, susceptibility to, type 3", "description": "" }, { "id": "MONDO:0011982", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011982", "name": "AITD3", "description": "" }, { "id": "MIM:608175", "resource": "MIM", "url": "https://www.omim.org/entry/608175", "name": "Autoimmune thyroid disease 3", "description": "Autoimmune thyroid disease 3" } ], "unlinked_id_list": [], "evidence": [ { "id": "608175", "database": "MIM", "url": "https://www.omim.org/entry/608175" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 108, "end_pos": 108, "sequence_org": "Y", "sequence_mut": "F", "comment": "Severe loss of thyroxine (T4) production; when associated with F-149 or F-234, and F-2540 and F-2766. Abolishes thyroxine (T4) production; when associated with F-149, F-234, F-2540 and F-2766.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "start_pos": 1309, "end_pos": 1309, "sequence_org": "D", "sequence_mut": "S", "comment": "Abolishes thyroxine (T4) production.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "start_pos": 1310, "end_pos": 1310, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes thyroxine (T4) production; when associated with F-24, F-2573 and F-2766.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "start_pos": 149, "end_pos": 149, "sequence_org": "Y", "sequence_mut": "F", "comment": "Severe loss of thyroxine (T4) production; when associated with F-108, F-2540 and F-2766. Abolishes thyroxine (T4) production; when associated with F-108, F-234, F-2540 and F-2766.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "start_pos": 234, "end_pos": 234, "sequence_org": "Y", "sequence_mut": "F", "comment": "Severe loss of thyroxine (T4) production; when associated with F-108, F-2540 and F-2766. Abolishes thyroxine (T4) production; when associated with F-108, F-149, F-2540 and F-2766.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "start_pos": 24, "end_pos": 24, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes thyroxine (T4) production; when associated with F-1310, F-2573 and F-2766.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "start_pos": 2540, "end_pos": 2540, "sequence_org": "Y", "sequence_mut": "F", "comment": "Severe loss of thyroxine (T4) production; when associated with F-149 or F-234, and F-108 and F-2766. Abolishes thyroxine (T4) production; when associated with F-108, F-149, F-234 and F-2766.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "start_pos": 2573, "end_pos": 2573, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes thyroxine (T4) production; when associated with F-24, F-1310 and F-2766.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "start_pos": 2766, "end_pos": 2766, "sequence_org": "Y", "sequence_mut": "F", "comment": "Abolishes thyroxine (T4) production; when associated with F-24, F-1310 and F-2573.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "start_pos": 2766, "end_pos": 2766, "sequence_org": "Y", "sequence_mut": "F", "comment": "Severe loss of thyroxine (T4) production; when associated with F-149 or F-234, and F-108 and F-2540. Abolishes thyroxine (T4) production; when associated with F-108, F-149, F-234 and F-2540.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "75.8", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "44.98", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "48.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "73.48", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "71.91", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "60.2", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "62.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "69.75", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "81.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "72.39", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0700275", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700275", "name": "prostate cancer, hereditary", "description": "An instance of prostate cancer that is caused by an inherited genomic modification in an individual. Familial prostate cancer (FPC) is a malignant tumor of the prostate with an early onset. FPC is either asymptomatic or causes mictionary symptoms, erectile dysfunction, bone pain, venous compression and infectious or inflammatory syndrome (for the metastatic forms). It is also characterized by familial antecedents." }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:610997", "resource": "MIM", "url": "https://www.omim.org/entry/610997", "name": "Prostate cancer, hereditary, 9", "description": "Prostate cancer, hereditary, 9" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "GC", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ], "unlinked_id_list": [ "DOID:1542" ], "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ], "unlinked_id_list": [ "DOID:4765" ], "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ], "unlinked_id_list": [ "DOID:3017", "DOID:0050938" ], "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3973", "DOID:0080524", "DOID:0080525" ], "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3675", "DOID:4455" ], "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:9460", "DOID:5166", "DOID:2021", "DOID:4114" ], "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "P01266", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/P01266" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "gene": [ { "name": "TG", "url": "https://www.uniprot.org/uniprotkb/P01266", "locus": { "chromosome": "8", "start_pos": 133134903, "end_pos": 132866958, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000042832", "url": "https://www.ensembl.org/id/ENSG00000042832" } ] } } ], "crossref": [ { "id": "HGNC:11764", "url": "https://alliancegenome.org/gene/HGNC:11764", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "ENSG00000042832", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000042832", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "P01266", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/P01266", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00191", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00191", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "TG", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TG", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "7038", "url": "https://www.ncbi.nlm.nih.gov/gene/7038", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycomics" ] }, { "id": "11764", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:11764", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "7038", "url": "https://hpo.jax.org/browse/gene/NCBIGene:7038", "database": "HPO", "categories": [ "Other" ] }, { "id": "6SCJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6SCJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7B75", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7B75&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9I0O", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9I0O&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1028146", "url": "https://www.iedb.org/epitope/1028146", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1088591", "url": "https://www.iedb.org/epitope/1088591", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1088592", "url": "https://www.iedb.org/epitope/1088592", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1088593", "url": "https://www.iedb.org/epitope/1088593", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1088594", "url": "https://www.iedb.org/epitope/1088594", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1089189", "url": "https://www.iedb.org/epitope/1089189", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1089190", "url": "https://www.iedb.org/epitope/1089190", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1091210", "url": "https://www.iedb.org/epitope/1091210", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1091574", "url": "https://www.iedb.org/epitope/1091574", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1093375", "url": "https://www.iedb.org/epitope/1093375", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1093646", "url": "https://www.iedb.org/epitope/1093646", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1095078", "url": "https://www.iedb.org/epitope/1095078", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1097093", "url": "https://www.iedb.org/epitope/1097093", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1097352", "url": "https://www.iedb.org/epitope/1097352", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1102958", "url": "https://www.iedb.org/epitope/1102958", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1105533", "url": "https://www.iedb.org/epitope/1105533", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108635", "url": "https://www.iedb.org/epitope/1108635", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1108636", "url": "https://www.iedb.org/epitope/1108636", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1109186", "url": "https://www.iedb.org/epitope/1109186", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1109267", "url": "https://www.iedb.org/epitope/1109267", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1112418", "url": "https://www.iedb.org/epitope/1112418", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1113155", "url": "https://www.iedb.org/epitope/1113155", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1114797", "url": "https://www.iedb.org/epitope/1114797", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1117165", "url": "https://www.iedb.org/epitope/1117165", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1117166", "url": "https://www.iedb.org/epitope/1117166", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1117167", "url": "https://www.iedb.org/epitope/1117167", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1117599", "url": "https://www.iedb.org/epitope/1117599", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1117805", "url": "https://www.iedb.org/epitope/1117805", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1118097", "url": "https://www.iedb.org/epitope/1118097", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1118208", "url": "https://www.iedb.org/epitope/1118208", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1118722", "url": "https://www.iedb.org/epitope/1118722", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1118723", "url": "https://www.iedb.org/epitope/1118723", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1123874", "url": "https://www.iedb.org/epitope/1123874", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1123894", "url": "https://www.iedb.org/epitope/1123894", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1261064", "url": "https://www.iedb.org/epitope/1261064", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1302776", "url": "https://www.iedb.org/epitope/1302776", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1311321", "url": "https://www.iedb.org/epitope/1311321", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1311398", "url": "https://www.iedb.org/epitope/1311398", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1311401", "url": "https://www.iedb.org/epitope/1311401", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1311498", "url": "https://www.iedb.org/epitope/1311498", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1311511", "url": "https://www.iedb.org/epitope/1311511", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1311518", "url": "https://www.iedb.org/epitope/1311518", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1311526", "url": "https://www.iedb.org/epitope/1311526", "database": "IEDB", "categories": [ "Other" ] }, { "id": "133885", "url": "https://www.iedb.org/epitope/133885", "database": "IEDB", "categories": [ "Other" ] }, { "id": "144222", "url": "https://www.iedb.org/epitope/144222", "database": "IEDB", "categories": [ "Other" ] }, { "id": "144353", "url": "https://www.iedb.org/epitope/144353", "database": "IEDB", "categories": [ "Other" ] }, { "id": "144410", "url": "https://www.iedb.org/epitope/144410", "database": "IEDB", "categories": [ "Other" ] }, { "id": "144453", "url": "https://www.iedb.org/epitope/144453", "database": "IEDB", "categories": [ "Other" ] }, { "id": "144482", "url": "https://www.iedb.org/epitope/144482", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1609330", "url": "https://www.iedb.org/epitope/1609330", "database": "IEDB", "categories": [ "Other" ] }, { "id": "161231", "url": "https://www.iedb.org/epitope/161231", "database": "IEDB", "categories": [ "Other" ] }, { "id": "161258", "url": "https://www.iedb.org/epitope/161258", "database": "IEDB", "categories": [ "Other" ] }, { "id": "164764", "url": "https://www.iedb.org/epitope/164764", "database": "IEDB", "categories": [ "Other" ] }, { "id": "164765", "url": "https://www.iedb.org/epitope/164765", "database": "IEDB", "categories": [ "Other" ] }, { "id": "165257", "url": "https://www.iedb.org/epitope/165257", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1866643", "url": "https://www.iedb.org/epitope/1866643", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2004732", "url": "https://www.iedb.org/epitope/2004732", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2008394", "url": "https://www.iedb.org/epitope/2008394", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2013321", "url": "https://www.iedb.org/epitope/2013321", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2015889", "url": "https://www.iedb.org/epitope/2015889", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2031920", "url": "https://www.iedb.org/epitope/2031920", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2036004", "url": "https://www.iedb.org/epitope/2036004", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2037952", "url": "https://www.iedb.org/epitope/2037952", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2042813", "url": "https://www.iedb.org/epitope/2042813", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2052206", "url": "https://www.iedb.org/epitope/2052206", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2143913", "url": "https://www.iedb.org/epitope/2143913", "database": "IEDB", "categories": [ "Other" ] }, { "id": "39688", "url": "https://www.iedb.org/epitope/39688", "database": "IEDB", "categories": [ "Other" ] }, { "id": "506176", "url": "https://www.iedb.org/epitope/506176", "database": "IEDB", "categories": [ "Other" ] }, { "id": "772121", "url": "https://www.iedb.org/epitope/772121", "database": "IEDB", "categories": [ "Other" ] }, { "id": "P01266", "url": "https://www.ebi.ac.uk/intact/interactors/id:P01266*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000716", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000716", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002018", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002018", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011641", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011641", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016324", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016324", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019819", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019819", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036857", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036857", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051093", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051093", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051950", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051950", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR052001", "url": "https://www.ebi.ac.uk/interpro/entry/IPR052001", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7038", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:7038", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "188450", "url": "http://www.omim.org/entry/188450", "database": "MIM", "categories": [ "Other" ] }, { "id": "274700", "url": "http://www.omim.org/entry/274700", "database": "MIM", "categories": [ "Other" ] }, { "id": "608175", "url": "http://www.omim.org/entry/608175", "database": "MIM", "categories": [ "Other" ] }, { "id": "SIYVPQC", "url": "https://omabrowser.org/oma/group/SIYVPQC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "E5RG33", "url": "https://www.orthodb.org/?gene=E5RG33", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "E7EVM0", "url": "https://www.orthodb.org/?gene=E7EVM0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0YB42", "url": "https://www.orthodb.org/?gene=H0YB42", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0YBC5", "url": "https://www.orthodb.org/?gene=H0YBC5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0YBJ2", "url": "https://www.orthodb.org/?gene=H0YBJ2", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0YBL4", "url": "https://www.orthodb.org/?gene=H0YBL4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0YBQ6", "url": "https://www.orthodb.org/?gene=H0YBQ6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0YBR7", "url": "https://www.orthodb.org/?gene=H0YBR7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0YBY1", "url": "https://www.orthodb.org/?gene=H0YBY1", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "P01266", "url": "https://www.orthodb.org/?gene=P01266", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12352", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12352", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12352:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12352:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14093", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14093", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14093:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14093:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43903", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43903", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "pdb_00006scj", "url": "https://www.rcsb.org/structure/pdb_00006scj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007b75", "url": "https://www.rcsb.org/structure/pdb_00007b75", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009i0o", "url": "https://www.rcsb.org/structure/pdb_00009i0o", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6SCJ", "url": "https://www.rcsb.org/structure/6SCJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7B75", "url": "https://www.rcsb.org/structure/7B75", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9I0O", "url": "https://www.rcsb.org/structure/9I0O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00086", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00086", "database": "Pfam", "categories": [ "Other", "Protein Classification" ] }, { "id": "PF00135", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00135", "database": "Pfam", "categories": [ "Other", "Protein Classification" ] }, { "id": "PF07699", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07699", "database": "Pfam", "categories": [ "Other", "Protein Classification" ] }, { "id": "P01266", "url": "https://pharos.nih.gov/targets/P01266", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:P01266", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:P01266", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040", "database": "UniCarbKB", "categories": [] }, { "id": "E5RG33", "url": "https://www.uniprot.org/uniprotkb/E5RG33", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RG33-1", "url": "https://www.uniprot.org/uniprotkb/E5RG33-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EVM0", "url": "https://www.uniprot.org/uniprotkb/E7EVM0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EVM0-1", "url": "https://www.uniprot.org/uniprotkb/E7EVM0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YB42", "url": "https://www.uniprot.org/uniprotkb/H0YB42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YB42-1", "url": "https://www.uniprot.org/uniprotkb/H0YB42-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBC5", "url": "https://www.uniprot.org/uniprotkb/H0YBC5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBC5-1", "url": "https://www.uniprot.org/uniprotkb/H0YBC5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBJ2", "url": "https://www.uniprot.org/uniprotkb/H0YBJ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBJ2-1", "url": "https://www.uniprot.org/uniprotkb/H0YBJ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBL4", "url": "https://www.uniprot.org/uniprotkb/H0YBL4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBL4-1", "url": "https://www.uniprot.org/uniprotkb/H0YBL4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBQ6", "url": "https://www.uniprot.org/uniprotkb/H0YBQ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBQ6-1", "url": "https://www.uniprot.org/uniprotkb/H0YBQ6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBR7", "url": "https://www.uniprot.org/uniprotkb/H0YBR7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBR7-1", "url": "https://www.uniprot.org/uniprotkb/H0YBR7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBY1", "url": "https://www.uniprot.org/uniprotkb/H0YBY1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YBY1-1", "url": "https://www.uniprot.org/uniprotkb/H0YBY1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01266-1", "url": "https://www.uniprot.org/uniprotkb/P01266-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P01266-2", "url": "https://www.uniprot.org/uniprotkb/P01266-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQTVQCQNDGRSCWCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQCQDSGDYAPVQCDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSPPQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFPEVSGYCHCADSQGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRILQRRFLAVQSVISGRFRCPTKCEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTRQQGEPPSCAEGQSCASERQQALSRLYFGTSGYFSQHDLFSSPEKRWASPRVARFATSCPPTIKELFVDSGLLRPMVEGQSQQFSVSENLLKEAIRAIFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNVGQFNLSGALGTRGTFNFSQFFQQLGLASFLNGGRQEDLAKPLSVGLDSNSSTGTPEAAKKDGTMNKPTVGSFGFEINLQENQNALKFLASLLELPEFLLFLQHAISVPEDVARDLGDVMETVLSSQTCEQTPERLFVPSCTTEGSYEDVQCFSGECWCVNSWGKELPGSRVRGGQPRCPTDCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEGQAIPGTRSAIGKPKKCPTPCQLQSEQAFLRTVQALLSNSSMLPTLSDTYIPQCSTDGQWRQVQCNGPPEQVFELYQRWEAQNKGQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEAGQQDVFPVLSQYPSLQDVPLAALEGKRPQPRENILLEPYLFWQILNGQLSQYPGSYSDFSTPLAHFDLRNCWCVDEAGQELEGMRSEPSKLPTCPGSCEEAKLRVLQFIRETEEIVSASNSSRFPLGESFLVAKGIRLRNEDLGLPPLFPPREAFAEQFLRGSDYAIRLAAQSTLSFYQRRRFSPDDSAGASALLRSGPYMPQCDAFGSWEPVQCHAGTGHCWCVDEKGGFIPGSLTARSLQIPQCPTTCEKSRTSGLLSSWKQARSQENPSPKDLFVPACLETGEYARLQASGAGTWCVDPASGEELRPGSSSSAQCPSLCNVLKSGVLSRRVSPGYVPACRAEDGGFSPVQCDQAQGSCWCVMDSGEEVPGTRVTGGQPACESPRCPLPFNASEVVGGTILCETISGPTGSAMQQCQLLCRQGSWSVFPPGPLICSLESGRWESQLPQPRACQRPQLWQTIQTQGHFQLQLPPGKMCSADYADLLQTFQVFILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGSYSQDEECIPCPVGFYQEQAGSLACVPCPVGRTTISAGAFSQTHCVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLMMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTEDEACSFFTVSTTEPEISCDFYAWTSDNVACMTSDQKRDALGNSKATSFGSLRCQVKVRSHGQDSPAVYLKKGQGSTTTLQKRFEPTGFQNMLSGLYNPIVFSASGANLTDAHLFCLLACDRDLCCDGFVLTQVQGGAIICGLLSSPSVLLCNVKDWMDPSEAWANATCPGVTYDQESHQVILRLGDQEFIKSLTPLEGTQDTFTNFQQVYLWKDSDMGSRPESMGCRKDTVPRPASPTEAGLTTELFSPVDLNQVIVNGNQSLSSQKHWLFKHLFSAQQANLWCLSRCVQEHSFCQLAEITESASLYFTCTLYPEAQVCDDIMESNAQGCRLILPQMPKALFRKKVILEDKVKNFYTRLPFQKLMGISIRNKVPMSEKSISNGFFECERRCDADPCCTGFGFLNVSQLKGGEVTCLTLNSLGIQMCSEENGGAWRILDCGSPDIEVHTYPFGWYQKPIAQNNAPSFCPLVVLPSLTEKVSLDSWQSLALSSVVVDPSIRHFDVAHVSTAATSNFSAVRDLCLSECSQHEACLITTLQTQPGAVRCMFYADTQSCTHSLQGQNCRLLLREEATHIYRKPGISLLSYEASVPSVPISTHGRLLGRSQAIQVGTSWKQVDQFLGVPYAAPPLAERRFQAPEPLNWTGSWDASKPRASCWQPGTRTSTSPGVSEDCLYLNVFIPQNVAPNASVLVFFHNTMDREESEGWPAIDGSFLAAVGNLIVVTASYRVGVFGFLSSGSGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRVSLAADRGGADVASIHLLTARATNSQLFRRAVLMGGSALSPAAVISHERAQQQAIALAKEVSCPMSSSQEVVSCLRQKPANVLNDAQTKLLAVSGPFHYWGPVIDGHFLREPPARALKRSLWVEVDLLIGSSQDDGLINRAKAVKQFEESRGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRALENATRDYFIICPIIDMASAWAKRARGNVFMYHAPENYGHGSLELLADVQFALGLPFYPAYEGQFSLEEKSLSLKIMQYFSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK", "length": 2768, "header": "sp|P01266-1|THYG_HUMAN Isoform 1 of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=5 CANONICAL=P01266-1" }, "isoforms": [ { "isoform_ac": "E5RG33-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#E5RG33-1", "sequence": { "sequence": "MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQ", "length": 59, "header": "tr|E5RG33-1|THYG_HUMAN Computationally mapped isoform of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=1 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 132868224, "end_pos": 132867001, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523901.1", "url": "https://www.ensembl.org/id/ENST00000523901.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000427871.1", "url": "https://www.ensembl.org/id/ENSP00000427871.1" } ] } }, { "isoform_ac": "E7EVM0-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#E7EVM0-1", "sequence": { "sequence": "MLPGLTTELFSPVDLNQVIVNGNQSLSSQKHWLFKHLFSAQQANLWCLSRCVQEHSFCQLAEITESASLYFTCTLYPEAQVCDDIMESNAQGCRLILPQMPKALFRKKVILEDKVKNFYTRLPFQKLMGISIRNKVPMSEKSISNGFFECERRCDADPCCTGFGFLNVSQLKGGEVTCLTLNSLGIQMCSEENGGAWRILDCGSPDIEVHTYPFGWYQKPMSLDSWQSLALSSVVVDPSIRHFDVAHVSTAATSNFSAVRDLCLSECSQHEACLITTLQTQPGAVRCMFYADTQSCTHSLQGQNCRLLLREEATHIYRKPGISLLSYEASVPSVPISTHGRLLGRSQAIQVGTSWKQVDQFLGVPYAAPPLAERRFQAPEPLNWTGSWDASKPRASCWQPGTRTSTSPGVSEDCLYLNVFIPQNVAPNASVLVFFHNTMDREESEGWPAIDGSFLAAVGNLIVVTASYRVGVFGFLSSGSGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRVSLAADRGGADVASIHLLTARATNSQLFRRAVLMGGSALSPAAVISHERAQQQAIALAKEVSCPMSSSQEVVSCLRQKPANVLNDAQTKLLAVSGPFHYWGPVIDGHFLREPPARALKRSLWVEVDLLIGSSQDDGLINRAKAVKQFEESRGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRALENATRDYFIICPIIDMASAWAKRARGNVFMYHAPENYGHGSLELLADVQFALGLPFYPAYEGQFSLEEKSLSLKIMQYFSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK", "length": 901, "header": "tr|E7EVM0-1|THYG_HUMAN Computationally mapped isoform of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=1 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 133134791, "end_pos": 132964924, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519543.5", "url": "https://www.ensembl.org/id/ENST00000519543.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430430.1", "url": "https://www.ensembl.org/id/ENSP00000430430.1" } ] } }, { "isoform_ac": "H0YB42-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#H0YB42-1", "sequence": { "sequence": "XSAGASALLRSGPYMPQCDAFGSWEPVQCHAGTGHCWCVDEKGGFIPGSLTARSLQIPQCPTTCEKSRTSGLLSSWKQARSQENPSPKDLFVPACLEARGVRCHSTRRRWLVEQSCVRQSRAPQALPCSSANCCAARAPGACFHQGH", "length": 147, "header": "tr|H0YB42-1|H0YB42_HUMAN Computationally mapped isoform of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=1 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 132906839, "end_pos": 132897689, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000523756.5", "url": "https://www.ensembl.org/id/ENST00000523756.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428628.1", "url": "https://www.ensembl.org/id/ENSP00000428628.1" } ] } }, { "isoform_ac": "H0YBC5-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#H0YBC5-1", "sequence": { "sequence": "XSDMGSRPESMGCRKDTVPRPASPTEAGCVQEHSFCQLAEITESASLYFTCTLYPEAQVCDD", "length": 62, "header": "tr|H0YBC5-1|THYG_HUMAN Computationally mapped isoform of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=1 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 132967897, "end_pos": 132962994, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518058.1", "url": "https://www.ensembl.org/id/ENST00000518058.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000429164.1", "url": "https://www.ensembl.org/id/ENSP00000429164.1" } ] } }, { "isoform_ac": "H0YBJ2-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#H0YBJ2-1", "sequence": { "sequence": "XGSWEPVQCHAGTGHCWCVDEKGGFIPGSLTARSLQIPQCPTTCEKSRTSGLLSSWKQARSQENPSPKDLFVPACLETGEYARLQASGAGTWCVDPASGEELRPGSSSSAQSCRAEDGGFSPVQCDQAQGSCWCVMDSGEEVPGTRVTGGQPACESPRCPLPFNASEVVGGTILCETISGPTGSAMQQCQLLCRQGSWSVFPPGPLICSLESGRWESQLPQPRACQ", "length": 226, "header": "tr|H0YBJ2-1|H0YBJ2_HUMAN Computationally mapped isoform of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=1 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 132906900, "end_pos": 132897748, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518505.1", "url": "https://www.ensembl.org/id/ENST00000518505.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000429605.1", "url": "https://www.ensembl.org/id/ENSP00000429605.1" } ] } }, { "isoform_ac": "H0YBL4-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#H0YBL4-1", "sequence": { "sequence": "XHSECQWREHSLRPLPFLTPFSSLSQQESLCSAMRHLYLLCPFPPMAGCWAGPRPSRASCWQPGTRTSTSPGVSEDCLYLNVFIPQNVAPNASVLVFFHNTMDREESEGWPAIDGSFLAAVGNLIVVTASYRVGVFGFLSSGSGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRVSLAADRGGADVASIHLLT", "length": 194, "header": "tr|H0YBL4-1|H0YBL4_HUMAN Computationally mapped isoform of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=1 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 133029979, "end_pos": 133017699, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518108.1", "url": "https://www.ensembl.org/id/ENST00000518108.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000429761.1", "url": "https://www.ensembl.org/id/ENSP00000429761.1" } ] } }, { "isoform_ac": "H0YBQ6-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#H0YBQ6-1", "sequence": { "sequence": "XGIQMCSEENGGAWRILDCGSPDIEVHTYPFGWYQKPIAQNNAPSFCPLVVLPSLTEKVFKVREVRGTQLKRME", "length": 74, "header": "tr|H0YBQ6-1|THYG_HUMAN Computationally mapped isoform of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=3 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 132994764, "end_pos": 132972632, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522797.1", "url": "https://www.ensembl.org/id/ENST00000522797.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000430087.1", "url": "https://www.ensembl.org/id/ENSP00000430087.1" } ] } }, { "isoform_ac": "H0YBR7-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#H0YBR7-1", "sequence": { "sequence": "SDARVEAAATWYYSLEHSTDDYASFSRALENATRDYFIICPIIDMASAWAKRARGNVFMYHAPENYGHGRNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK", "length": 172, "header": "tr|H0YBR7-1|H0YBR7_HUMAN Computationally mapped isoform of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=1 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 133134791, "end_pos": 133113503, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521107.1", "url": "https://www.ensembl.org/id/ENST00000521107.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000430161.1", "url": "https://www.ensembl.org/id/ENSP00000430161.1" } ] } }, { "isoform_ac": "H0YBY1-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#H0YBY1-1", "sequence": { "sequence": "XQEQAGSLACVPCPVGRTTISAGAFSQTHCVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLMMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTEDEACSFFTVSTTEPEISCDFYAWTSDNVACMTSDQKRDALGNSKATSFGSLRCQVKVRSHGQDSPAVYLKKGAIICGLLSSPSVLLCNVKDWMDPSEAWANATCPGVTYDQESHQVILRLGDQEFIKSLTPLEGTQDTFTNFQQVYLWKDSDMGSRPESMGCRKDTVPRPASPTEAGLTTELFSPVDLNQVIVNGNQSLSSQKHWLFKHLFSAQQANLWCLSRCVQEHSFCQLAEITESASLYFTCTLYPEAQVCDDIMESNAQGCRLILPQMPKALFRKKVILEDKVKNFYTRLPFQKLMGISIRNKVPMSEKSISNGFFECERRCDADPCCTGFGFLNVSQLKGGEVTCLTLNSLGIQMCSEENGGAWRILDCGSPDIEVHTYPFGWYQKPIAQNNAPSFCPLVVLPSLTEKVSLDSWQSLALSSVVVDPSIRHFDVAHVSTAATSNFSAVRDLCLSECSQHEACLITTLQTQPGAVRCMFYADTQSCTHSLQGQNCRLLLREEATHIYRKPGISLLSYEASVPSVPISTHGRLLGRSQAIQVGTSWKQVDQFLGVPYAAPPLAERRFQAPEPLNWTGSWDASKPRASCWQPGTRTSTSPGVSEDCLYLNVFIPQNVAPNASVLVFFHNTMDREESEGWPAIDGSFLAAVGNLIVVTASYRVGVFGFLSSGSGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRVSLAADRGGADVASIHLLTARATNSQLFRRAVLMGGSALSPAAVISHERAQQQAIALAKEVSCPMSSSQEVVSCLRQKPANVLNDAQTKLLAVSGPFHYWGPVIDGHFLREPPARALKRSLWVEVDLLIGSSQDDGLINRAKAVKQFEESRGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRALENATRDYFIICPIIDMASAWAKRARGNVFMYHAPENYGHGSLELLADVQFALGLPFYPAYEGQFSLEEKSLSLKIMQYFSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK", "length": 1224, "header": "tr|H0YBY1-1|H0YBY1_HUMAN Computationally mapped isoform of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=1 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 133134793, "end_pos": 132919440, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000519178.5", "url": "https://www.ensembl.org/id/ENST00000519178.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430523.1", "url": "https://www.ensembl.org/id/ENSP00000430523.1" } ] } }, { "isoform_ac": "P01266-1", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#P01266-1", "sequence": { "sequence": "MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQTVQCQNDGRSCWCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQCQDSGDYAPVQCDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSPPQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFPEVSGYCHCADSQGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRILQRRFLAVQSVISGRFRCPTKCEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTRQQGEPPSCAEGQSCASERQQALSRLYFGTSGYFSQHDLFSSPEKRWASPRVARFATSCPPTIKELFVDSGLLRPMVEGQSQQFSVSENLLKEAIRAIFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNVGQFNLSGALGTRGTFNFSQFFQQLGLASFLNGGRQEDLAKPLSVGLDSNSSTGTPEAAKKDGTMNKPTVGSFGFEINLQENQNALKFLASLLELPEFLLFLQHAISVPEDVARDLGDVMETVLSSQTCEQTPERLFVPSCTTEGSYEDVQCFSGECWCVNSWGKELPGSRVRGGQPRCPTDCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEGQAIPGTRSAIGKPKKCPTPCQLQSEQAFLRTVQALLSNSSMLPTLSDTYIPQCSTDGQWRQVQCNGPPEQVFELYQRWEAQNKGQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEAGQQDVFPVLSQYPSLQDVPLAALEGKRPQPRENILLEPYLFWQILNGQLSQYPGSYSDFSTPLAHFDLRNCWCVDEAGQELEGMRSEPSKLPTCPGSCEEAKLRVLQFIRETEEIVSASNSSRFPLGESFLVAKGIRLRNEDLGLPPLFPPREAFAEQFLRGSDYAIRLAAQSTLSFYQRRRFSPDDSAGASALLRSGPYMPQCDAFGSWEPVQCHAGTGHCWCVDEKGGFIPGSLTARSLQIPQCPTTCEKSRTSGLLSSWKQARSQENPSPKDLFVPACLETGEYARLQASGAGTWCVDPASGEELRPGSSSSAQCPSLCNVLKSGVLSRRVSPGYVPACRAEDGGFSPVQCDQAQGSCWCVMDSGEEVPGTRVTGGQPACESPRCPLPFNASEVVGGTILCETISGPTGSAMQQCQLLCRQGSWSVFPPGPLICSLESGRWESQLPQPRACQRPQLWQTIQTQGHFQLQLPPGKMCSADYADLLQTFQVFILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGSYSQDEECIPCPVGFYQEQAGSLACVPCPVGRTTISAGAFSQTHCVTDCQRNEAGLQCDQNGQYRASQKDRGSGKAFCVDGEGRRLPWWETEAPLEDSQCLMMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTEDEACSFFTVSTTEPEISCDFYAWTSDNVACMTSDQKRDALGNSKATSFGSLRCQVKVRSHGQDSPAVYLKKGQGSTTTLQKRFEPTGFQNMLSGLYNPIVFSASGANLTDAHLFCLLACDRDLCCDGFVLTQVQGGAIICGLLSSPSVLLCNVKDWMDPSEAWANATCPGVTYDQESHQVILRLGDQEFIKSLTPLEGTQDTFTNFQQVYLWKDSDMGSRPESMGCRKDTVPRPASPTEAGLTTELFSPVDLNQVIVNGNQSLSSQKHWLFKHLFSAQQANLWCLSRCVQEHSFCQLAEITESASLYFTCTLYPEAQVCDDIMESNAQGCRLILPQMPKALFRKKVILEDKVKNFYTRLPFQKLMGISIRNKVPMSEKSISNGFFECERRCDADPCCTGFGFLNVSQLKGGEVTCLTLNSLGIQMCSEENGGAWRILDCGSPDIEVHTYPFGWYQKPIAQNNAPSFCPLVVLPSLTEKVSLDSWQSLALSSVVVDPSIRHFDVAHVSTAATSNFSAVRDLCLSECSQHEACLITTLQTQPGAVRCMFYADTQSCTHSLQGQNCRLLLREEATHIYRKPGISLLSYEASVPSVPISTHGRLLGRSQAIQVGTSWKQVDQFLGVPYAAPPLAERRFQAPEPLNWTGSWDASKPRASCWQPGTRTSTSPGVSEDCLYLNVFIPQNVAPNASVLVFFHNTMDREESEGWPAIDGSFLAAVGNLIVVTASYRVGVFGFLSSGSGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRVSLAADRGGADVASIHLLTARATNSQLFRRAVLMGGSALSPAAVISHERAQQQAIALAKEVSCPMSSSQEVVSCLRQKPANVLNDAQTKLLAVSGPFHYWGPVIDGHFLREPPARALKRSLWVEVDLLIGSSQDDGLINRAKAVKQFEESRGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRALENATRDYFIICPIIDMASAWAKRARGNVFMYHAPENYGHGSLELLADVQFALGLPFYPAYEGQFSLEEKSLSLKIMQYFSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK", "length": 2768, "header": "sp|P01266-1|THYG_HUMAN Isoform 1 of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=5 CANONICAL=P01266-1" }, "locus": { "chromosome": "8", "start_pos": 133134791, "end_pos": 132867001, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000220616.9", "url": "https://www.ensembl.org/id/ENST00000220616.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000220616.4", "url": "https://www.ensembl.org/id/ENSP00000220616.4" } ] } }, { "isoform_ac": "P01266-2", "url": "https://www.uniprot.org/uniprotkb/P01266/entry#P01266-2", "sequence": { "sequence": "MALVLEIFTLLASICWVSANIFEYQVDAQPLRPCELQRETAFLKQADYVPQCAEDGSFQTVQCQNDGRSCWCVGANGSEVLGSRQPGRPVACLSFCQLQKQQILLSGYINSTDTSYLPQCQDSGDYAPVQCDVQQVQCWCVDAEGMEVYGTRQLGRPKRCPRSCEIRNRRLLHGVGDKSPPQCSAEGEFMPVQCKFVNTTDMMIFDLVHSYNRFPDAFVTFSSFQRRFPEVSGYCHCADSQGRELAETGLELLLDEIYDTIFAGLDLPSTFTETTLYRILQRRFLAVQSVISGRFRCPTKCEVERFTATSFGHPYVPSCRRNGDYQAVQCQTEGPCWCVDAQGKEMHGTRQQGEPPSCAEGQSCASERQQALSRLYFGTSGYFSQHDLFSSPEKRWASPRVARFATSCPPTIKELFVDSGLLRPMVEGQSQQFSVSENLLKEAIRAIFPSRGLARLALQFTTNPKRLQQNLFGGKFLVNVGQFNLSGALGTRGTFNFSQFFQQLGLASFLNGGRQEDLAKPLSVGLDSNSSTGTPEAAKKDGTMNKPTVGSFGFEINLQENQNALKFLASLLELPEFLLFLQHAISVPEDVARDLGDVMETVLSSQTCEQTPERLFVPSCTTEGSYEDVQCFSGECWCVNSWGKELPGSRVRGGQPRCPTDCEKQRARMQSLMGSQPAGSTLFVPACTSEGHFLPVQCFNSECYCVDAEGQAIPGTRSAIGKPKKCPTPCQLQSEQAFLRTVQALLSNSSMLPTLSDTYIPQCSTDGQWRQVQCNGPPEQVFELYQRWEAQNKGQDLTPAKLLVKIMSYREAASGNFSLFIQSLYEAGQQDVFPVLSQYPSLQDVPLAALEGKRPQPRENILLEPYLFWQILNGQLSQYPGSYSDFSTPLAHFDLRNCWCVDEAGQELEGMRSEPSKLPTCPGSCEEAKLRVLQFIRETEEIVSASNSSRFPLGESFLVAKGIRLRNEDLGLPPLFPPREAFAEQFLRGSDYAIRLAAQSTLSFYQRRRFSPDDSAGASALLRSGPYMPQCDAFGSWEPVQCHAGTGHCWCVDEKGGFIPGSLTARSLQIPQCPTTCEKSRTSGLLSSWKQARSQENPSPKDLFVPACLETGEYARLQASGAGTWCVDPASGEELRPGSSSSAQCPSLCNVLKSGVLSRRVSPGYVPACRAEDGGFSPVQCDQAQGSCWCVMDSGEEVPGTRVTGGQPACESPRCPLPFNASEVVGGTILCETISGPTGSAMQQCQLLCRQGSWSVFPPGPLICSLESGRWESQLPQPRACQRPQLWQTIQTQGHFQLQLPPGKMCSADYADLLQTFQVFILDELTARGFCQIQVKTFGTLVSIPVCNNSSVQVGCLTRERLGVNVTWKSRLEDIPVASLPDLHDIERALVGKDLLGRFTDLIQSGSFQLHLDSKTFPAETIRFLQGDHFGTSPRTWFGCSEGFYQVLTSEASQDGLGCVKCPEGSYSQDEECIPCPVGFYQEQAGSLACVPCPVGRTTISAGAFSQTHLMQKFEKVPESKVIFDANAPVAVRSKVPDSEFPVMQCLTDCTEDEACSFFTVSTTEPEISCDFYAWTSDNVACMTSDQKRDALGNSKATSFGSLRCQVKVRSHGQDSPAVYLKKGQGSTTTLQKRFEPTGFQNMLSGLYNPIVFSASGANLTDAHLFCLLACDRDLCCDGFVLTQVQGGAIICGLLSSPSVLLCNVKDWMDPSEAWANATCPGVTYDQESHQVILRLGDQEFIKSLTPLEGTQDTFTNFQQVYLWKDSDMGSRPESMGCRKDTVPRPASPTEAGLTTELFSPVDLNQVIVNGNQSLSSQKHWLFKHLFSAQQANLWCLSRCVQEHSFCQLAEITESASLYFTCTLYPEAQVCDDIMESNAQGCRLILPQMPKALFRKKVILEDKVKNFYTRLPFQKLMGISIRNKVPMSEKSISNGFFECERRCDADPCCTGFGFLNVSQLKGGEVTCLTLNSLGIQMCSEENGGAWRILDCGSPDIEVHTYPFGWYQKPIAQNNAPSFCPLVVLPSLTEKVSLDSWQSLALSSVVVDPSIRHFDVAHVSTAATSNFSAVRDLCLSECSQHEACLITTLQTQPGAVRCMFYADTQSCTHSLQGQNCRLLLREEATHIYRKPGISLLSYEASVPSVPISTHGRLLGRSQAIQVGTSWKQVDQFLGVPYAAPPLAERRFQAPEPLNWTGSWDASKPRASCWQPGTRTSTSPGVSEDCLYLNVFIPQNVAPNASVLVFFHNTMDREESEGWPAIDGSFLAAVGNLIVVTASYRVGVFGFLSSGSGEVSGNWGLLDQVAALTWVQTHIRGFGGDPRRVSLAADRGGADVASIHLLTARATNSQLFRRAVLMGGSALSPAAVISHERAQQQAIALAKEVSCPMSSSQEVVSCLRQKPANVLNDAQTKLLAVSGPFHYWGPVIDGHFLREPPARALKRSLWVEVDLLIGSSQDDGLINRAKAVKQFEESRGRTSSKTAFYQALQNSLGGEDSDARVEAAATWYYSLEHSTDDYASFSRALENATRDYFIICPIIDMASAWAKRARGNVFMYHAPENYGHGSLELLADVQFALGLPFYPAYEGQFSLEEKSLSLKIMQYFSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQGLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSLQEPGSKTYSK", "length": 2711, "header": "sp|P01266-2|THYG_HUMAN Isoform 2 of Thyroglobulin OS=Homo sapiens OX=9606 GN=TG PE=1 SV=5 CANONICAL=P01266-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:110;+center+selection;+zoom+selection" }, "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "35995381", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35995381" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ|B|110", "database": "", "url": "" }, { "id": "6SCJ|A|110", "database": "", "url": "" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:1220;+center+selection;+zoom+selection" }, "start_pos": 1220, "start_aa": "Asn", "end_pos": 1220, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1220", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "6SCJ|B|1220", "database": "", "url": "" }, { "id": "6SCJ|A|1220", "database": "", "url": "" }, { "id": "7B75|A|1220", "database": "", "url": "" }, { "id": "7B75|B|1220", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1348, "start_aa": "Asn", "end_pos": 1348, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1348", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" } ], "filter_code": "00100000000000000000.00010000000000.00.01000" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:1349;+center+selection;+zoom+selection" }, "start_pos": 1349, "start_aa": "Asn", "end_pos": 1349, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1349", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "6SCJ|B|1349", "database": "", "url": "" }, { "id": "6SCJ|A|1349", "database": "", "url": "" }, { "id": "7B75|A|1349", "database": "", "url": "" }, { "id": "7B75|B|1349", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G00406II", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110000000.010011100001111101.00010.01001" }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111110.00010.01001" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01001" }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01001" }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.1000000.1100000000.111111100111111101.00010.01001" }, { "glytoucan_ac": "G25451PN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0010000.1110000000.000111000011101100.00010.01001" }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110000000.010101100011111100.00010.01001" }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1100000000.111111100011111110.00010.01001" }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G62894KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110000000.000000000001000100.00010.01001" }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01001" }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1100000000.110111100001111110.00010.01001" }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111101.00010.01001" }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01001" }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G80333GO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110100000.000000000001010000.00100.01001" }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001" }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1110000000.010011100011111101.00010.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:1365;+center+selection;+zoom+selection" }, "start_pos": 1365, "start_aa": "Asn", "end_pos": 1365, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1365", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "6SCJ|B|1365", "database": "", "url": "" }, { "id": "6SCJ|A|1365", "database": "", "url": "" }, { "id": "7B75|A|1365", "database": "", "url": "" }, { "id": "7B75|B|1365", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:1716;+center+selection;+zoom+selection" }, "start_pos": 1716, "start_aa": "Asn", "end_pos": 1716, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1716", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ|B|1716", "database": "", "url": "" }, { "id": "6SCJ|A|1716", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:1774;+center+selection;+zoom+selection" }, "start_pos": 1774, "start_aa": "Asn", "end_pos": 1774, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1774", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "6SCJ|B|1774", "database": "", "url": "" }, { "id": "6SCJ|A|1774", "database": "", "url": "" }, { "id": "7B75|A|1774", "database": "", "url": "" }, { "id": "7B75|B|1774", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:1869;+center+selection;+zoom+selection" }, "start_pos": 1869, "start_aa": "Asn", "end_pos": 1869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1869", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "35995381", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35995381" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ|B|1869", "database": "", "url": "" }, { "id": "6SCJ|A|1869", "database": "", "url": "" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:198;+center+selection;+zoom+selection" }, "start_pos": 198, "start_aa": "Asn", "end_pos": 198, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn198", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ|B|198", "database": "", "url": "" }, { "id": "6SCJ|A|198", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 2013, "start_aa": "Asn", "end_pos": 2013, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2013", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" } ], "filter_code": "00100000000000000000.00010000000000.00.01000" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:2122;+center+selection;+zoom+selection" }, "start_pos": 2122, "start_aa": "Asn", "end_pos": 2122, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2122", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "35995381", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35995381" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ|B|2122", "database": "", "url": "" }, { "id": "6SCJ|A|2122", "database": "", "url": "" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "00100000000000000000.00010000000000.00.01000" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:2250;+center+selection;+zoom+selection" }, "start_pos": 2250, "start_aa": "Asn", "end_pos": 2250, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2250", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "6SCJ|B|2250", "database": "", "url": "" }, { "id": "6SCJ|A|2250", "database": "", "url": "" }, { "id": "7B75|A|2250", "database": "", "url": "" }, { "id": "7B75|B|2250", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G81315DD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7B75&bu=0&command=select+.A:2295;+center+selection;+zoom+selection" }, "start_pos": 2295, "start_aa": "Asn", "end_pos": 2295, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2295", "evidence": [ { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75|A|2295", "database": "", "url": "" }, { "id": "7B75|B|2295", "database": "", "url": "" } ], "filter_code": "00100000000000000000.0000000.00010000000000.1000000.1100000000.110100100101111111.10000.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:2295;+center+selection;+zoom+selection" }, "start_pos": 2295, "start_aa": "Asn", "end_pos": 2295, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2295", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ|B|2295", "database": "", "url": "" }, { "id": "6SCJ|A|2295", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G42984ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7B75&bu=0&command=select+.A:2582;+center+selection;+zoom+selection" }, "start_pos": 2582, "start_aa": "Asn", "end_pos": 2582, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2582", "evidence": [ { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75|A|2582", "database": "", "url": "" }, { "id": "7B75|B|2582", "database": "", "url": "" } ], "filter_code": "00100000000000000000.0000000.00010000000000.0100000.1100000000.000000000001000001.10000.01000" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:2582;+center+selection;+zoom+selection" }, "start_pos": 2582, "start_aa": "Asn", "end_pos": 2582, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2582", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ|B|2582", "database": "", "url": "" }, { "id": "6SCJ|A|2582", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01000" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "icn3d_view": {}, "start_pos": 2749, "start_aa": "Ser", "end_pos": 2749, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2749", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "16679516", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16679516" } ], "filter_code": "00000000000000010000.00000000001000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:484;+center+selection;+zoom+selection" }, "start_pos": 484, "start_aa": "Asn", "end_pos": 484, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn484", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ|B|484", "database": "", "url": "" }, { "id": "6SCJ|A|484", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 529, "start_aa": "Asn", "end_pos": 529, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn529", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" } ], "filter_code": "00100000000000000000.00010000000000.00.01000" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7B75&bu=0&command=select+.A:748;+center+selection;+zoom+selection" }, "start_pos": 748, "start_aa": "Asn", "end_pos": 748, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn748", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75|A|748", "database": "", "url": "" }, { "id": "7B75|B|748", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:76;+center+selection;+zoom+selection" }, "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "25628020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25628020" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "6SCJ|B|76", "database": "", "url": "" }, { "id": "6SCJ|A|76", "database": "", "url": "" }, { "id": "7B75|A|76", "database": "", "url": "" }, { "id": "7B75|B|76", "database": "", "url": "" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 816, "start_aa": "Asn", "end_pos": 816, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn816", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6SCJ&bu=0&command=select+.B:947;+center+selection;+zoom+selection" }, "start_pos": 947, "start_aa": "Asn", "end_pos": 947, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn947", "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "id": "8615697", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/8615697" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SCJ" }, { "id": "32025030", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32025030" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "6SCJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6SCJ" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "7B75", "database": "PDB", "url": "https://www.rcsb.org/structure/7B75" }, { "id": "6SCJ|B|947", "database": "", "url": "" }, { "id": "6SCJ|A|947", "database": "", "url": "" }, { "id": "7B75|A|947", "database": "", "url": "" }, { "id": "7B75|B|947", "database": "", "url": "" } ], "filter_code": "00100000000000000000.00010000000000.00.01001" }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "4335100", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/4335100" }, { "id": "600", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "filter_code": "00000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000" } ], "phosphorylation": [ { "start_pos": 1652, "end_pos": 1652, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01266", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01266" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser1652" }, { "start_pos": 2728, "end_pos": 2728, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P01266", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01266" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ], "site_lbl": "Ser2728" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Two novel cysteine substitutions (C1263R and C1995S) of thyroglobulin cause a defect in intracellular transport of thyroglobulin in patients with congenital goiter and the variant type of adenomatous goiter.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1999", "authors": "Hishinuma A, Takamatsu J, Ohyama Y, Yokozawa T, Kanno Y, Kuma K, Yoshida S, Matsuura N, Ieiri T", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "10199792", "url": "https://glygen.org/publication/PubMed/10199792" } ] }, { "title": "Sulfated tyrosines of thyroglobulin are involved in thyroid hormone synthesis.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Nlend MC, Cauvi D, Venot N, Chabaud O", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "10448091", "url": "https://glygen.org/publication/PubMed/10448091" } ] }, { "title": "Genomic organization of the 3' region of the human thyroglobulin gene.", "journal": "Thyroid", "date": "1999", "authors": "Mendive F M, Rivolta C M, Vassart G, Targovnik H M", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "10524569", "url": "https://glygen.org/publication/PubMed/10524569" } ] }, { "title": "Cathepsin K in thyroid epithelial cells: sequence, localization and possible function in extracellular proteolysis of thyroglobulin.", "journal": "J. Cell Sci.", "date": "2000", "authors": "Tepel C, Br\u00f6mme D, Herzog V, Brix K", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "11082042", "url": "https://glygen.org/publication/PubMed/11082042" } ] }, { "title": "Genomic organization of the 5' region of the human thyroglobulin gene.", "journal": "Eur. J. Endocrinol.", "date": "2000", "authors": "Moya C M, Mendive F M, Rivolta C M, Vassart G, Targovnik H M", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "11124863", "url": "https://glygen.org/publication/PubMed/11124863" } ] }, { "title": "Initial sequencing and analysis of the human genome.", "journal": "Nature", "date": "2001", "authors": "Lander ES, Linton LM, Birren B, Nusbaum C, Zody MC, Baldwin J, Devon K, Dewar K, Doyle M, FitzHugh W, Funke R, Gage D, Harris K, Heaford A, Howland J, Kann L, Lehoczky J, LeVine R, McEwan P, McKernan K, Meldrim J, Mesirov JP, Miranda C, Morris W, Naylor J, Raymond C, Rosetti M, Santos R, Sheridan A, Sougnez C, Stange-Thomann Y, Stojanovic N, Subramanian A, Wyman D, Rogers J, Sulston J, Ainscough R, Beck S, Bentley D, Burton J, Clee C, Carter N, Coulson A, Deadman R, Deloukas P, Dunham A, Dunham I, Durbin R, French L, Grafham D, Gregory S, Hubbard T, Humphray S, Hunt A, Jones M, Lloyd C, McMurray A, Matthews L, Mercer S, Milne S, Mullikin JC, Mungall A, Plumb R, Ross M, Shownkeen R, Sims S, Waterston RH, Wilson RK, Hillier LW, McPherson JD, Marra MA, Mardis ER, Fulton LA, Chinwalla AT, Pepin KH, Gish WR, Chissoe SL, Wendl MC, Delehaunty KD, Miner TL, Delehaunty A, Kramer JB, Cook LL, Fulton RS, Johnson DL, Minx PJ, Clifton SW, Hawkins T, Branscomb E, Predki P, Richardson P, Wenning S, Slezak T, Doggett N, Cheng JF, Olsen A, Lucas S, Elkin C, Uberbacher E, Frazier M, Gibbs RA, Muzny DM, Scherer SE, Bouck JB, Sodergren EJ, Worley KC, Rives CM, Gorrell JH, Metzker ML, Naylor SL, Kucherlapati RS, Nelson DL, Weinstock GM, Sakaki Y, Fujiyama A, Hattori M, Yada T, Toyoda A, Itoh T, Kawagoe C, Watanabe H, Totoki Y, Taylor T, Weissenbach J, Heilig R, Saurin W, Artiguenave F, Brottier P, Bruls T, Pelletier E, Robert C, Wincker P, Smith DR, Doucette-Stamm L, Rubenfield M, Weinstock K, Lee HM, Dubois J, Rosenthal A, Platzer M, Nyakatura G, Taudien S, Rump A, Yang H, Yu J, Wang J, Huang G, Gu J, Hood L, Rowen L, Madan A, Qin S, Davis RW, Federspiel NA, Abola AP, Proctor MJ, Myers RM, Schmutz J, Dickson M, Grimwood J, Cox DR, Olson MV, Kaul R, Raymond C, Shimizu N, Kawasaki K, Minoshima S, Evans GA, Athanasiou M, Schultz R, Roe BA, Chen F, Pan H, Ramser J, Lehrach H, Reinhardt R, McCombie WR, de la Bastide M, Dedhia N, Blocker H, Hornischer K, Nordsiek G, Agarwala R, Aravind L, Bailey JA, Bateman A, Batzoglou S, Birney E, Bork P, Brown DG, Burge CB, Cerutti L, Chen HC, Church D, Clamp M, Copley RR, Doerks T, Eddy SR, Eichler EE, Furey TS, Galagan J, Gilbert JG, Harmon C, Hayashizaki Y, Haussler D, Hermjakob H, Hokamp K, Jang W, Johnson LS, Jones TA, Kasif S, Kaspryzk A, Kennedy S, Kent WJ, Kitts P, Koonin EV, Korf I, Kulp D, Lancet D, Lowe TM, McLysaght A, Mikkelsen T, Moran JV, Mulder N, Pollara VJ, Ponting CP, Schuler G, Schultz J, Slater G, Smit AF, Stupka E, Szustakowki J, Thierry-Mieg D, Thierry-Mieg J, Wagner L, Wallis J, Wheeler R, Williams A, Wolf YI, Wolfe KH, Yang SP, Yeh RF, Collins F, Guyer MS, Peterson J, Felsenfeld A, Wetterstrand KA, Patrinos A, Morgan MJ, de Jong P, Catanese JJ, Osoegawa K, Shizuya H, Choi S, Chen YJ, Szustakowki J", "evidence": [ { "database": "UniProtKB", "id": "E5RG33", "url": "https://www.uniprot.org/uniprotkb/E5RG33" } ], "reference": [ { "type": "PubMed", "id": "11237011", "url": "https://glygen.org/publication/PubMed/11237011" } ] }, { "title": "Amino acid substitutions in the thyroglobulin gene are associated with susceptibility to human and murine autoimmune thyroid disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Ban Y, Greenberg DA, Concepcion E, Skrabanek L, Villanueva R, Tomer Y", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "14657345", "url": "https://glygen.org/publication/PubMed/14657345" } ] }, { "title": "Identification of a minor Tg mRNA transcript in RNA from normal and goitrous thyroids.", "journal": "Mol. Cell. Endocrinol.", "date": "1992", "authors": "Targovnik HM, Cochaux P, Corach D, Vassart G", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "1639210", "url": "https://glygen.org/publication/PubMed/1639210" } ] }, { "title": "A novel compound heterozygous mutation in the thyroglobulin gene resulting in congenital goitrous hypothyroidism with high serum triiodothyronine levels.", "journal": "Journal of human genetics", "date": "2006", "authors": "Kitanaka S, Takeda A, Sato U, Miki Y, Hishinuma A, Ieiri T, Igarashi T", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "16477365", "url": "https://glygen.org/publication/PubMed/16477365" } ] }, { "title": "A single chondroitin 6-sulfate oligosaccharide unit at Ser-2730 of human thyroglobulin enhances hormone formation and limits proteolytic accessibility at the carboxyl terminus. Potential insights into thyroid homeostasis and autoimmunity.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Conte M, Arcaro A, D'Angelo D, Gnata A, Mamone G, Ferranti P, Formisano S, Gentile F", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "16679516", "url": "https://glygen.org/publication/PubMed/16679516" } ] }, { "title": "Thyroglobulin gene mutations producing defective intracellular transport of thyroglobulin are associated with increased thyroidal type 2 iodothyronine deiodinase activity.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2007", "authors": "Kanou Y, Hishinuma A, Tsunekawa K, Seki K, Mizuno Y, Fujisawa H, Imai T, Miura Y, Nagasaka T, Yamada C, Ieiri T, Murakami M, Murata Y", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "17244789", "url": "https://glygen.org/publication/PubMed/17244789" } ] }, { "title": "Congenital hypothyroidism with goitre caused by new mutations in the thyroglobulin gene.", "journal": "Clinical endocrinology", "date": "2007", "authors": "Caputo M, Rivolta CM, Esperante SA, Gruneiro-Papendieck L, Chiesa A, Pellizas CG, Gonzalez-Sarmiento R, Targovnik HM", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "17532758", "url": "https://glygen.org/publication/PubMed/17532758" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "P01266-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01266-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Thyroglobulin peptides associate in vivo to HLA-DR in autoimmune thyroid glands.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008-07-01", "authors": "Muix\u00ed Laia, Carrascal Montserrat, Alvarez I\u00f1aki, Daura Xavier, Mart\u00ed Merc\u00e8, Armengol Maria Pilar, Pinilla Clemencia, Abian Joaqu\u00edn, Pujol-Borrell Ricardo, Jaraquemada Dolores", "evidence": [ { "database": "IEDB", "id": "39688", "url": "https://www.iedb.org/epitope/39688" }, { "database": "IEDB", "id": "144222", "url": "https://www.iedb.org/epitope/144222" }, { "database": "IEDB", "id": "144353", "url": "https://www.iedb.org/epitope/144353" }, { "database": "IEDB", "id": "144410", "url": "https://www.iedb.org/epitope/144410" }, { "database": "IEDB", "id": "144453", "url": "https://www.iedb.org/epitope/144453" }, { "database": "IEDB", "id": "144482", "url": "https://www.iedb.org/epitope/144482" } ], "reference": [ { "type": "PubMed", "id": "18566446", "url": "https://glygen.org/publication/PubMed/18566446" } ] }, { "title": "Peptides presented in vivo by HLA-DR in thyroid autoimmunity.", "journal": "Advances in immunology", "date": "2008", "authors": "Muix\u00ed Laia, Alvarez I\u00f1aki, Jaraquemada Dolores", "evidence": [ { "database": "IEDB", "id": "144410", "url": "https://www.iedb.org/epitope/144410" } ], "reference": [ { "type": "PubMed", "id": "19117535", "url": "https://glygen.org/publication/PubMed/19117535" } ] }, { "title": "The p.A2215D thyroglobulin gene mutation leads to deficient synthesis and secretion of the mutated protein and congenital hypothyroidism with wide phenotype variation.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2009", "authors": "Pardo V, Vono-Toniolo J, Rubio IG, Knobel M, Possato RF, Targovnik HM, Kopp P, Medeiros-Neto G", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "19509106", "url": "https://glygen.org/publication/PubMed/19509106" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "P01266-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P01266-1" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Tg.2098 is a major human thyroglobulin T-cell epitope.", "journal": "Journal of autoimmunity", "date": "2010-08", "authors": "Menconi Francesca, Huber Amanda, Osman Roman, Concepcion Erlinda, Jacobson Eric M, Stefan Mihaela, David Chela S, Tomer Yaron", "evidence": [ { "database": "IEDB", "id": "39688", "url": "https://www.iedb.org/epitope/39688" } ], "reference": [ { "type": "PubMed", "id": "20303712", "url": "https://glygen.org/publication/PubMed/20303712" } ] }, { "title": "Fine epitope mapping within the pathogenic thyroglobulin peptide 2340-2359: minimal epitopes retaining antigenicity across various MHC haplotypes are not necessarily immunogenic.", "journal": "Immunology", "date": "2012-03", "authors": "Hatzioannou Aikaterini, Alevizaki Maria, Carayanniotis George, Lymberi Peggy", "evidence": [ { "database": "IEDB", "id": "161231", "url": "https://www.iedb.org/epitope/161231" }, { "database": "IEDB", "id": "161258", "url": "https://www.iedb.org/epitope/161258" } ], "reference": [ { "type": "PubMed", "id": "22098450", "url": "https://glygen.org/publication/PubMed/22098450" } ] }, { "title": "Evidence of a combined cytotoxic thyroglobulin and thyroperoxidase epitope-specific cellular immunity in Hashimoto's thyroiditis.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2012-04", "authors": "Ehlers Margret, Thiel Annette, Bernecker Christian, Porwol Dominika, Papewalis Claudia, Willenberg Holger S, Schinner Sven, Hautzel Hubertus, Scherbaum Werner A, Schott Matthias", "evidence": [ { "database": "IEDB", "id": "164764", "url": "https://www.iedb.org/epitope/164764" }, { "database": "IEDB", "id": "164765", "url": "https://www.iedb.org/epitope/164765" }, { "database": "IEDB", "id": "165257", "url": "https://www.iedb.org/epitope/165257" } ], "reference": [ { "type": "PubMed", "id": "22259066", "url": "https://glygen.org/publication/PubMed/22259066" } ] }, { "title": "The nature and extent of contributions by defective ribosome products to the HLA peptidome.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014-04-22", "authors": "Bourdetsky Dmitry, Schmelzer Christian E H, Admon Arie", "evidence": [ { "database": "IEDB", "id": "506176", "url": "https://www.iedb.org/epitope/506176" } ], "reference": [ { "type": "PubMed", "id": "24715725", "url": "https://glygen.org/publication/PubMed/24715725" } ] }, { "title": "The acquisition of novel N-glycosylation sites in conserved proteins during human evolution.", "journal": "BMC bioinformatics", "date": "2015-01-28", "authors": "Kim Dong Seon, Hahn Yoonsoo", "evidence": [ { "database": "GlyGen", "id": "GLY_000481", "url": "https://data.glygen.org/GLY_000481" } ], "reference": [ { "type": "PubMed", "id": "25628020", "url": "https://glygen.org/publication/PubMed/25628020" } ] }, { "title": "Mutations in the genes for thyroglobulin and thyroid peroxidase cause thyroid dyshormonogenesis and autosomal-recessive intellectual disability.", "journal": "Journal of human genetics", "date": "2016", "authors": "Mittal K, Rafiq MA, Rafiullah R, Harripaul R, Ali H, Ayaz M, Aslam M, Naeem F, Amin-Ud-Din M, Waqas A, So J, Rappold GA, Vincent JB, Ayub M", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "27305979", "url": "https://glygen.org/publication/PubMed/27305979" } ] }, { "title": "Consensus sequences for early iodination and hormonogenesis in human thyroglobulin.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Lamas L, Anderson PC, Fox JW, Dunn JT", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "2760035", "url": "https://glygen.org/publication/PubMed/2760035" } ] }, { "title": "Hormone synthesis in human thyroglobulin: possible cleavage of the polypeptide chain at the tyrosine donor site.", "journal": "FEBS Lett.", "date": "1989", "authors": "Marriq C, Lejeune P J, Venot N, Vinet L", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "2914619", "url": "https://glygen.org/publication/PubMed/2914619" } ] }, { "title": "The natural HLA ligandome of glioblastoma stem-like cells: antigen discovery for T cell-based immunotherapy.", "journal": "Acta neuropathologica", "date": "2018-06", "authors": "Neidert Marian Christoph, Kowalewski Daniel Johannes, Silginer Manuela, Kapolou Konstantina, Backert Linus, Freudenmann Lena Katharina, Peper Janet Kerstin, Marcu Ana, Wang Sophie Shih-Y\u00fcng, Walz Juliane Sarah, Wolpert Fabian, Rammensee Hans-Georg, Henschler Reinhard, Lamszus Katrin, Westphal Manfred, Roth Patrick, Regli Luca, Stevanovi\u0107 Stefan, Weller Michael, Eisele G\u00fcnter", "evidence": [ { "database": "IEDB", "id": "39688", "url": "https://www.iedb.org/epitope/39688" }, { "database": "IEDB", "id": "133885", "url": "https://www.iedb.org/epitope/133885" }, { "database": "IEDB", "id": "144410", "url": "https://www.iedb.org/epitope/144410" }, { "database": "IEDB", "id": "1088591", "url": "https://www.iedb.org/epitope/1088591" }, { "database": "IEDB", "id": "1088592", "url": "https://www.iedb.org/epitope/1088592" }, { "database": "IEDB", "id": "1088593", "url": "https://www.iedb.org/epitope/1088593" }, { "database": "IEDB", "id": "1088594", "url": "https://www.iedb.org/epitope/1088594" }, { "database": "IEDB", "id": "1089189", "url": "https://www.iedb.org/epitope/1089189" }, { "database": "IEDB", "id": "1089190", "url": "https://www.iedb.org/epitope/1089190" }, { "database": "IEDB", "id": "1091210", "url": "https://www.iedb.org/epitope/1091210" }, { "database": "IEDB", "id": "1091574", "url": "https://www.iedb.org/epitope/1091574" }, { "database": "IEDB", "id": "1093375", "url": "https://www.iedb.org/epitope/1093375" }, { "database": "IEDB", "id": "1093646", "url": "https://www.iedb.org/epitope/1093646" }, { "database": "IEDB", "id": "1095078", "url": "https://www.iedb.org/epitope/1095078" }, { "database": "IEDB", "id": "1097093", "url": "https://www.iedb.org/epitope/1097093" }, { "database": "IEDB", "id": "1097352", "url": "https://www.iedb.org/epitope/1097352" }, { "database": "IEDB", "id": "1102958", "url": "https://www.iedb.org/epitope/1102958" }, { "database": "IEDB", "id": "1105533", "url": "https://www.iedb.org/epitope/1105533" }, { "database": "IEDB", "id": "1108635", "url": "https://www.iedb.org/epitope/1108635" }, { "database": "IEDB", "id": "1108636", "url": "https://www.iedb.org/epitope/1108636" }, { "database": "IEDB", "id": "1109186", "url": "https://www.iedb.org/epitope/1109186" }, { "database": "IEDB", "id": "1109267", "url": "https://www.iedb.org/epitope/1109267" }, { "database": "IEDB", "id": "1112418", "url": "https://www.iedb.org/epitope/1112418" }, { "database": "IEDB", "id": "1113155", "url": "https://www.iedb.org/epitope/1113155" }, { "database": "IEDB", "id": "1114797", "url": "https://www.iedb.org/epitope/1114797" }, { "database": "IEDB", "id": "1117165", "url": "https://www.iedb.org/epitope/1117165" }, { "database": "IEDB", "id": "1117166", "url": "https://www.iedb.org/epitope/1117166" }, { "database": "IEDB", "id": "1117167", "url": "https://www.iedb.org/epitope/1117167" }, { "database": "IEDB", "id": "1117599", "url": "https://www.iedb.org/epitope/1117599" }, { "database": "IEDB", "id": "1117805", "url": "https://www.iedb.org/epitope/1117805" }, { "database": "IEDB", "id": "1118097", "url": "https://www.iedb.org/epitope/1118097" }, { "database": "IEDB", "id": "1118208", "url": "https://www.iedb.org/epitope/1118208" }, { "database": "IEDB", "id": "1118722", "url": "https://www.iedb.org/epitope/1118722" }, { "database": "IEDB", "id": "1118723", "url": "https://www.iedb.org/epitope/1118723" }, { "database": "IEDB", "id": "1123874", "url": "https://www.iedb.org/epitope/1123874" }, { "database": "IEDB", "id": "1123894", "url": "https://www.iedb.org/epitope/1123894" } ], "reference": [ { "type": "PubMed", "id": "29557506", "url": "https://glygen.org/publication/PubMed/29557506" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "GLY_000040", "url": "http://data.glygen.org/GLY_000040" }, { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Immunopeptidomic Profiling of HLA-A2-Positive Triple Negative Breast Cancer Identifies Potential Immunotherapy Target Antigens.", "journal": "Proteomics", "date": "2018-06", "authors": "Ternette Nicola, Olde Nordkamp Marloes J M, M\u00fcller Julius, Anderson Amanda P, Nicastri Annalisa, Hill Adrian V S, Kessler Benedikt M, Li Demin", "evidence": [ { "database": "IEDB", "id": "772121", "url": "https://www.iedb.org/epitope/772121" } ], "reference": [ { "type": "PubMed", "id": "29786170", "url": "https://glygen.org/publication/PubMed/29786170" } ] }, { "title": "An unusually long poly(purine)-poly(pyrimidine) sequence is located upstream from the human thyroglobulin gene.", "journal": "Nucleic Acids Res.", "date": "1985", "authors": "Christophe D, Cabrer B, Bacolla A, Targovnik H, Pohl V, Vassart G", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "2991855", "url": "https://glygen.org/publication/PubMed/2991855" } ] }, { "title": "A large peptidome dataset improves HLA class I epitope prediction across most of the human population.", "journal": "Nature biotechnology", "date": "2020-02", "authors": "Sarkizova Siranush, Klaeger Susan, Le Phuong M, Li Letitia W, Oliveira Giacomo, Keshishian Hasmik, Hartigan Christina R, Zhang Wandi, Braun David A, Ligon Keith L, Bachireddy Pavan, Zervantonakis Ioannis K, Rosenbluth Jennifer M, Ouspenskaia Tamara, Law Travis, Justesen Sune, Stevens Jonathan, Lane William J, Eisenhaure Thomas, Lan Zhang Guang, Clauser Karl R, Hacohen Nir, Carr Steven A, Wu Catherine J, Keskin Derin B", "evidence": [ { "database": "IEDB", "id": "1028146", "url": "https://www.iedb.org/epitope/1028146" } ], "reference": [ { "type": "PubMed", "id": "31844290", "url": "https://glygen.org/publication/PubMed/31844290" } ] }, { "title": "The structure of human thyroglobulin.", "journal": "Nature", "date": "2020", "authors": "Coscia F, Taler-Vercic A, Chang VT, Sinn L, O'Reilly FJ, Izore T, Renko M, Berger I, Rappsilber J, Turk D, Lowe J", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" } ] }, { "title": "Identification of novel HLA-A0201-restricted T-cell epitopes against thyroid antigens in autoimmune thyroid diseases.", "journal": "Endocrine", "date": "2020-09", "authors": "Cai Yun, Xu Xinyu, Zhang Zheng, Wang Ping, Hu Qingfang, Jin Yu, Wang Zhixiao, Liu Xiaoyun, Yang Tao", "evidence": [ { "database": "IEDB", "id": "164764", "url": "https://www.iedb.org/epitope/164764" }, { "database": "IEDB", "id": "164765", "url": "https://www.iedb.org/epitope/164765" }, { "database": "IEDB", "id": "165257", "url": "https://www.iedb.org/epitope/165257" }, { "database": "IEDB", "id": "1261064", "url": "https://www.iedb.org/epitope/1261064" }, { "database": "IEDB", "id": "1311321", "url": "https://www.iedb.org/epitope/1311321" }, { "database": "IEDB", "id": "1311398", "url": "https://www.iedb.org/epitope/1311398" }, { "database": "IEDB", "id": "1311401", "url": "https://www.iedb.org/epitope/1311401" }, { "database": "IEDB", "id": "1311498", "url": "https://www.iedb.org/epitope/1311498" }, { "database": "IEDB", "id": "1311511", "url": "https://www.iedb.org/epitope/1311511" }, { "database": "IEDB", "id": "1311518", "url": "https://www.iedb.org/epitope/1311518" }, { "database": "IEDB", "id": "1311526", "url": "https://www.iedb.org/epitope/1311526" } ], "reference": [ { "type": "PubMed", "id": "32198668", "url": "https://glygen.org/publication/PubMed/32198668" } ] }, { "title": "In-depth mining of the immunopeptidome of an acute myeloid leukemia cell line using complementary ligand enrichment and data acquisition strategies.", "journal": "Molecular immunology", "date": "2020-07", "authors": "Pandey Kirti, Mifsud Nicole A, Lim Kam Sian Terry C C, Ayala Rochelle, Ternette Nicola, Ramarathinam Sri H, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "1302776", "url": "https://www.iedb.org/epitope/1302776" } ], "reference": [ { "type": "PubMed", "id": "32387766", "url": "https://glygen.org/publication/PubMed/32387766" } ] }, { "title": "Biogenesis of HLA Ligand Presentation in Immune Cells Upon Activation Reveals Changes in Peptide Length Preference.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Marino Fabio, Semilietof Aikaterini, Michaux Justine, Pak Hui-Song, Coukos George, M\u00fcller Markus, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "1866643", "url": "https://www.iedb.org/epitope/1866643" } ], "reference": [ { "type": "PubMed", "id": "32983136", "url": "https://glygen.org/publication/PubMed/32983136" } ] }, { "title": "CIITA-Transduced Glioblastoma Cells Uncover a Rich Repertoire of Clinically Relevant Tumor-Associated HLA-II Antigens.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Forlani Greta, Michaux Justine, Pak HuiSong, Huber Florian, Marie Joseph Elodie Lauret, Ramia Elise, Stevenson Brian J, Linnebacher Michael, Accolla Roberto S, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "1609330", "url": "https://www.iedb.org/epitope/1609330" } ], "reference": [ { "type": "PubMed", "id": "33592498", "url": "https://glygen.org/publication/PubMed/33592498" } ] }, { "title": "Carbamazepine Induces Focused T Cell Responses in Resolved Stevens-Johnson Syndrome and Toxic Epidermal Necrolysis Cases But Does Not Perturb the Immunopeptidome for T Cell Recognition.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Mifsud Nicole A, Illing Patricia T, Lai Jeffrey W, Fettke Heidi, Hensen Luca, Huang Ziyi, Rossjohn Jamie, Vivian Julian P, Kwan Patrick, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "1117166", "url": "https://www.iedb.org/epitope/1117166" } ], "reference": [ { "type": "PubMed", "id": "33912179", "url": "https://glygen.org/publication/PubMed/33912179" } ] }, { "title": "Immunopeptidogenomics: Harnessing RNA-Seq to Illuminate the Dark Immunopeptidome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Scull Katherine E, Pandey Kirti, Ramarathinam Sri H, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "1117166", "url": "https://www.iedb.org/epitope/1117166" } ], "reference": [ { "type": "PubMed", "id": "34509645", "url": "https://glygen.org/publication/PubMed/34509645" } ] }, { "title": "Immunopeptidomic analysis of influenza A virus infected human tissues identifies internal proteins as a rich source of HLA ligands.", "journal": "PLoS pathogens", "date": "2022-01", "authors": "Nicholas Ben, Bailey Alistair, Staples Karl J, Wilkinson Tom, Elliott Tim, Skipp Paul", "evidence": [ { "database": "IEDB", "id": "1117166", "url": "https://www.iedb.org/epitope/1117166" }, { "database": "IEDB", "id": "2004732", "url": "https://www.iedb.org/epitope/2004732" }, { "database": "IEDB", "id": "2008394", "url": "https://www.iedb.org/epitope/2008394" }, { "database": "IEDB", "id": "2013321", "url": "https://www.iedb.org/epitope/2013321" }, { "database": "IEDB", "id": "2015889", "url": "https://www.iedb.org/epitope/2015889" }, { "database": "IEDB", "id": "2031920", "url": "https://www.iedb.org/epitope/2031920" }, { "database": "IEDB", "id": "2036004", "url": "https://www.iedb.org/epitope/2036004" }, { "database": "IEDB", "id": "2037952", "url": "https://www.iedb.org/epitope/2037952" }, { "database": "IEDB", "id": "2042813", "url": "https://www.iedb.org/epitope/2042813" }, { "database": "IEDB", "id": "2052206", "url": "https://www.iedb.org/epitope/2052206" } ], "reference": [ { "type": "PubMed", "id": "35051231", "url": "https://glygen.org/publication/PubMed/35051231" } ] }, { "title": "Primary structure of human thyroglobulin deduced from the sequence of its 8448-base complementary DNA.", "journal": "European journal of biochemistry", "date": "1987", "authors": "Malthiery Y, Lissitzky S", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "3595599", "url": "https://glygen.org/publication/PubMed/3595599" } ] }, { "title": "Site-specific N-glycosylation analysis of human thyroid thyroglobulin by mass spectrometry-based Glyco-analytical strategies.", "journal": "Journal of proteomics", "date": "2022-09-15", "authors": "Kayili H Mehmet, Salih Bekir", "evidence": [ { "database": "GlyGen", "id": "GLY_000481", "url": "https://data.glygen.org/GLY_000481" } ], "reference": [ { "type": "PubMed", "id": "35995381", "url": "https://glygen.org/publication/PubMed/35995381" } ] }, { "title": "Multi-Omic Analysis of Two Common P53 Mutations: Proteins Regulated by Mutated P53 as Potential Targets for Immunotherapy.", "journal": "Cancers", "date": "2022-08-17", "authors": "Vadakekolathu Jayakumar, Boocock David J, Pandey Kirti, Guinn Barbara-Ann, Legrand Antoine, Miles Amanda K, Coveney Clare, Ayala Rochelle, Purcell Anthony W, McArdle Stephanie E", "evidence": [ { "database": "IEDB", "id": "2143913", "url": "https://www.iedb.org/epitope/2143913" } ], "reference": [ { "type": "PubMed", "id": "36010968", "url": "https://glygen.org/publication/PubMed/36010968" } ] }, { "title": "Structural organization of the 5' region of the thyroglobulin gene. Evidence for intron loss and `exonization` during evolution.", "journal": "Journal of molecular biology", "date": "1987", "authors": "Parma J, Christophe D, Pohl V, Vassart G", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "3681978", "url": "https://glygen.org/publication/PubMed/3681978" } ] }, { "title": "Serum thyroglobulin as a biomarker of iodine excess and thyroid disease occurrence in adults.", "journal": "Journal of trace elements in medicine and biology : organ of the Society for Minerals and Trace Elements (GMS)", "date": "2023-04-05", "authors": "Du Yang, Liu Peng, Zhang Wei, Yao Jinyin, Meng Fangang, Fan Lijun, Liu Lixiang, Li Ming, Lv Chunpeng, Jiang Wen, Sun Dianjun", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ], "reference": [ { "type": "PubMed", "id": "37043922", "url": "https://glygen.org/publication/PubMed/37043922" } ] }, { "title": "The p.Cys1281Tyr variant in the hinge module/flap region of thyroglobulin causes intracellular transport disorder and congenital hypothyroidism.", "journal": "Molecular and cellular endocrinology", "date": "2023-05-08", "authors": "Gomes Pio Mauricio, Adrover Ezequiela, Miras Mirta B, Sobrero Gabriela, Molina Maricel F, Scheps Karen G, Rivolta Carina M, Targovnik H\u00e9ctor M", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ], "reference": [ { "type": "PubMed", "id": "37164149", "url": "https://glygen.org/publication/PubMed/37164149" } ] }, { "title": "Lymph node ratio independently associated with postoperative thyroglobulin levels in papillary thyroid cancer.", "journal": "Oral oncology", "date": "2023-11", "authors": "Hei Hu, Luo Ziyu, Zheng Chen, Gong Wenbo, Zhou Bin, Fang Jugao, Qin Jianwu", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ], "reference": [ { "type": "PubMed", "id": "37690364", "url": "https://glygen.org/publication/PubMed/37690364" } ] }, { "title": "[Analysis of pre-ablative and preoperative thyroglobulin in differentiated thyroid cancer].", "journal": "Revista medica de Chile", "date": "2022-07", "authors": "Fuenzalida-Mery Lucas, Gonz\u00e1lez-Arestiz\u00e1bal Tom\u00e1s, Portilla-Rojas Marcelo, Gac-Espinoza Patricio, Rodr\u00edguez-Moreno Francisco, Caban\u00e9Toledo Patricio, Rappoport-Wurgaft Daniel", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ], "reference": [ { "type": "PubMed", "id": "37906818", "url": "https://glygen.org/publication/PubMed/37906818" } ] }, { "title": "Diagnostic value of thyroglobulin washout in fine-needle aspiration samples for diagnosis and follow-up of differentiated thyroid cancer.", "journal": "Medicine", "date": "2023-12-08", "authors": "Kargun Sinem, Aydemir Mustafa, Yilmaz Nusret, Ozdem Sebahat, Sari Ramazan", "evidence": [ { "database": "RefSeq", "id": "NP_003226", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003226" } ], "reference": [ { "type": "PubMed", "id": "38065908", "url": "https://glygen.org/publication/PubMed/38065908" } ] }, { "title": "Sequence of the 5'-end quarter of the human-thyroglobulin messenger ribonucleic acid and of its deduced amino-acid sequence.", "journal": "European journal of biochemistry", "date": "1985", "authors": "Malthiery Y, Lissitzky S", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "3971976", "url": "https://glygen.org/publication/PubMed/3971976" } ] }, { "title": "Studies on the carbohydrate units of thyroglobulin. Structure of the mannose-N-acetylglucosamine unit (unit A) of the human and calf proteins.", "journal": "The Journal of biological chemistry", "date": "1972", "authors": "Arima T, Spiro RG", "evidence": [ { "database": "GlyConnect", "id": "600", "url": "https://glyconnect.expasy.org/browser/proteins/600" } ], "reference": [ { "type": "PubMed", "id": "4335100", "url": "https://glygen.org/publication/PubMed/4335100" } ] }, { "title": "Characterization of hormonogenic sites in an N-terminal, cyanogen bromide fragment of human thyroglobulin.", "journal": "Arch. Biochem. Biophys.", "date": "1995", "authors": "Xiao S, Pollock H G, Taurog A, Rawitch A B", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "7793989", "url": "https://glygen.org/publication/PubMed/7793989" } ] }, { "title": "Thyroglobulin gene point mutation associated with non-endemic simple goitre.", "journal": "Lancet", "date": "1993", "authors": "Corral J, Mart\u00edn C, P\u00e9rez R, S\u00e1nchez I, Mories M T, San Millan J L, Miralles J M, Gonz\u00e1lez-Sarmiento R", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "8094490", "url": "https://glygen.org/publication/PubMed/8094490" } ] }, { "title": "Preferential sites of proteolytic cleavage of bovine, human and rat thyroglobulin. The use of limited proteolysis to detect solvent-exposed regions of the primary structure.", "journal": "Eur. J. Biochem.", "date": "1993", "authors": "Gentile F, Salvatore G", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "8269951", "url": "https://glygen.org/publication/PubMed/8269951" } ] }, { "title": "Glycosylation in human thyroglobulin: location of the N-linked oligosaccharide units and comparison with bovine thyroglobulin.", "journal": "Archives of biochemistry and biophysics", "date": "1996", "authors": "Yang SX, Pollock HG, Rawitch AB", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266#ptm_processing" }, { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "8615697", "url": "https://glygen.org/publication/PubMed/8615697" } ] }, { "title": "Multimerization of thyroglobulin (TG) during extracellular storage: isolation of highly cross-linked TG from human thyroids.", "journal": "J. Clin. Endocrinol. Metab.", "date": "1996", "authors": "Berndorfer U, Wilms H, Herzog V", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "8626858", "url": "https://glygen.org/publication/PubMed/8626858" } ] }, { "title": "Characterization of the type-1 repeat from thyroglobulin, a cysteine-rich module found in proteins from different families.", "journal": "Eur. J. Biochem.", "date": "1996", "authors": "Molina F, Bouanani M, Pau B, Granier C", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "8797845", "url": "https://glygen.org/publication/PubMed/8797845" } ] }, { "title": "The revised 8307 base pair coding sequence of human thyroglobulin transiently expressed in eukaryotic cells.", "journal": "Eur. J. Endocrinol.", "date": "1997", "authors": "van de Graaf S A, Pauws E, de Vijlder J J, Ris-Stalpers C R", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "reference": [ { "type": "PubMed", "id": "9186272", "url": "https://glygen.org/publication/PubMed/9186272" } ] } ], "pathway": [ { "id": "hsa:7038", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:7038", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A3Q1M6P2-1", "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MALALWVFGLLDLICLASANIFEYQVDAQPLRPCELQRERAFLKREDYVPQCAEDGSFQTVQCGKDGASCWCVDADGREVPGSRQPGRPAACLSFCQLQKQQILLSSYINSTATSYLPQCQDSGDYSPVQCDLRRRQCWCVDAEGMEVYGTRQQGRPARCPRSCEIRNRRLLHGVGDRSPPQCSPDGAFRPVQCKFVNTTDMMIFDLVHSYSRFPDAFVTFSSFRSRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDLASTFAETTLYRILQRRFLAVQLVISGRFRCPTKCEVERFAATSFRHPYVPSCHPDGEYQAAQCQQGGPCWCVDSRGQEIPGTRQRGEPPSCAEDQSCPSERRRAFSRLRFGPSGYFSRRSLLLAPEEGPVSQRFARFTASCPPSIKELFLDSGIFQPMLQGRDTRFVAPESLLKEAIRGLFPSRELARLALQFTTNAKRLQQNLFGGRFLVNVGQFNLSGALGTRGTFNFSHFFQQLGLPGFQDGRALADLAKPLSVGLNSNPASEAPKASKIDVALRKPVVGSFGFEVNLQENQNALQFLSSFLELPEFLLFLQHAISVPEDIARDLGDVMEMVFSSQGCGQAPGSLFVPACTAEGSYEEVQCFAGDCWCVDAQGRELAGSRVRGGRPRCPTECEKQRARMQSLLGSQPAGSSLFVPACTSKGNFLPVQCFNSECYCVDTEGQPIPGTRSALGEPKKCPSPCQLQAERAFLGTVRTLVSNPSTLPALSSIYIPQCSASGQWSPVQCDGPPEQAFEWYERWEAQNSAGQALTPAELLMKIMSYREAASRNFRLFIQNLYEAGQQGIFPGLARYSSFQDVPVSVLEGNQTQPGGNVFLEPYLFWQILNGQLDRYPGPYSDFSAPLAHFDLRSCWCVDEAGQKLEGTRNEPNKVPACPGSCEEVKLRVLQFIREAEEIVTYSNSSRFPLGESFLAAKGIRLTDEELAFPPLSPSRETFLEKFLSGSDYAIRLAAQSTFDFYQRRLVTLAESPRAPSPVWSSAYLPQCDAFGGWEPVQCHAATGHCWCVDGKGEYVPTSLTARSRQIPQCPTSCERLRASGLLSSWKQAGVQAEPSPKDLFIPTCLETGEFARLQASEAGTWCVDPASGEGVPPGTNSSAQCPSLCEVLQSGVPSRRTSPGYSPACRAEDGGFSPVQCDPAQGSCWCVLGSGEEVPGTRVAGSQPACESPQCPLPFSVADVAGGAILCERASGLGAAAGQRCQLRCSQGYRSAFPPEPLLCSVQRRRWESRPPQPRACQRPQFWQTLQTQAQFQLLLPLGKVCSADYSGLLLAFQVFLLDELTARGFCQIQVKTAGTPVSIPVCDDSSVKVECLSRERLGVNITWKLQLVDAPPASLPDLQDVEEALAGKYLAGRFADLIQSGTFQLHLDSKTFSADTSIHFLQGDRFGTSPRTQFGCLEGFGRVVAASDASQDALGCVKCPEGSYFQDEQCIPCPAGFYQEQAGSLACVPCPEGRTTVYAGAFSQTHCVTDCQKNEVGLQCDQDGQYRASQRDRTSGKAFCVDGEGRRLPWTEAEAPLVDAQCLVMRKFEKLPESKVIFSADVAVMVRSEVPGSESSLMQCLADCALDEACGFLTVSTAGSEVSCDFYAWASDSIACTTSGRSEDALGTSQATSFGSLQCQVKVRSREGDPLAVYLKKGQEFTITGQKRFEQTGFQSALSGMYSPVTFSASGASLAEVHLFCLLACDHDSCCDGFILVQVQGGPLLCGLLSSPDVLLCHVRDWRDPAEAQANASCPGVTYDQDSRQVTLRLGGQEIRGLTPLEGTQDTLTSFQQVYLWKDSDMGSRSESMGCRRDTEPRPASPSETDLTTGLFSPVDLIQVIVDGNVSLPSQQHWLFKHLFSLQQANLWCLSRCAGEPSFCQLAEVTDSEPLYFTCTLYPEAQVCDDILESSPKGCRLILPRRPSALYRKKVVLQDRVKNFYNRLPFQKLTGISIRNKVPMSDKSISSGFFECERLCDMDPCCTGFGFLNVSQLKGGEVTCLTLNSLGLQTCSEEYGGVWRILDCGSPDTEVRTYPFGWYQKPVSPSDAPSFCPSVALPALTENVALDSWQSLALSSVIVDPSIRNFDVAHISTAAVGNFSAARDRCLWECSRHQDCLVTTLQTQPGAVRCMFYADTQSCTHSLQAQNCRLLLHEEATYIYRKPNIPLPGFGTSSPSVPIATHGQLLGRSQAIQVGTSWKPVDQFLGVPYAAPPLGEKRFRAPEHLNWTGSWEATKPRARCWQPGIRTPTPPGVSEDCLYLNVFVPQNMAPNASVLVFFHNAAEGKGSGDRPAVDGSFLAAVGNLIVVTASYRTGIFGFLSSGSSELSGNWGLLDQVVALTWVQTHIQAFGGDPRRVTLAADRGGADIASIHLVTTRAANSRLFRRAVLMGGSALSPAAVIRPERARQQAAALAKEVGCPSSSVQEMVSCLRQEPARILNDAQTKLLAVSGPFHYWGPVVDGQYLRETPARVLQRAPRVKVDLLIGSSQDDGLINRAKAVKQFEESQGRTSSKTAFYQALQNSLGGEAADAGVQAAATWYYSLEHDSDDYASFSRALEQATRDYFIICPVIDMASHWARTVRGNVFMYHAPESYSHSSLELLTDVLYAFGLPFYPAYEGQFTLEEKSLSLKIMQYFSNFIRSGNPNYPHEFSRRAPEFAAPWPDFVPRDGAESYKELSVLLPNRQGLKKADCSFWSKYIQSLKASADETKDGPSADSEEEDQPAGSGLTEDLLGLPELASKTYSK", "length": 2770 }, "evidence": [ { "id": "P01266", "url": "https://omabrowser.org/oma/group/P01266/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "F1RRV3-1", "protein_name": "Thyroglobulin", "gene_name": "TG", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MALALWVFALLGSACLVSANIFEYQVDAQPLRPCELQRERAFLKRADYVPQCAEDGSFQTVQCKKDGGSCWCVDADGREVPGSRQPGRPVACLSFCQLQKQQILLSSYINSTATSYLPQCQDSGAYAPVQCDVRREQCWCVDAEGMEVYGTRRLGRPARCPGSCEIRNRRLLHGVGDKSPPQCSADGTFLPVQCKFVNTTDMMFFDLVHSYNRFPDAFVTFSSFRSRFPEVSGYCHCADSQGRELAGTGLELLLDEIYDTVFAGLDLASSFTETTLYRILQRRFLAVQLVTSGRFRCPTKCEVERFAATSFGHPYVPSCGRDGEYQAGQCQQEGLCWCVDAQGQEIPGTRRPSEPLSCAEGQSCPSERRRALSRLHLGPSGYSGQRGSFLAAERGPVSQTVPSFAASCPLPLKELFVESGILQPVVQGQKKEVTAATESLLKEGLRGIFPSRELARLALQFTANPKRLQQNLFGGRFLANVGQFNLSGALGTRGTFNFSHFFQQLGLPGFQKRQALADPAKSLSVGLDSNPATEAPEALKMGVAMNKTVVGSFGFEVNLQENRNALTFLSSLLELPEFLLFLQHAISVPEDIARDLGDVMEMALSSQGCEQTPGSLFVPSCTAEGSYEDVQCFAGECWCVDARGRELAGSRARGGRPRCPTACEKQRERMQSLLGRQPAGSSVFVPSCTREGHFLPVQCFSSDCYCVDADGQPIPGTRTAPGEPKQCPTPCQLQAEQAFLGTVRGLISNPSEPPVLSSIYIPQCSASGQWRRVQCDGPPEQAFEWYERWGAQSRSGQELTPAELLMKIMSYREAASGSFRLFIQNLYEAGQQGIFPGLARYSSLQDVPLAVLEGNLTQATGNILLEPYLFWQILNGQLPRYPGPYSDFSAPLAHLDLRSCWCVDEAGRKLEGTQTEPSKVPACPGSCEEVKLRVLQFIKEAEEIVMVSNSSQFPLGESFLAAKGIRLTDEELALPPLSPSRETFLEKFLSGSDYAIRLAAQSTFSFYQRRRVALSDAPRTSGPLQPYPYVPQCDALGSWEPVQCHAATGHCWCVDGEGAYLPASLAARSPQVLQCPTPCETSRVRGLLSAWKQAGSQVRPSPKDLFIPACTETGEFARLQASEASTWCVDPASGEAMPPGTNSSAPCPGLCEVLQRGVPSRRASPGTTPACRAEDGGFAPVQCDPAQGSCWCVLGSGEEVPGTRVAGSQPACERPQLWQTIQTRGQFQLQLPPGKVCSADYAGLLPTFQVVILDELTARGFCRIQVTTARTPVSIPVCDDSTVRVGCLSLDRLGVNVTWTLRLEDAPPASLPDLRDIEEALAGKDLVGRFADLIQSGTFQLHLDSRTFPADPSIHFLQGNSLGTSPRTRFGCVEGSRQVPATSNTSQDPLGCVRCPEGSYFQEEQCIPCPAGFYQEQTGSLACAPCPAGTTTTSVGAFSQTHCVTACQRDEAGLQCDQDGQYRASQRDRASGKAFCVDSEGRRLPWSETQAPLVDAQCLMMRKFEKLPESKVIFTADVAVLGSIVPDSESSLMQCLADCARDEACSFLTVSLEGSEGSCDFYAWTSDNIACTSSGQEEDALGTSKATSLGSLTCQVKVRPGDGVAPAVYLKKGQEFATIGQKRFEQTGFQNALSGLYSPVVFSASGASLTEAHLFCLLACDRDSCCDGFILTQVQGGPIICGLLSSPDVLLCHVRDWRDPSEAQADATCPGVTYDQDSRQGTLRLGGQEFKSLTPREGARDTFTSFQQVYLWKDSDMGSRSESMGCRRDMQPRPESPEETDLTAELFSPVDLNQVIVSENRSLPSQQHRLFKHLFSLQQAHLWCLSRCVQEPSFCQLAEITDSSPLYLTCTLYPEAQVCDDVMEASPRGCRRILPRRPNALFQRRVVLQDRVKNFYTRLPFQKLTGLSIRHKVPMADKAISSGFFECERLCDVDPCCTGFGFLNVSQLKGGEVTCLTLNSLGLQTCSEENGGSWRLLACGSPDTEVRTYPFGWYQKPAVQNDAPSFCPSAALPPVPEKVALDSWQPLPPSSVVVDPSIRNFDVAHISTAAVGDFSAARERCLLECSRHQACLVTTLQTRPGAVRCMFYADTQSCTHSLQAQNCQLLLREEATHIYRKPDIPLPGLGSSAPTVTIATHGQLLGTSQAIQLGASWKQVDQFLGVPYAAPPLAESRFRAPEPLNWTGTWDATKPRASCWQPGIRPATAPGVSEDCLYLSVFVPQSLTPNSSVLVFFHNGAEGPLAMAVDGSFLAAVGNLIVVTASYRTGVFGFLSSGSSEVSGNWGLLDQVAALTWVQTHIGVFGGDPRRVALAADRGGADVAGIHLLTSRATNSRLFRRAVLMGGSVLSPAAVIRPDRAQQQAAALAKEVGCPPRPSQKWYPASAGACQPPNDAQMQLLAVSGPFHYWGPVVDGQLLREAPARALQRPPRAKLDLLIGSSQDDGLIDRAKAVKRFEESQGRTSSKTAFYQALQNSLGGEAGDPGVQAAATWYYSLEHDTDDYASFSRALEAATRDYFIICPVIDMASHWARTARGNVFMYHAPESYSHGSLELLADVRYAFGLPFYPAYEGQFTQEEKSLSLKIMQYFSNFVRSGNPNYPHEFSRKAPEFAAPWPDFVPGDGAESYKELSVLLPNRQGLKKADCSFWSKYILSLKASADEAEDGPLAESEEEDRPGLTEDLLGLPELASKSYSK", "length": 2692 }, "evidence": [ { "id": "P01266", "url": "https://omabrowser.org/oma/group/P01266/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "O08710-1", "protein_name": "Thyroglobulin", "gene_name": "Tg", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTALVLWVSTLLSSVCLVAANIFEYQVDAQPLRPCELQREKAFLKQAEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGREVPGSRQLGRPTVCLSFCQLHKQRILLGSYINSTDALYLPQCQDSGNYAPVQCDLQRVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRNRRLLHGVGDRSPPQCTADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSSFRGRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPTKCEVEQFAATRFGHSYIPRCHRDGHYQTVQCQTEGMCWCVDAQGREVPGTRQQGQPPSCAADQSCALERQQALSRFYFETPDYFSPQDLLSSEDRLAPVSGVRSDTSCPPRIKELFVDSGLLRSIAVEHYQRLSESRSLLREAIRAVFPSRELAGLALQFTTNPKRLQQNLFGGTFLANAAQFNLSGALGTRSTFNFSQFFQQFGLPGFLNRDRVTTLAKLLPVRLDSSSTPETLRVSEKTVAMNKRVVGNFGFKVNLQENQDALKFLVSLLELPEFLVFLQRAVSVPEDIARDLGDVMEMVFSAQACKQMPGKFFVPSCTAGGSYEDIQCYAGECWCVDSRGKELDGSRVRGGRPRCPTKCEKQRAQMQSLASAQPAGSSFFVPTCTREGYFLPVQCFNSECYCVDTEGQVIPGTQSTVGEAKQCPSVCQLQAEQAFLGVVGVLLSNSSMVPSISNVYIPQCSASGQWRHVQCDGPHEQVFEWYERWKTQNGDGQELTPAALLMKIVSYREVASRNFSLFLQSLYDAGQQRIFPVLAQYPSLQDVPQVVLEGATTPPGENIFLDPYIFWQILNGQLSQYPGPYSDFNMPLEHFNLRSCWCVDEAGQKLDGTQTKPGEIPACPGPCEEVKLRVLKFIKETEEIVSASNASSFPLGESFLVAKGIQLTSEELDLPPQFPSRDAFSEKFLRGGEYAIRLAAQSTLTFYQSLRASLGKSDGAASLLWSGPYMPQCNMIGGWEPVQCHAGTGQCWCVDGRGEFIPGSLMSRSSQMPQCPTNCELSRASGLISAWKQAGPQRNPGPGDLFIPVCLQTGEYVRKQTSGTGTWCVDPASGEGMPVNTNGSAQCPGLCDVLKSRALSRKVGLGYSPVCEALDGAFSPVQCDLAQGSCWCVLGSGEEVPGTRVVGTQPACESPQCPLPFSGSDVADGVIFCETASSSGVTTVQQCQLLCRQGLRSAFSPGPLICSLESQHWVTLPPPRACQRPQLWQTMQTQAHFQLLLPPGKMCSVDYSGLLQAFQVFILDELIARGFCQIQVKTFGTLVSSTVCDNSSIQVGCLTAERLGVNVTWKLQLEDISVGSLPDLYSIERAVTGQDLLGRFADLIQSGRFQLHLDSKTFSADTTLYFLNGDSFVTSPRTQLGCMEGFYRVPTTRQDALGCVKCPEGSFSQDGRCTPCPAGTYQEQAGSSACIPCPRGRTTITTGAFSKTHCVTDCQKNEAGLQCDQNGQYQASQKNRDSGEVFCVDSEGRKLQWLQTEAGLSESQCLMIRKFDKAPESKVIFDANSPVIVKSSVPSADSPLVQCLTDCANDEACSFLTVSTMESEVSCDFYSWTRDNFACVTSDQEQDAMGSLKATSFGSLRCQVKVRNSGKDSLAVYVKKGYESTAAGQKSFEPTGFQNVLSGLYSPVVFSASGANLTDTHTYCLLACDNDSCCDGFIITQVKGGPTICGLLSSPDILLCHINDWRDTSATQANATCAGVTYDQGSRQMTLSLGGQEFLQGLALLEGTQDSFTSFQQVYLWKDSDMGSRPESMGCERGMVPRSDFPGDMATELFSPVDITQVIVNTSHSLPSQQYWLFTHLFSAEQANLWCLSRCAQEPIFCQLADITKSSSLYFTCFLYPEAQVCDNVMESNAKNCSQILPHQPTALFRRKVVLNDRVKNFYTRLPFQKLTGISIRDKVPMSGKLISNGFFECERLCDRDPCCTGFGFLNVSQLQGGEVTCLTLNSMGIQTCNEESGATWRILDCGSEDTEVHTYPFGWYQKPAVWSDTPSFCPSAALQSLTEEKVTSDSWQTLALSSVIVDPSIKHFDVAHISTAATSNFSMAQDFCLQQCSRHQDCLVTTLQIQPGVVRCVFYPDIQNCIHSLRSHTCWLLLHEEATYIYRKSGIPLVQSDVTSTPSVRIDSFGQLQGGSQVIKVGTAWKQVYRFLGVPYAAPPLADNRFRAPEVLNWTGSWDATKPRASCWQPGTRTPTPPQINEDCLYLNVFVPENLVSNASVLVFFHNTMEMEGSGGQLTIDGSILAAVGNFIVVTANYRLGVFGFLSSGSDEVAGNWGLLDQVAALTWVQSHIGAFGGDPQRVTLAADRSGADVASIHLLISRPTRLQLFRKALLMGGSALSPAAIISPERAQQQAAALAKEVGCPTSSIQEVVSCLRQKPANILNDAQTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLPVKVDLLIGGSQDDGLINRAKAVKQFEESQGRTNSKTAFYQALQNSLGGEDSDARILAAAVWYYSLEHSTDDYASFSRALENATRDYFIICPMVNMASLWARRTRGNVFMYHVPESYGHGSLELLADVQYAFGLPFYSAYQGQFSTEEQSLSLKVMQYFSNFIRSGNPNYPHEFSRKAAEFATPWPDFIPGAGGESYKELSAQLPNRQGLKQADCSFWSKYIQTLKDADGAKDAQLTKSEEEDLEVGPGLEEDLSGSLEPVPKSYSK", "length": 2766 }, "evidence": [ { "id": "RGD:3848", "url": "https://alliancegenome.org/gene/RGD:3848#orthology", "database": "AGR" }, { "id": "MGI:98733", "url": "https://alliancegenome.org/gene/MGI:98733#orthology", "database": "AGR" }, { "id": "HGNC:11764", "url": "https://alliancegenome.org/gene/HGNC:11764#orthology", "database": "AGR" }, { "id": "P01266", "url": "https://omabrowser.org/oma/group/P01266/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "P06882-1", "protein_name": "Thyroglobulin", "gene_name": "Tg", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MMTLVLWVSTLLSSVCLVAANIFEYQVDAQPLRPCELQREKAFLKQDEYVPQCSEDGSFQTVQCQNDGQSCWCVDSDGTEVPGSRQLGRPTACLSFCQLHKQRILLSSYINSTDALYLPQCQDSGNYAPVQCDLQQVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRSRRLLHGVGDKSPPQCDADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSAFRNRFPEVSGYCYCADSQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPTKCEVEQFTATSFGHPYIPSCHRDGHYQTVQCQMERMCWCVDAQGIEIPGTRQQGQPLFCAKDQSCASERQQALSRLYFETPGYFSPQDLLSSEDRLVPVSGARLDISCPPRIKELFVDSGLLRSIAVERYQQLSESRSLLREAIRAIFPSRELAGLALQFTTNPKRLQQNLFGGTFLVNAAQLNLSGALGTRSTFNFSQFFQQFGLPGFLVRDRATDLAKLLPVSLDSSPTPVPLRVPEKRVAMNKSVVGTFGFKVNLQENQDALKFLVSLMELPEFLVFLQRAVSVPEDRARDLGDVMEMVFSAQACKQTSGRFFVPSCTAEGSYEDIQCYAGECWCVNSQGKEVEGSRVSGGHPRCPTKCEKQRAQMQNLAGAQPAGSSFFVPTCTSEGYFLPVQCFNSECYCVDAEGQVIPGTQSTIGEPKLCPSVCQLQAEQAFLGVVGVLLSNSSMVPPISSVYIPQCSTSGQWMPVQCDGPHEQVFEWYERWNTQNSDGQELTTATLLMKLMSYREVASTNFSLFLQSLYDAGQQSIFPVLAQYPSLQDVPQVVLEGATIQPGENIFLDPYIFWQILNGQLSQYPGPYSDFSMPLEHFNLRSCWCVDEAGQELDGTRTRAGEIPACPGPCEEVKFRVLKFIKETEEIVSASNASSFPLGESFLVAKGIQLTSEELGLPPLYPSREAFSEKFLRGSEYAIRLAAQSTLTFYQKLRASLGESNGTASLLWSGPYMPQCNTIGGWEPVQCHPGTGQCWCVDGWGELIPGSLMARSSQMPQCPTSCELSRANGLISAWKQAGHQRNPGPGDLFTPVCLQTGEYVRQQTSGTGAWCVDPSSGEGVPTNTNSSAQCPGLCDALKSRVLSRKVGLGYTPVCEALDGGFSPVQCDLAQGSCWCVLASGEEVPGTRVVGTQPACESPQCPLPFSGSDVTDGVVFCETASSSGVTTVQQCQLFCRQGLRNVFSPGPLICNLESQRWVTLPLPRACQRPQLWQTMQTQAHFQLLLPPGKMCSIDYSGLLQAFQVFILDELITRGFCQIQVKTFGTLVSRTVCDNSSIQVGCLTAERLGVNATWKLQLEDISVGSLPNLHSIERALMGQDLLGRFANLIQSGKFQLHLDSKTFSADTILYFLNGDRFVTSPMTQLGCLEGFYRVSTTSQDPLGCVKCPEGSFSQDGKCTPCPAGTYQGQAGSSACIPCPRGRTTTITGAFSKTHCVTDCQRDEAGLQCDQNGQYQANQKDMDSGEVFCVDSEGQRLQWLQTEAGLSESQCLMMRKFEKAPESKVIFDASSPVIVKSRVPSANSPLVQCLADCADDEACSFVTVSSMSSEVSCDLYSWTRDNFACVTSDQEEDAVDSLKETSFGSLRCQVKVRNSGKDSLAVYVKKGHEFTASGQKSFEPTGFQNVLSGLYSSVVFSALGTNLTDTHLFCLLACDQDSCCDGFIVTQVKEGPTICGLLSAPDILVCHINDWRDASDTQANGTCAGVTYDQGSRQMTMSLGGQEFLQGLTLLEGTQDSFISFQQVYLWKDSDIGSRPESMGCGRGMVPKSEAPEGADMATELFSPVDITQVIVNTSHSLPSQQYWLSTHLFSAEQANLWCLSRCAQEPVFCQLADIMESSSLYFTCSLYPEAQVCDNDVESNAKNCSQILPRQPTALFQRKVVLNDRVKNFYTRLPFQKLSGISIRDRIPMSEKLISNGFFECERLCDRDPCCTGFGFLNVSQMQGGEMTCLTLNSMGIQTCSEENGATWRILDCGSEDTEVHTYPFGWYQKPAVWSDAPSFCPSAALQSLTEEKVALDSWQTLALSSVIIDPSIKHFDVAHISISATRNFSLAQDFCLQECSRHQDCLVTTLQIQQGVVRCVFYPDIQSCEHSLRSKTCWLLLHEEAAYIYRKSGAPLHQSDGISTPSVHIDSFGQLQGGSQVVKVGTAWKQVYQFLGVPYAAPPLAENRFQAPEVLNWTGSWDATKLRSSCWQPGTRTPTPPQISEDCLYLNVFVPENLVSNASVLVFFHNTVEMEGSGGQLNIDGSILAAVGNLIVVTANYRLGVFGFLSSGSDEVAGNWGLLDQVAALTWVQTHIGAFGGDPQRVTLAADRGGADVASIHLLITRPTRLQLFRKALLMGGSALSPAAIISPDRAQQQAAALAKEVGCPNSSVQEVVSCFRQKPANILNEAQTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLPVKVDLLIGGSQDDGLINRAKAVKQFEESQGRTNSKTAFYQALQNSLGGEDSDARILAAAIWYYSLEHSTDDYASFSRALENATRDYFIICPIVNMASLWARRTRGNVFMYHVPESYGHGSLELLADVQYAFGLPFYSAYQGYFSTEEQSLSLKVMQYFSNFIRSGNPNYPHEFSQKAAEFATPWPDFVPGAGGESYKELSAQLPNRQGLKKADCSFWSKYIQTLKDADGAKDAQLTKSGEEDLEVGPGSEEDFSGSLEPVPKSYSK", "length": 2768 }, "evidence": [ { "id": "RGD:3848", "url": "https://alliancegenome.org/gene/RGD:3848#orthology", "database": "AGR" }, { "id": "MGI:98733", "url": "https://alliancegenome.org/gene/MGI:98733#orthology", "database": "AGR" }, { "id": "HGNC:11764", "url": "https://alliancegenome.org/gene/HGNC:11764#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "thyroid gland development", "id": "GO:0030878", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030878", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "pmid": "" }, { "name": "hormone biosynthetic process", "id": "GO:0042446", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042446", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "pmid": "" }, { "name": "thyroid hormone generation", "id": "GO:0006590", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006590", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "pmid": "" }, { "name": "hormone activity", "id": "GO:0005179", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005179", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1220, "end_pos": 1222, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1348, "end_pos": 1350, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1349, "end_pos": 1351, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1365, "end_pos": 1367, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1716, "end_pos": 1718, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1774, "end_pos": 1776, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1869, "end_pos": 1871, "annotation": "n_glycosylation_sequon" }, { "start_pos": 198, "end_pos": 200, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2013, "end_pos": 2015, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2122, "end_pos": 2124, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2250, "end_pos": 2252, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2295, "end_pos": 2297, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2582, "end_pos": 2584, "annotation": "n_glycosylation_sequon" }, { "start_pos": 484, "end_pos": 486, "annotation": "n_glycosylation_sequon" }, { "start_pos": 496, "end_pos": 498, "annotation": "n_glycosylation_sequon" }, { "start_pos": 529, "end_pos": 531, "annotation": "n_glycosylation_sequon" }, { "start_pos": 748, "end_pos": 750, "annotation": "n_glycosylation_sequon" }, { "start_pos": 76, "end_pos": 78, "annotation": "n_glycosylation_sequon" }, { "start_pos": 816, "end_pos": 818, "annotation": "n_glycosylation_sequon" }, { "start_pos": 947, "end_pos": 949, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Iodinated on tyrosine residues by TPO (PubMed:2760035, PubMed:32025030). There are 4 pairs of iodinated tyrosines used for coupling: acceptor Tyr-24 is coupled to donor Tyr-149 or Tyr-234, acceptor Tyr-2573 is coupled to donor Tyr-2540, acceptor Tyr-2766 in monomer 1 is coupled to donor Tyr-2766 in monomer 2 and acceptor Tyr-1310 in monomer 1 is coupled to donor Tyr-108 in monomer 2 (PubMed:32025030).", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "32025030", "url": "https://glygen.org/publication/PubMed/32025030" }, { "database": "PubMed", "id": "2760035", "url": "https://glygen.org/publication/PubMed/2760035" } ] }, { "annotation": "Sulfated tyrosines are desulfated during iodination.", "evidence": [ { "database": "UniProtKB", "id": "P01266", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "database": "PubMed", "id": "10448091", "url": "https://glygen.org/publication/PubMed/10448091" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "7b75", "pdb_chain": "a/b", "start_pos": 1, "end_pos": 2768, "overlap": "1.0", "method": "Electron_Microscopy", "type": "experimental", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/7b75.pdb", "url_external": "https://www.rcsb.org/structure/7b75" } ], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "E7EVM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E7EVM0" }, { "id": "PF00135", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00135" }, { "id": "H0YBL4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/H0YBL4" }, { "id": "H0YBR7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/H0YBR7" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Carboxylesterase type B", "eco_id": "ECO_0000259", "start_pos": 332, "end_pos": 851, "start_aa": "Thr", "end_aa": "Glu", "glycosite_overlap": "Asn484,Asn748,Asn816,Asn529" }, { "evidence": [ { "id": "H0YBY1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/H0YBY1" }, { "id": "PS51162", "database": "PROSITE", "url": "https://prosite.expasy.org/PS51162" }, { "id": "H0YB42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/H0YB42" }, { "id": "H0YBJ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/H0YBJ2" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1", "eco_id": "ECO_0000259", "start_pos": 31, "end_pos": 85, "start_aa": "Leu", "end_aa": "Gln", "glycosite_overlap": "Asn76" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 1", "eco_id": "ECO_0000255", "start_pos": 31, "end_pos": 92, "start_aa": "Leu", "end_aa": "Cys", "glycosite_overlap": "Asn76" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 10", "eco_id": "ECO_0000255", "start_pos": 1146, "end_pos": 1210, "start_aa": "Pro", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 11", "eco_id": "ECO_0000255", "start_pos": 1511, "end_pos": 1565, "start_aa": "Val", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 2", "eco_id": "ECO_0000255", "start_pos": 93, "end_pos": 160, "start_aa": "Leu", "end_aa": "Cys", "glycosite_overlap": "Asn110" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 3", "eco_id": "ECO_0000255", "start_pos": 161, "end_pos": 297, "start_aa": "Pro", "end_aa": "Cys", "glycosite_overlap": "Asn198" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 4", "eco_id": "ECO_0000255", "start_pos": 298, "end_pos": 358, "start_aa": "Pro", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 5", "eco_id": "ECO_0000255", "start_pos": 605, "end_pos": 658, "start_aa": "Ser", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 6", "eco_id": "ECO_0000255", "start_pos": 659, "end_pos": 726, "start_aa": "Pro", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 7", "eco_id": "ECO_0000255", "start_pos": 727, "end_pos": 921, "start_aa": "Pro", "end_aa": "Cys", "glycosite_overlap": "Asn748,Asn816" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 8", "eco_id": "ECO_0000255", "start_pos": 922, "end_pos": 1073, "start_aa": "Pro", "end_aa": "Cys", "glycosite_overlap": "Asn947" }, { "evidence": [ { "id": "P01266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01266" }, { "id": "PRU00500", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00500" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Thyroglobulin type-1 9", "eco_id": "ECO_0000255", "start_pos": 1074, "end_pos": 1145, "start_aa": "Pro", "end_aa": "Cys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [ 76, 110, 198, 484, 529, 748, 816, 947, 1220, 1348, 1349, 1365, 1716, 1774, 1869, 2013, 2122, 2250, 2295, 2582 ], "o_linked_sites": [ 2749 ], "snv_sites": [ 2, 3, 6, 8, 9, 12, 15, 18, 24, 27, 29, 32, 33, 37, 38, 43, 45, 49, 53, 54, 56, 62, 65, 66, 67, 68, 69, 73, 76, 77, 78, 81, 87, 88, 90, 92, 93, 99, 101, 104, 108, 109, 110, 111, 113, 114, 118, 123, 124, 126, 127, 128, 130, 134, 137, 140, 142, 143, 145, 147, 152, 155, 159, 161, 162, 164, 166, 168, 169, 170, 171, 175, 176, 181, 182, 185, 186, 187, 188, 190, 194, 198, 199, 203, 205, 208, 209, 211, 215, 216, 221, 222, 225, 230, 235, 236, 237, 238, 242, 243, 244, 249, 250, 252, 256, 263, 264, 266, 269, 271, 272, 273, 277, 278, 283, 286, 288, 291, 296, 297, 298, 299, 305, 317, 320, 321, 322, 324, 326, 327, 328, 329, 331, 332, 334, 335, 341, 344, 345, 346, 349, 350, 353, 355, 360, 363, 365, 366, 367, 373, 377, 380, 382, 385, 387, 390, 393, 395, 397, 398, 399, 402, 403, 407, 410, 411, 413, 415, 419, 421, 423, 424, 426, 428, 430, 432, 433, 434, 437, 438, 439, 440, 441, 442, 443, 445, 446, 449, 452, 454, 455, 458, 464, 465, 467, 468, 471, 472, 473, 474, 475, 476, 478, 480, 481, 482, 484, 492, 497, 498, 499, 502, 503, 504, 505, 507, 509, 512, 513, 514, 515, 517, 522, 525, 527, 530, 531, 535, 537, 539, 541, 542, 544, 545, 546, 550, 555, 556, 557, 560, 562, 563, 564, 565, 568, 570, 573, 575, 576, 577, 578, 579, 580, 583, 584, 588, 590, 591, 592, 595, 598, 600, 601, 602, 603, 608, 609, 612, 619, 621, 623, 624, 625, 627, 628, 629, 633, 634, 636, 637, 641, 643, 644, 645, 651, 656, 660, 661, 662, 666, 668, 671, 673, 677, 678, 679, 684, 685, 686, 689, 690, 691, 693, 696, 700, 703, 708, 709, 710, 712, 714, 716, 717, 724, 728, 734, 740, 741, 742, 743, 744, 748, 754, 755, 757, 761, 762, 766, 767, 769, 770, 777, 780, 783, 787, 788, 792, 794, 798, 799, 800, 802, 803, 804, 806, 810, 811, 815, 816, 817, 818, 819, 821, 823, 827, 828, 829, 830, 831, 834, 842, 843, 845, 846, 848, 852, 854, 859, 862, 874, 875, 876, 880, 881, 882, 884, 885, 886, 887, 889, 892, 893, 896, 899, 907, 910, 912, 913, 914, 915, 918, 919, 920, 922, 923, 924, 925, 927, 928, 931, 932, 936, 939, 940, 946, 947, 949, 950, 953, 954, 955, 958, 959, 964, 966, 967, 969, 974, 977, 978, 981, 983, 988, 989, 993, 995, 996, 997, 1001, 1004, 1006, 1008, 1009, 1011, 1012, 1014, 1020, 1024, 1025, 1026, 1028, 1033, 1038, 1039, 1041, 1044, 1045, 1046, 1050, 1054, 1063, 1066, 1069, 1074, 1075, 1076, 1078, 1079, 1080, 1081, 1083, 1084, 1086, 1087, 1088, 1090, 1093, 1094, 1095, 1096, 1097, 1098, 1101, 1102, 1103, 1104, 1106, 1107, 1108, 1110, 1119, 1121, 1123, 1126, 1133, 1136, 1138, 1139, 1140, 1141, 1145, 1149, 1152, 1153, 1154, 1156, 1158, 1159, 1160, 1162, 1164, 1167, 1171, 1175, 1177, 1178, 1185, 1194, 1195, 1200, 1201, 1202, 1209, 1213, 1216, 1220, 1222, 1223, 1229, 1230, 1232, 1235, 1237, 1238, 1239, 1240, 1243, 1245, 1246, 1249, 1250, 1252, 1258, 1261, 1262, 1267, 1269, 1270, 1277, 1278, 1279, 1280, 1283, 1287, 1288, 1293, 1297, 1299, 1301, 1306, 1307, 1308, 1311, 1312, 1318, 1319, 1322, 1323, 1324, 1328, 1329, 1330, 1332, 1334, 1338, 1339, 1341, 1343, 1345, 1349, 1350, 1351, 1353, 1356, 1359, 1360, 1361, 1363, 1364, 1365, 1367, 1368, 1370, 1371, 1373, 1375, 1376, 1379, 1381, 1382, 1385, 1388, 1391, 1392, 1394, 1395, 1396, 1398, 1401, 1404, 1405, 1407, 1410, 1411, 1413, 1414, 1416, 1417, 1420, 1421, 1423, 1426, 1427, 1429, 1432, 1433, 1434, 1435, 1437, 1440, 1442, 1443, 1446, 1454, 1456, 1458, 1459, 1460, 1461, 1465, 1471, 1472, 1473, 1474, 1475, 1480, 1490, 1491, 1493, 1494, 1495, 1496, 1498, 1499, 1501, 1502, 1504, 1506, 1507, 1511, 1512, 1513, 1515, 1518, 1519, 1520, 1521, 1525, 1527, 1529, 1530, 1531, 1534, 1537, 1538, 1539, 1541, 1543, 1546, 1547, 1548, 1549, 1553, 1554, 1555, 1556, 1558, 1559, 1561, 1562, 1565, 1566, 1571, 1572, 1574, 1575, 1582, 1583, 1585, 1586, 1591, 1594, 1598, 1599, 1600, 1601, 1604, 1609, 1610, 1611, 1614, 1617, 1618, 1619, 1620, 1621, 1622, 1623, 1625, 1628, 1630, 1631, 1636, 1640, 1642, 1646, 1648, 1650, 1656, 1658, 1661, 1664, 1666, 1667, 1670, 1672, 1673, 1678, 1680, 1681, 1682, 1683, 1691, 1693, 1696, 1697, 1698, 1702, 1707, 1708, 1713, 1714, 1716, 1717, 1718, 1719, 1725, 1726, 1727, 1729, 1730, 1736, 1738, 1741, 1742, 1749, 1755, 1756, 1757, 1760, 1761, 1762, 1766, 1767, 1768, 1769, 1770, 1771, 1774, 1776, 1779, 1781, 1788, 1792, 1795, 1796, 1797, 1801, 1804, 1806, 1807, 1809, 1810, 1811, 1813, 1816, 1817, 1818, 1827, 1829, 1831, 1833, 1836, 1838, 1848, 1853, 1854, 1856, 1857, 1858, 1863, 1866, 1868, 1869, 1885, 1886, 1889, 1893, 1894, 1896, 1898, 1899, 1905, 1907, 1908, 1909, 1911, 1912, 1917, 1919, 1924, 1930, 1933, 1940, 1941, 1944, 1945, 1947, 1949, 1952, 1953, 1959, 1962, 1965, 1967, 1969, 1970, 1971, 1973, 1974, 1977, 1979, 1988, 1990, 1991, 1992, 1993, 1994, 1997, 1998, 1999, 2001, 2003, 2005, 2010, 2015, 2016, 2019, 2020, 2022, 2024, 2028, 2033, 2034, 2036, 2037, 2038, 2041, 2043, 2044, 2051, 2054, 2056, 2058, 2059, 2061, 2062, 2066, 2067, 2068, 2072, 2073, 2074, 2077, 2079, 2080, 2081, 2083, 2086, 2088, 2089, 2090, 2092, 2094, 2099, 2100, 2106, 2107, 2116, 2120, 2121, 2123, 2124, 2125, 2126, 2127, 2128, 2132, 2133, 2134, 2135, 2138, 2139, 2141, 2142, 2147, 2151, 2152, 2154, 2156, 2159, 2161, 2173, 2177, 2178, 2179, 2182, 2185, 2190, 2195, 2200, 2203, 2204, 2207, 2208, 2216, 2219, 2222, 2227, 2229, 2232, 2234, 2239, 2240, 2242, 2244, 2249, 2250, 2251, 2253, 2256, 2258, 2260, 2261, 2266, 2267, 2272, 2273, 2275, 2276, 2278, 2284, 2287, 2289, 2292, 2293, 2294, 2295, 2296, 2301, 2306, 2307, 2309, 2311, 2313, 2316, 2318, 2319, 2321, 2329, 2330, 2332, 2333, 2335, 2336, 2339, 2341, 2345, 2346, 2348, 2350, 2352, 2355, 2357, 2358, 2359, 2361, 2362, 2366, 2369, 2371, 2372, 2373, 2375, 2376, 2377, 2378, 2379, 2380, 2381, 2384, 2385, 2386, 2388, 2389, 2395, 2398, 2399, 2400, 2401, 2404, 2405, 2408, 2409, 2413, 2414, 2415, 2417, 2420, 2422, 2425, 2427, 2439, 2442, 2444, 2446, 2447, 2449, 2455, 2461, 2462, 2463, 2469, 2470, 2472, 2474, 2475, 2477, 2479, 2480, 2481, 2486, 2488, 2489, 2491, 2493, 2497, 2498, 2499, 2501, 2502, 2503, 2505, 2506, 2507, 2509, 2511, 2512, 2514, 2520, 2525, 2528, 2529, 2530, 2531, 2532, 2540, 2546, 2547, 2548, 2549, 2550, 2551, 2553, 2554, 2555, 2556, 2560, 2562, 2564, 2565, 2568, 2570, 2574, 2575, 2576, 2578, 2583, 2584, 2585, 2586, 2590, 2592, 2593, 2595, 2599, 2600, 2605, 2606, 2608, 2609, 2613, 2614, 2616, 2618, 2620, 2623, 2629, 2633, 2634, 2635, 2641, 2647, 2649, 2652, 2662, 2664, 2665, 2668, 2671, 2673, 2674, 2675, 2676, 2678, 2686, 2687, 2688, 2691, 2692, 2693, 2694, 2695, 2698, 2699, 2701, 2702, 2704, 2705, 2706, 2707, 2709, 2713, 2714, 2718, 2720, 2722, 2723, 2724, 2726, 2728, 2730, 2732, 2735, 2736, 2738, 2739, 2741, 2742, 2743, 2744, 2745, 2746, 2747, 2748, 2749, 2752, 2753, 2754, 2757, 2760, 2763, 2765, 2766 ], "sites_with_glycoeffect": [ 1350, 1869, 1001, 1011, 1024, 1046, 1075, 1076, 1080, 1087, 1088, 108, 1094, 1098, 1098, 1098, 109, 110, 111, 1139, 113, 1140, 1141, 1154, 1154, 1158, 1162, 1162, 1177, 1177, 1194, 1201, 1220, 1220, 1222, 1222, 1229, 1235, 1238, 123, 1240, 126, 126, 1307, 1343, 1349, 1351, 1351, 1365, 1365, 1365, 1367, 1370, 1379, 1405, 1407, 1414, 1416, 1421, 1432, 1433, 1498, 1499, 1501, 1506, 1512, 1529, 1538, 1556, 1586, 1586, 1591, 1591, 1614, 1617, 1619, 1620, 1621, 1642, 1656, 1673, 1702, 170, 1713, 1716, 1716, 1718, 1756, 1769, 1774, 1774, 1774, 1776, 1776, 1776, 1801, 1811, 1813, 1853, 1857, 1869, 1885, 18, 1912, 1912, 1965, 1977, 1988, 198, 1990, 1993, 199, 2015, 2015, 2036, 2058, 2072, 2073, 2074, 2083, 2089, 2089, 2092, 2099, 2100, 2106, 2116, 211, 2120, 2121, 2124, 2124, 2128, 2132, 2135, 2142, 2147, 2190, 2200, 2200, 2204, 222, 2250, 2250, 2256, 2258, 2272, 2278, 2278, 2293, 2293, 2295, 2295, 2295, 2295, 2295, 2296, 2306, 2311, 2311, 2318, 2332, 2335, 2345, 2381, 2398, 2404, 2425, 2446, 2447, 2499, 24, 2511, 2511, 2520, 2529, 2540, 2546, 2546, 2564, 2565, 2568, 2570, 2575, 2575, 2584, 2618, 2618, 2652, 2665, 2671, 2671, 2675, 269, 2701, 2714, 2723, 2724, 2726, 272, 2746, 2746, 2749, 2749, 2757, 2765, 2766, 277, 299, 332, 349, 363, 366, 373, 373, 382, 390, 398, 407, 411, 419, 434, 472, 484, 484, 484, 498, 530, 531, 541, 570, 601, 619, 621, 625, 633, 641, 660, 671, 671, 67, 689, 69, 716, 724, 728, 734, 741, 748, 754, 76, 76, 78, 78, 798, 806, 816, 818, 818, 882, 884, 885, 887, 887, 899, 920, 939, 946, 947, 949, 949, 9 ], "glycation_sites": [], "phosphorylation_sites": [ 1652, 2728 ], "sequon_annotation_sites": [ { "start_pos": 110, "end_pos": 112 }, { "start_pos": 1220, "end_pos": 1222 }, { "start_pos": 1348, "end_pos": 1350 }, { "start_pos": 1349, "end_pos": 1351 }, { "start_pos": 1365, "end_pos": 1367 }, { "start_pos": 1716, "end_pos": 1718 }, { "start_pos": 1774, "end_pos": 1776 }, { "start_pos": 1869, "end_pos": 1871 }, { "start_pos": 198, "end_pos": 200 }, { "start_pos": 2013, "end_pos": 2015 }, { "start_pos": 2122, "end_pos": 2124 }, { "start_pos": 2250, "end_pos": 2252 }, { "start_pos": 2295, "end_pos": 2297 }, { "start_pos": 2582, "end_pos": 2584 }, { "start_pos": 484, "end_pos": 486 }, { "start_pos": 496, "end_pos": 498 }, { "start_pos": 529, "end_pos": 531 }, { "start_pos": 748, "end_pos": 750 }, { "start_pos": 76, "end_pos": 78 }, { "start_pos": 816, "end_pos": 818 }, { "start_pos": 947, "end_pos": 949 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 43 }, { "field": "total_sites", "count": 22 }, { "field": "n_linked_sites", "count": 21 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 21 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 21 }, { "field": "exact_n_linked_sites", "count": 20 }, { "field": "exact_n_linked_glycan_sites", "count": 3 }, { "field": "exact_n_linked_glycans", "count": 21 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 21 }, { "field": "n_linked_sites", "count": 20 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 21 }, { "field": "exact_n_linked_sites", "count": 20 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 22 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 4 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 21 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "exact_n_linked_glycan_sites", "count": 3 }, { "field": "exact_n_linked_glycans", "count": 21 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 4 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_n_linked_sites", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1507 }, { "field": "total_sites", "count": 1184 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1430 }, { "field": "total_sites", "count": 1141 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 77 }, { "field": "total_sites", "count": 59 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 56 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ], "tool_support": { "graph_view": "yes" } } ]