[ { "uniprot_canonical_ac": "O14497-1", "uniprot_ac": "O14497", "uniprot_id": "ARI1A_HUMAN", "mass": { "chemical_mass": 242045.0, "monoisotopic_mass": 242045.0 }, "refseq": { "ac": "NP_006006", "name": "AT-rich interactive domain-containing protein 1A isoform a", "summary": "This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, "gene_names": [ { "name": "ARID1A", "type": "recommended", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497" } ] }, { "name": "ARID1A", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "B120", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "BAF250A", "type": "synonym", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497" } ] }, { "name": "BAF250a", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "BAF250", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497" } ] }, { "name": "BM029", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "C1orf4", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497" } ] }, { "name": "CSS2", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "ELD", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "MRD14", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "OSA1", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497" } ] }, { "name": "P270", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "SMARCF1", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497" } ] }, { "name": "hELD", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "hOSA1", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] } ], "protein_names": [ { "name": "AT-rich interactive domain-containing protein 1A", "type": "recommended", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "ARID domain-containing protein 1A", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "AT rich interactive domain 1A (SWI-like)", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "AT-rich interactive domain-containing protein 1A isoform a", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "B120", "type": "synonym", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "BAF250A", "type": "synonym", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "BAF250", "type": "synonym", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "BRG1-associated factor 250a", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "BRG1-associated factor 250", "type": "synonym", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "OSA1 nuclear protein", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "Osa homolog 1", "type": "synonym", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "SWI-like protein", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "SWI/SNF complex protein p270", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "SWI/SNF-related, matrix-associated, actin-dependent regulator of chromatin subfamily F member 1", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "brain protein 120", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "chromatin remodeling factor p250", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] }, { "name": "hELD", "type": "synonym", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "hOSA1", "type": "synonym", "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#names_and_taxonomy" } ] }, { "name": "osa homolog 1", "type": "synonym", "evidence": [ { "id": "NP_006006", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] } ], "function": [ { "annotation": "ARID1A restrains EMT and stemness of ovarian cancer cells through the Hippo pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "database": "PubMed", "id": "38873993", "url": "https://glygen.org/publication/PubMed/38873993" } ] }, { "annotation": "ARID1A suppresses R-loop-mediated STING-type I interferon pathway activation of anti-tumor immunity.", "evidence": [ { "database": "RefSeq", "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "database": "PubMed", "id": "38754421", "url": "https://glygen.org/publication/PubMed/38754421" } ] }, { "annotation": "ARID1A-Deficient Tumors Acquire Immunogenic Neoantigens during the Development of Resistance to Targeted Therapy.", "evidence": [ { "database": "RefSeq", "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "database": "PubMed", "id": "39228255", "url": "https://glygen.org/publication/PubMed/39228255" } ] }, { "annotation": "Genome-wide DNA methylation in relation to ARID1A deficiency in ovarian clear cell carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" }, { "database": "PubMed", "id": "38858765", "url": "https://glygen.org/publication/PubMed/38858765" } ] }, { "annotation": "Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Component of SWI/SNF chromatin remodeling complexes that carry out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner. Binds DNA non-specifically. Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a postmitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to postmitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497#function" }, { "database": "PubMed", "id": "26601204", "url": "https://glygen.org/publication/PubMed/26601204" }, { "database": "UniProtKB", "id": "A2BH40", "url": "https://www.uniprot.org/uniprotkb/A2BH40#function" }, { "database": "PubMed", "id": "22952240", "url": "https://glygen.org/publication/PubMed/22952240" }, { "database": "PubMed", "id": "12672490", "url": "https://glygen.org/publication/PubMed/12672490" } ] }, { "annotation": "This gene encodes a member of the SWI/SNF family, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation. It is thought that the protein encoded by this gene confers specificity to the SNF/SWI complex and may recruit the complex to its targets through either protein-DNA or protein-protein interactions. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ] } ], "disease": [ { "disease_id": "DOID:0050934", "recommended_name": { "id": "DOID:0050934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0050934", "name": "ovarian clear cell carcinoma", "description": "An ovarian carcinoma that has_material_basis_in cells with clear cytoplasm and glycogen secreting hob nail cells." }, "synonyms": [ { "id": "DOID:0050934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0050934", "name": "clear-cell ovarian carcinoma", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "0050934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0050934" } ] }, { "disease_id": "DOID:0070042", "recommended_name": { "id": "DOID:0070042", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070042", "name": "Coffin-Siris syndrome 1", "description": "A Coffin-Siris syndrome that has_material_basis_in an autosomal dominant mutation of the ARID1B gene on chromosome 6q25.3." }, "synonyms": [ { "id": "DOID:0070042", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070042", "name": "CSS1", "description": "" }, { "id": "DOID:0070042", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070042", "name": "MRD12", "description": "" }, { "id": "DOID:0070042", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070042", "name": "autosomal dominant mental retardation 12", "description": "" }, { "id": "DOID:0070042", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070042", "name": "fifth digit syndrome", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "Coffin-Siris syndrome 1", "description": "Any Coffin-Siris syndrome in which the cause of the disease is a mutation in the ARID1B gene." }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "fifth digit syndrome", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "ARID1B-related BAFopathy", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "COFFIN-SIRIS syndrome 1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "CSS1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "Coffin-Siris syndrome 1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "MRD12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "hypertrichosis, hyperkeratosis, intellectual disability, and distinctive facial features", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "hypertrichosis, hyperkeratosis, mental retardation, and distinctive facial features", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "intellectual disability, autosomal dominant 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "mental retardation, autosomal dominant type 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "COFFIN-SIRIS syndrome", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "CSS", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "mental retardation, autosomal dominant 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "Coffin-Siris syndrome 1", "description": "Any Coffin-Siris syndrome in which the cause of the disease is a mutation in the ARID1B gene." }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "fifth digit syndrome", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "ARID1B-related BAFopathy", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "COFFIN-SIRIS syndrome 1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "CSS1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "Coffin-Siris syndrome 1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "MRD12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "hypertrichosis, hyperkeratosis, intellectual disability, and distinctive facial features", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "hypertrichosis, hyperkeratosis, mental retardation, and distinctive facial features", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "intellectual disability, autosomal dominant 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "mental retardation, autosomal dominant type 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "COFFIN-SIRIS syndrome", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "CSS", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "mental retardation, autosomal dominant 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "Coffin-Siris syndrome 1", "description": "Any Coffin-Siris syndrome in which the cause of the disease is a mutation in the ARID1B gene." }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "fifth digit syndrome", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "ARID1B-related BAFopathy", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "COFFIN-SIRIS syndrome 1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "CSS1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "Coffin-Siris syndrome 1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "MRD12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "hypertrichosis, hyperkeratosis, intellectual disability, and distinctive facial features", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "hypertrichosis, hyperkeratosis, mental retardation, and distinctive facial features", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "intellectual disability, autosomal dominant 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "mental retardation, autosomal dominant type 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "COFFIN-SIRIS syndrome", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "CSS", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "mental retardation, autosomal dominant 12", "description": "" }, { "id": "MIM:135900", "resource": "MIM", "url": "https://www.omim.org/entry/135900", "name": "Coffin-Siris syndrome 1", "description": "Coffin-Siris syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070042", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070042" }, { "id": "0070042", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070042" } ] }, { "disease_id": "DOID:0070044", "recommended_name": { "id": "DOID:0070044", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070044", "name": "Coffin-Siris syndrome 2", "description": "A Coffin-Siris syndrome that has_material_basis_in an autosomal dominant mutation of the ARID1A gene on chromosome 1p36.11." }, "synonyms": [ { "id": "DOID:0070044", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070044", "name": "CSS2", "description": "" }, { "id": "DOID:0070044", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070044", "name": "MRD14", "description": "" }, { "id": "DOID:0070044", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070044", "name": "autosomal dominant mental retardation 14", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "intellectual disability, autosomal dominant 14", "description": "Any Coffin-Siris syndrome in which the cause of the disease is a mutation in the ARID1A gene." }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "ARID1A Coffin-Siris syndrome", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "ARID1A-related BAFopathy", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "CSS2", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "Coffin-Siris syndrome caused by mutation in ARID1A", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "MRD14", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "autosomal dominant intellectual disability 14", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "intellectual disability, autosomal dominant 14", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "intellectual disability, autosomal dominant type 14", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "mental retardation, autosomal dominant type 14", "description": "" }, { "id": "MONDO:0013819", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013819", "name": "mental retardation, autosomal dominant 14", "description": "" }, { "id": "MIM:614607", "resource": "MIM", "url": "https://www.omim.org/entry/614607", "name": "Coffin-Siris syndrome 2", "description": "Coffin-Siris syndrome 2" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070044", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070044" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "GC", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] }, { "disease_id": "DOID:10591", "recommended_name": { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "pre-eclampsia", "description": "A hypertension occurring during pregnancy characterized by large amounts of protein in the urine (proteinuria) and edema, usually by the last trimester of pregnancy." }, "synonyms": [ { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "gestational hypertension", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "hypertension induced by pregnancy", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "pre-eclamptic toxaemia", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "preeclampsia", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "preeclampsia/eclampsia", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "pregnancy associated hypertension", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "pregnancy toxemia", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "proteinuric hypertension of pregnancy", "description": "" }, { "id": "DOID:10591", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10591", "name": "toxaemia of pregnancy", "description": "" }, { "id": "MONDO:0012264", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012264", "name": "preeclampsia/eclampsia 2", "description": "" }, { "id": "MONDO:0012264", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012264", "name": "PEE2", "description": "" }, { "id": "MONDO:0012264", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012264", "name": "PREECLAMPSIA/eclampsia 2", "description": "" }, { "id": "MONDO:0012265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012265", "name": "preeclampsia/eclampsia 3", "description": "" }, { "id": "MONDO:0012265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012265", "name": "PEE3", "description": "" }, { "id": "MONDO:0012265", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012265", "name": "PREECLAMPSIA/eclampsia 3", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "preeclampsia/eclampsia 4", "description": "Any preeclampsia in which the cause of the disease is a mutation in the STOX1 gene." }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "Preeclampsia/eclampsia type 4", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "STOX1 preeclampsia", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "preeclampsia caused by mutation in STOX1", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "preeclampsia/eclampsia 4", "description": "" }, { "id": "MONDO:0012266", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012266", "name": "PEE4", "description": "" }, { "id": "MONDO:0100467", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100467", "name": "preeclampsia/eclampsia 1", "description": "" }, { "id": "MONDO:0100467", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100467", "name": "toxaemia of pregnancy", "description": "" }, { "id": "MONDO:0100467", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100467", "name": "toxemia of pregnancy", "description": "" }, { "id": "MONDO:0100467", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100467", "name": "PEE1", "description": "" }, { "id": "MONDO:0100467", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100467", "name": "PREECLAMPSIA/eclampsia 1", "description": "" }, { "id": "MONDO:0100467", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0100467", "name": "PREG1", "description": "" }, { "id": "MIM:609404", "resource": "MIM", "url": "https://www.omim.org/entry/609404", "name": "Pre-eclampsia/eclampsia 4", "description": "Pre-eclampsia/eclampsia 4" } ], "unlinked_id_list": [], "evidence": [ { "id": "10591", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10591" } ] }, { "disease_id": "DOID:1574", "recommended_name": { "id": "DOID:1574", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1574", "name": "alcohol use disorder", "description": "A substance abuse that involves the recurring use of alcoholic beverages despite negative consequences." }, "synonyms": [ { "id": "DOID:1574", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1574", "name": "Ethanol abuse", "description": "" }, { "id": "DOID:1574", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1574", "name": "alcohol abuse", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "1574", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1574" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ], "unlinked_id_list": [ "DOID:3017", "DOID:0050938" ], "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] }, { "disease_id": "DOID:162", "recommended_name": { "id": "DOID:162", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:162", "name": "cancer", "description": "A disease of cellular proliferation that is malignant and primary, characterized by uncontrolled cellular proliferation, local cell invasion and metastasis." }, "synonyms": [ { "id": "DOID:162", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:162", "name": "malignant neoplasm", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:162", "name": "malignant tumor", "description": "" }, { "id": "DOID:162", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:162", "name": "primary cancer", "description": "" } ], "unlinked_id_list": [ "DOID:193", "DOID:7757", "DOID:2151", "DOID:3316", "DOID:370", "DOID:706", "DOID:5604", "DOID:184", "DOID:2599", "DOID:4706", "DOID:2174", "DOID:4015", "DOID:4203", "DOID:170", "DOID:10154", "DOID:3017", "DOID:5166", "DOID:1795", "DOID:3149", "DOID:8527", "DOID:0050938", "DOID:3093", "DOID:0060122", "DOID:201", "DOID:3303", "DOID:3350", "DOID:176", "DOID:2595", "DOID:5093", "DOID:0070003", "DOID:0080355", "DOID:368", "DOID:0080524", "DOID:9460", "DOID:0080639", "DOID:0050619", "DOID:0080638", "DOID:4907", "DOID:1325", "DOID:688", "DOID:771", "DOID:0060073", "DOID:672", "DOID:5772", "DOID:4645", "DOID:0080879", "DOID:4765", "DOID:1357", "DOID:5032", "DOID:0060083", "DOID:0050743", "DOID:4045", "DOID:5672", "DOID:3675", "DOID:5662", "DOID:192", "DOID:4043", "DOID:0060116", "DOID:0080364", "DOID:0060100", "DOID:3095", "DOID:0080525", "DOID:3541", "DOID:4230", "DOID:1294", "DOID:0050615", "DOID:0050687", "DOID:3953", "DOID:5158", "DOID:1039", "DOID:3973", "DOID:8858", "DOID:0060119", "DOID:3111", "DOID:60004", "DOID:5467", "DOID:1036", "DOID:2706", "DOID:3856", "DOID:3112", "DOID:3479", "DOID:2815", "DOID:660", "DOID:120", "DOID:2021", "DOID:4114", "DOID:0081452", "DOID:4455", "DOID:3451", "DOID:175", "DOID:4931", "DOID:3277", "DOID:1659", "DOID:4960", "DOID:3001", "DOID:2621", "DOID:1542", "DOID:3419", "DOID:6536", "DOID:3850" ], "evidence": [ { "id": "162", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:162" } ] }, { "disease_id": "DOID:1925", "recommended_name": { "id": "DOID:1925", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1925", "name": "Coffin-Siris syndrome", "description": "An autosomal dominant intellectual developmental disorder that is characterized by mental retardation associated with coarse facial features, hypertrichosis, sparse scalp hair, and hypoplastic or absent fifth fingernails or toenails." }, "synonyms": [ { "id": "DOID:1925", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1925", "name": "Dwarfism-Onychodysplasia", "description": "" }, { "id": "DOID:1925", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1925", "name": "Fifth Digit Syndrome", "description": "" }, { "id": "DOID:1925", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1925", "name": "Short Stature-Onychodysplasia.", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "Coffin-Siris syndrome 1", "description": "Any Coffin-Siris syndrome in which the cause of the disease is a mutation in the ARID1B gene." }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "fifth digit syndrome", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "ARID1B-related BAFopathy", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "COFFIN-SIRIS syndrome 1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "CSS1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "Coffin-Siris syndrome 1", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "MRD12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "hypertrichosis, hyperkeratosis, intellectual disability, and distinctive facial features", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "hypertrichosis, hyperkeratosis, mental retardation, and distinctive facial features", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "intellectual disability, autosomal dominant 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "mental retardation, autosomal dominant type 12", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "COFFIN-SIRIS syndrome", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "CSS", "description": "" }, { "id": "MONDO:0007617", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007617", "name": "mental retardation, autosomal dominant 12", "description": "" }, { "id": "MIM:135900", "resource": "MIM", "url": "https://www.omim.org/entry/135900", "name": "Coffin-Siris syndrome 1", "description": "Coffin-Siris syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "1925", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1925" } ] }, { "disease_id": "DOID:219", "recommended_name": { "id": "DOID:219", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:219", "name": "colon cancer", "description": "A colorectal cancer that is located_in the colon." }, "synonyms": [], "unlinked_id_list": [], "evidence": [ { "id": "219", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:219" } ] }, { "disease_id": "DOID:2870", "recommended_name": { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "endometrial adenocarcinoma", "description": "An endometrial carcinoma that derives_from epithelial cells of glandular origin." }, "synonyms": [ { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "endometrial endometrioid adenocarcinoma with squamous differentiation", "description": "" }, { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "adenocarcinoma of endometrium", "description": "" }, { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "adenocarcinoma of the Endometrium", "description": "" }, { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "adenocarcinoma of uterus", "description": "" }, { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "endometrial adenoacanthoma", "description": "" }, { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "endometrial endometrioid adenocarcinoma", "description": "" }, { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "endometrioid adenoma or carcinoma", "description": "" }, { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "endometrioid adenomas and carcinomas", "description": "" }, { "id": "DOID:2870", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2870", "name": "endometrioid carcinoma of Endometrium", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "2870", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2870" } ] }, { "disease_id": "DOID:3717", "recommended_name": { "id": "DOID:3717", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3717", "name": "gastric adenocarcinoma", "description": "A stomach carcinoma that derives_from epithelial cells of glandular origin." }, "synonyms": [ { "id": "DOID:3717", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3717", "name": "adenocarcinoma of stomach", "description": "" }, { "id": "DOID:3717", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3717", "name": "stomach adenocarcinoma", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "3717", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3717" } ] }, { "disease_id": "DOID:3908", "recommended_name": { "id": "DOID:3908", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3908", "name": "lung non-small cell carcinoma", "description": "A lung carcinoma that is characterized as any type of epithelial lung cancer other than small cell lung carcinoma." }, "synonyms": [ { "id": "DOID:3908", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3908", "name": "NSCLC", "description": "" }, { "id": "DOID:3908", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3908", "name": "Non-small cell lung cancer", "description": "" }, { "id": "DOID:3908", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3908", "name": "non-small cell lung carcinoma", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "3908", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3908" } ] }, { "disease_id": "DOID:4914", "recommended_name": { "id": "DOID:4914", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4914", "name": "esophagus adenocarcinoma", "description": "An esophageal carcinoma that derives_from epithelial cells of glandular origin." }, "synonyms": [ { "id": "DOID:4914", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4914", "name": "Oesophageal adenocarcinoma", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "4914", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4914" } ] }, { "disease_id": "DOID:4927", "recommended_name": { "id": "DOID:4927", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4927", "name": "Klatskin's tumor", "description": "An intrahepatic cholangiocarcinoma arising near or at the confluence of the right and left hepatic ducts." }, "synonyms": [ { "id": "DOID:4927", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4927", "name": "Klatskin tumor", "description": "" }, { "id": "DOID:4927", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4927", "name": "Klatskin tumour", "description": "" }, { "id": "DOID:4927", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4927", "name": "Klatskin's tumour", "description": "" }, { "id": "DOID:4927", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4927", "name": "Perihilar extrahepatic bile duct carcinoma", "description": "" }, { "id": "DOID:4927", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4927", "name": "hilar cholangiocarcinoma", "description": "" }, { "id": "DOID:4927", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4927", "name": "hilar cholangiocellular carcinoma", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "4927", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4927" } ] }, { "disease_id": "DOID:4928", "recommended_name": { "id": "DOID:4928", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4928", "name": "intrahepatic cholangiocarcinoma", "description": "A cholangiocarcinoma that arises from the intrahepatic bile duct epithelium in any site of the intrahepatic biliary tree." }, "synonyms": [ { "id": "DOID:4928", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4928", "name": "Intrahepatic bile duct carcinoma", "description": "" }, { "id": "DOID:4928", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:4928", "name": "peripheral Cholangiocarcinoma", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "4928", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:4928" } ] }, { "disease_id": "DOID:684", "recommended_name": { "id": "DOID:684", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:684", "name": "hepatocellular carcinoma", "description": "A liver carcinoma that has_material_basis_in undifferentiated hepatocytes and located_in the liver." }, "synonyms": [ { "id": "DOID:684", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:684", "name": "Hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "A malignant tumor that arises from hepatocytes. Hepatocellular carcinoma is relatively rare in the United States but very common in all African countries south of the Sahara and in Southeast Asia. Most cases are seen in patients over the age of 50 years, but this tumor can also occur in younger individuals and even in children. Hepatocellular carcinoma is more common in males than females and is associated with hepatitis B, hepatitis C, chronic alcohol abuse and cirrhosis. Serum elevation of alpha-fetoprotein occurs in a large percentage of patients with hepatocellular carcinoma. Grossly, hepatocellular carcinoma may present as a single mass, as multiple nodules, or as diffuse liver involvement. Microscopically, there is a wide range of differentiation from tumor to tumor (well differentiated to poorly differentiated tumors). Hepatocellular carcinomas quickly metastasize to regional lymph nodes and lung. The overall median survival of untreated liver cell carcinoma is about 4 months. The most effective treatment of hepatocellular carcinoma is complete resection of the tumor. Lately, an increasing number of tumors have been treated with liver transplantation." }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "HCC", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "cancer, hepatocellular", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "carcinoma, hepatocellular, malignant", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoblastoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular adenocarcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular cancer, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, childhood type, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatocellular carcinoma, somatic", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell cancer (hepatocellular carcinoma)", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "liver cell carcinoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "primary carcinoma of the liver cells", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult hepatoma", "description": "" }, { "id": "MONDO:0007256", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007256", "name": "adult primary hepatocellular carcinoma", "description": "" }, { "id": "MIM:114550", "resource": "MIM", "url": "https://www.omim.org/entry/114550", "name": "Hepatocellular carcinoma", "description": "Hepatocellular carcinoma" } ], "unlinked_id_list": [], "evidence": [ { "id": "684", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:684" } ] }, { "disease_id": "DOID:769", "recommended_name": { "id": "DOID:769", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:769", "name": "neuroblastoma", "description": "An autonomic nervous system neoplasm that derives_from immature nerve cells." }, "synonyms": [], "unlinked_id_list": [], "evidence": [ { "id": "769", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:769" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:9261", "recommended_name": { "id": "DOID:9261", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9261", "name": "nasopharynx carcinoma", "description": "A pharynx cancer that is located in the nasopharynx, the uppermost region of the pharynx or throat, where the nasal passages and auditory tubes join the remainder of the upper respiratory tract." }, "synonyms": [ { "id": "DOID:9261", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9261", "name": "Nasopharyngeal carcinoma", "description": "" }, { "id": "DOID:9261", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9261", "name": "malignant Nasopharyngeal tumor", "description": "" }, { "id": "DOID:9261", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9261", "name": "malignant neoplasm of nasopharynx", "description": "" }, { "id": "DOID:9261", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9261", "name": "nasopharynx cancer", "description": "" }, { "id": "MONDO:0008067", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008067", "name": "nasopharyngeal carcinoma, susceptibility to, 2", "description": "" }, { "id": "MONDO:0008067", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008067", "name": "nasopharyngeal carcinoma, susceptibility to, 2", "description": "" }, { "id": "MONDO:0008067", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008067", "name": "nasopharyngeal carcinoma, susceptibility to, type 2", "description": "" }, { "id": "MONDO:0008067", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008067", "name": "NPCA2", "description": "" }, { "id": "MONDO:0011775", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011775", "name": "nasopharyngeal carcinoma, susceptibility to, 1", "description": "Any nasopharyngeal carcinoma in which the cause of the disease is a mutation in the TP53 gene." }, { "id": "MONDO:0011775", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011775", "name": "TP53 nasopharyngeal carcinoma", "description": "" }, { "id": "MONDO:0011775", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011775", "name": "nasopharyngeal carcinoma 1", "description": "" }, { "id": "MONDO:0011775", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011775", "name": "nasopharyngeal carcinoma caused by mutation in TP53", "description": "" }, { "id": "MONDO:0011775", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011775", "name": "nasopharyngeal carcinoma, somatic", "description": "" }, { "id": "MONDO:0011775", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011775", "name": "nasopharyngeal carcinoma, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011775", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011775", "name": "NPC", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "9261", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9261" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 1073, "end_pos": 1073, "sequence_org": "W", "sequence_mut": "A", "comment": "Partial loss of DNA-binding activity. Complete loss of activity; when associated with A-1096.", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "10757798", "url": "https://glygen.org/publication/PubMed/10757798" } ] }, { "start_pos": 1096, "end_pos": 1096, "sequence_org": "Y", "sequence_mut": "A", "comment": "Partial loss of DNA-binding activity. Complete loss of activity; when associated with A-1073.", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "10757798", "url": "https://glygen.org/publication/PubMed/10757798" } ] }, { "start_pos": 1370, "end_pos": 1371, "sequence_org": "KR", "sequence_mut": "TT", "comment": "Displays nucleocytoplasmic localization and increased stability; when associated with T-1383.", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "26614907", "url": "https://glygen.org/publication/PubMed/26614907" } ] }, { "start_pos": 1383, "end_pos": 1383, "sequence_org": "R", "sequence_mut": "T", "comment": "Displays nucleocytoplasmic localization and increased stability; when associated with 1370-T-T-1371.", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "26614907", "url": "https://glygen.org/publication/PubMed/26614907" } ] }, { "start_pos": 1656, "end_pos": 1658, "sequence_org": "RRR", "sequence_mut": "TTT", "comment": "No effect on subcellular localization.", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "26614907", "url": "https://glygen.org/publication/PubMed/26614907" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "88.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "91.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "91.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "92.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "91.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "89.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "89.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "92.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "91.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "92.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "88.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "89.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "90.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0700275", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0700275", "name": "prostate cancer, hereditary", "description": "An instance of prostate cancer that is caused by an inherited genomic modification in an individual. Familial prostate cancer (FPC) is a malignant tumor of the prostate with an early onset. FPC is either asymptomatic or causes mictionary symptoms, erectile dysfunction, bone pain, venous compression and infectious or inflammatory syndrome (for the metastatic forms). It is also characterized by familial antecedents." }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:610997", "resource": "MIM", "url": "https://www.omim.org/entry/610997", "name": "Prostate cancer, hereditary, 9", "description": "Prostate cancer, hereditary, 9" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10283", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10283" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "GC", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" }, { "id": "10534", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:10534" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "11054", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11054" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ], "unlinked_id_list": [ "DOID:1542" ], "evidence": [ { "id": "11934", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:11934" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ], "unlinked_id_list": [ "DOID:4765" ], "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "An organ system cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ], "unlinked_id_list": [ "DOID:3017", "DOID:0050938" ], "evidence": [ { "id": "1612", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1612" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thyroid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3973", "DOID:0080524", "DOID:0080525" ], "evidence": [ { "id": "1781", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1781" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ], "unlinked_id_list": [ "DOID:3675", "DOID:4455" ], "evidence": [ { "id": "263", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:263" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ], "unlinked_id_list": [], "evidence": [ { "id": "3571", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:3571" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:9460", "DOID:5166", "DOID:2021", "DOID:4114" ], "evidence": [ { "id": "363", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:363" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "5041", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:5041" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "https://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14497", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14497" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "gene": [ { "name": "ARID1A", "url": "https://www.uniprot.org/uniprotkb/O14497", "locus": { "chromosome": "1", "start_pos": 26782104, "end_pos": 26693236, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000117713", "url": "https://www.ensembl.org/id/ENSG00000117713" } ] } } ], "crossref": [ { "id": "HGNC:11110", "url": "https://alliancegenome.org/gene/HGNC:11110", "database": "AGR", "categories": [ "Protein Classification" ] }, { "id": "O14497", "url": "https://alphafold.ebi.ac.uk/entry/O14497", "database": "AlphaFoldDB", "categories": [] }, { "id": "ENSG00000117713", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000117713", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O14497", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O14497", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd16876", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16876", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL6066172", "url": "https://www.ebi.ac.uk/chembl/target/inspect/CHEMBL6066172", "database": "ChEMBL", "categories": [ "Chemical" ] }, { "id": "ARID1A", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=ARID1A", "database": "GeneCards", "categories": [ "Organism-specific", "Gene Annotation" ] }, { "id": "8289", "url": "https://www.ncbi.nlm.nih.gov/gene/8289", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11110", "url": "https://www.genenames.org/data/gene-symbol-report/#!/hgnc_id/HGNC:11110", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "8289", "url": "https://hpo.jax.org/browse/gene/NCBIGene:8289", "database": "HPO", "categories": [ "Other" ] }, { "id": "1RYU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1RYU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LTH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LTH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6LTJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6LTJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1000044", "url": "https://www.iedb.org/epitope/1000044", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1017450", "url": "https://www.iedb.org/epitope/1017450", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1028352", "url": "https://www.iedb.org/epitope/1028352", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1028425", "url": "https://www.iedb.org/epitope/1028425", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1030852", "url": "https://www.iedb.org/epitope/1030852", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1030897", "url": "https://www.iedb.org/epitope/1030897", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1032688", "url": "https://www.iedb.org/epitope/1032688", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1037914", "url": "https://www.iedb.org/epitope/1037914", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1051296", "url": "https://www.iedb.org/epitope/1051296", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1052424", "url": "https://www.iedb.org/epitope/1052424", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1054561", "url": "https://www.iedb.org/epitope/1054561", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1055061", "url": "https://www.iedb.org/epitope/1055061", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1113188", "url": "https://www.iedb.org/epitope/1113188", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1160352", "url": "https://www.iedb.org/epitope/1160352", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1171723", "url": "https://www.iedb.org/epitope/1171723", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1176351", "url": "https://www.iedb.org/epitope/1176351", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1319447", "url": "https://www.iedb.org/epitope/1319447", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1325886", "url": "https://www.iedb.org/epitope/1325886", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1337127", "url": "https://www.iedb.org/epitope/1337127", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1343458", "url": "https://www.iedb.org/epitope/1343458", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1365654", "url": "https://www.iedb.org/epitope/1365654", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1366388", "url": "https://www.iedb.org/epitope/1366388", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1368900", "url": "https://www.iedb.org/epitope/1368900", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1370066", "url": "https://www.iedb.org/epitope/1370066", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1376934", "url": "https://www.iedb.org/epitope/1376934", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1566681", "url": "https://www.iedb.org/epitope/1566681", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1584717", "url": "https://www.iedb.org/epitope/1584717", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1588548", "url": "https://www.iedb.org/epitope/1588548", "database": "IEDB", "categories": [ "Other" ] }, { "id": "161881", "url": "https://www.iedb.org/epitope/161881", "database": "IEDB", "categories": [ "Other" ] }, { "id": "162627", "url": "https://www.iedb.org/epitope/162627", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1712787", "url": "https://www.iedb.org/epitope/1712787", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1715179", "url": "https://www.iedb.org/epitope/1715179", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1715606", "url": "https://www.iedb.org/epitope/1715606", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1768012", "url": "https://www.iedb.org/epitope/1768012", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1881392", "url": "https://www.iedb.org/epitope/1881392", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1899658", "url": "https://www.iedb.org/epitope/1899658", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1922148", "url": "https://www.iedb.org/epitope/1922148", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1975389", "url": "https://www.iedb.org/epitope/1975389", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1989675", "url": "https://www.iedb.org/epitope/1989675", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1989736", "url": "https://www.iedb.org/epitope/1989736", "database": "IEDB", "categories": [ "Other" ] }, { "id": "1997222", "url": "https://www.iedb.org/epitope/1997222", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2006533", "url": "https://www.iedb.org/epitope/2006533", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2014460", "url": "https://www.iedb.org/epitope/2014460", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2014638", "url": "https://www.iedb.org/epitope/2014638", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2021950", "url": "https://www.iedb.org/epitope/2021950", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2037222", "url": "https://www.iedb.org/epitope/2037222", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2044118", "url": "https://www.iedb.org/epitope/2044118", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2049312", "url": "https://www.iedb.org/epitope/2049312", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2050913", "url": "https://www.iedb.org/epitope/2050913", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2053584", "url": "https://www.iedb.org/epitope/2053584", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2061182", "url": "https://www.iedb.org/epitope/2061182", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2061527", "url": "https://www.iedb.org/epitope/2061527", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2071581", "url": "https://www.iedb.org/epitope/2071581", "database": "IEDB", "categories": [ "Other" ] }, { "id": "213285", "url": "https://www.iedb.org/epitope/213285", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2142198", "url": "https://www.iedb.org/epitope/2142198", "database": "IEDB", "categories": [ "Other" ] }, { "id": "224520", "url": "https://www.iedb.org/epitope/224520", "database": "IEDB", "categories": [ "Other" ] }, { "id": "2259393", "url": "https://www.iedb.org/epitope/2259393", "database": "IEDB", "categories": [ "Other" ] }, { "id": "240475", "url": "https://www.iedb.org/epitope/240475", "database": "IEDB", "categories": [ "Other" ] }, { "id": "240476", "url": "https://www.iedb.org/epitope/240476", "database": "IEDB", "categories": [ "Other" ] }, { "id": "240477", "url": "https://www.iedb.org/epitope/240477", "database": "IEDB", "categories": [ "Other" ] }, { "id": "419513", "url": "https://www.iedb.org/epitope/419513", "database": "IEDB", "categories": [ "Other" ] }, { "id": "419703", "url": "https://www.iedb.org/epitope/419703", "database": "IEDB", "categories": [ "Other" ] }, { "id": "420212", "url": "https://www.iedb.org/epitope/420212", "database": "IEDB", "categories": [ "Other" ] }, { "id": "431661", "url": "https://www.iedb.org/epitope/431661", "database": "IEDB", "categories": [ "Other" ] }, { "id": "436239", "url": "https://www.iedb.org/epitope/436239", "database": "IEDB", "categories": [ "Other" ] }, { "id": "440733", "url": "https://www.iedb.org/epitope/440733", "database": "IEDB", "categories": [ "Other" ] }, { "id": "441344", "url": "https://www.iedb.org/epitope/441344", "database": "IEDB", "categories": [ "Other" ] }, { "id": "441790", "url": "https://www.iedb.org/epitope/441790", "database": "IEDB", "categories": [ "Other" ] }, { "id": "441915", "url": "https://www.iedb.org/epitope/441915", "database": "IEDB", "categories": [ "Other" ] }, { "id": "442275", "url": "https://www.iedb.org/epitope/442275", "database": "IEDB", "categories": [ "Other" ] }, { "id": "444635", "url": "https://www.iedb.org/epitope/444635", "database": "IEDB", "categories": [ "Other" ] }, { "id": "447188", "url": "https://www.iedb.org/epitope/447188", "database": "IEDB", "categories": [ "Other" ] }, { "id": "447230", "url": "https://www.iedb.org/epitope/447230", "database": "IEDB", "categories": [ "Other" ] }, { "id": "448605", "url": "https://www.iedb.org/epitope/448605", "database": "IEDB", "categories": [ "Other" ] }, { "id": "449301", "url": "https://www.iedb.org/epitope/449301", "database": "IEDB", "categories": [ "Other" ] }, { "id": "453610", "url": "https://www.iedb.org/epitope/453610", "database": "IEDB", "categories": [ "Other" ] }, { "id": "456478", "url": "https://www.iedb.org/epitope/456478", "database": "IEDB", "categories": [ "Other" ] }, { "id": "457558", "url": "https://www.iedb.org/epitope/457558", "database": "IEDB", "categories": [ "Other" ] }, { "id": "459252", "url": "https://www.iedb.org/epitope/459252", "database": "IEDB", "categories": [ "Other" ] }, { "id": "469718", "url": "https://www.iedb.org/epitope/469718", "database": "IEDB", "categories": [ "Other" ] }, { "id": "470058", "url": "https://www.iedb.org/epitope/470058", "database": "IEDB", "categories": [ "Other" ] }, { "id": "476936", "url": "https://www.iedb.org/epitope/476936", "database": "IEDB", "categories": [ "Other" ] }, { "id": "483492", "url": "https://www.iedb.org/epitope/483492", "database": "IEDB", "categories": [ "Other" ] }, { "id": "483557", "url": "https://www.iedb.org/epitope/483557", "database": "IEDB", "categories": [ "Other" ] }, { "id": "491299", "url": "https://www.iedb.org/epitope/491299", "database": "IEDB", "categories": [ "Other" ] }, { "id": "491992", "url": "https://www.iedb.org/epitope/491992", "database": "IEDB", "categories": [ "Other" ] }, { "id": "508371", "url": "https://www.iedb.org/epitope/508371", "database": "IEDB", "categories": [ "Other" ] }, { "id": "508467", "url": "https://www.iedb.org/epitope/508467", "database": "IEDB", "categories": [ "Other" ] }, { "id": "508592", "url": "https://www.iedb.org/epitope/508592", "database": "IEDB", "categories": [ "Other" ] }, { "id": "526827", "url": "https://www.iedb.org/epitope/526827", "database": "IEDB", "categories": [ "Other" ] }, { "id": "541856", "url": "https://www.iedb.org/epitope/541856", "database": "IEDB", "categories": [ "Other" ] }, { "id": "542303", "url": "https://www.iedb.org/epitope/542303", "database": "IEDB", "categories": [ "Other" ] }, { "id": "543840", "url": "https://www.iedb.org/epitope/543840", "database": "IEDB", "categories": [ "Other" ] }, { "id": "544483", "url": "https://www.iedb.org/epitope/544483", "database": "IEDB", "categories": [ "Other" ] }, { "id": "545212", "url": "https://www.iedb.org/epitope/545212", "database": "IEDB", "categories": [ "Other" ] }, { "id": "545417", "url": "https://www.iedb.org/epitope/545417", "database": "IEDB", "categories": [ "Other" ] }, { "id": "546598", "url": "https://www.iedb.org/epitope/546598", "database": "IEDB", "categories": [ "Other" ] }, { "id": "572840", "url": "https://www.iedb.org/epitope/572840", "database": "IEDB", "categories": [ "Other" ] }, { "id": "576755", "url": "https://www.iedb.org/epitope/576755", "database": "IEDB", "categories": [ "Other" ] }, { "id": "577391", "url": "https://www.iedb.org/epitope/577391", "database": "IEDB", "categories": [ "Other" ] }, { "id": "583629", "url": "https://www.iedb.org/epitope/583629", "database": "IEDB", "categories": [ "Other" ] }, { "id": "595012", "url": "https://www.iedb.org/epitope/595012", "database": "IEDB", "categories": [ "Other" ] }, { "id": "598923", "url": "https://www.iedb.org/epitope/598923", "database": "IEDB", "categories": [ "Other" ] }, { "id": "599513", "url": "https://www.iedb.org/epitope/599513", "database": "IEDB", "categories": [ "Other" ] }, { "id": "599554", "url": "https://www.iedb.org/epitope/599554", "database": "IEDB", "categories": [ "Other" ] }, { "id": "599847", "url": "https://www.iedb.org/epitope/599847", "database": "IEDB", "categories": [ "Other" ] }, { "id": "609871", "url": "https://www.iedb.org/epitope/609871", "database": "IEDB", "categories": [ "Other" ] }, { "id": "613637", "url": "https://www.iedb.org/epitope/613637", "database": "IEDB", "categories": [ "Other" ] }, { "id": "619699", "url": "https://www.iedb.org/epitope/619699", "database": "IEDB", "categories": [ "Other" ] }, { "id": "623514", "url": "https://www.iedb.org/epitope/623514", "database": "IEDB", "categories": [ "Other" ] }, { "id": "626654", "url": "https://www.iedb.org/epitope/626654", "database": "IEDB", "categories": [ "Other" ] }, { "id": "626655", "url": "https://www.iedb.org/epitope/626655", "database": "IEDB", "categories": [ "Other" ] }, { "id": "629085", "url": "https://www.iedb.org/epitope/629085", "database": "IEDB", "categories": [ "Other" ] }, { "id": "633468", "url": "https://www.iedb.org/epitope/633468", "database": "IEDB", "categories": [ "Other" ] }, { "id": "637907", "url": "https://www.iedb.org/epitope/637907", "database": "IEDB", "categories": [ "Other" ] }, { "id": "640768", "url": "https://www.iedb.org/epitope/640768", "database": "IEDB", "categories": [ "Other" ] }, { "id": "641008", "url": "https://www.iedb.org/epitope/641008", "database": "IEDB", "categories": [ "Other" ] }, { "id": "644019", "url": "https://www.iedb.org/epitope/644019", "database": "IEDB", "categories": [ "Other" ] }, { "id": "645878", "url": "https://www.iedb.org/epitope/645878", "database": "IEDB", "categories": [ "Other" ] }, { "id": "650344", "url": "https://www.iedb.org/epitope/650344", "database": "IEDB", "categories": [ "Other" ] }, { "id": "651211", "url": "https://www.iedb.org/epitope/651211", "database": "IEDB", "categories": [ "Other" ] }, { "id": "652672", "url": "https://www.iedb.org/epitope/652672", "database": "IEDB", "categories": [ "Other" ] }, { "id": "652694", "url": "https://www.iedb.org/epitope/652694", "database": "IEDB", "categories": [ "Other" ] }, { "id": "691226", "url": "https://www.iedb.org/epitope/691226", "database": "IEDB", "categories": [ "Other" ] }, { "id": "692890", "url": "https://www.iedb.org/epitope/692890", "database": "IEDB", "categories": [ "Other" ] }, { "id": "697408", "url": "https://www.iedb.org/epitope/697408", "database": "IEDB", "categories": [ "Other" ] }, { "id": "697433", "url": "https://www.iedb.org/epitope/697433", "database": "IEDB", "categories": [ "Other" ] }, { "id": "700079", "url": "https://www.iedb.org/epitope/700079", "database": "IEDB", "categories": [ "Other" ] }, { "id": "708629", "url": "https://www.iedb.org/epitope/708629", "database": "IEDB", "categories": [ "Other" ] }, { "id": "711189", "url": "https://www.iedb.org/epitope/711189", "database": "IEDB", "categories": [ "Other" ] }, { "id": "712707", "url": "https://www.iedb.org/epitope/712707", "database": "IEDB", "categories": [ "Other" ] }, { "id": "718081", "url": "https://www.iedb.org/epitope/718081", "database": "IEDB", "categories": [ "Other" ] }, { "id": "720643", "url": "https://www.iedb.org/epitope/720643", "database": "IEDB", "categories": [ "Other" ] }, { "id": "726204", "url": "https://www.iedb.org/epitope/726204", "database": "IEDB", "categories": [ "Other" ] }, { "id": "727324", "url": "https://www.iedb.org/epitope/727324", "database": "IEDB", "categories": [ "Other" ] }, { "id": "774973", "url": "https://www.iedb.org/epitope/774973", "database": "IEDB", "categories": [ "Other" ] }, { "id": "823871", "url": "https://www.iedb.org/epitope/823871", "database": "IEDB", "categories": [ "Other" ] }, { "id": "836958", "url": "https://www.iedb.org/epitope/836958", "database": "IEDB", "categories": [ "Other" ] }, { "id": "839182", "url": "https://www.iedb.org/epitope/839182", "database": "IEDB", "categories": [ "Other" ] }, { "id": "865132", "url": "https://www.iedb.org/epitope/865132", "database": "IEDB", "categories": [ "Other" ] }, { "id": "868772", "url": "https://www.iedb.org/epitope/868772", "database": "IEDB", "categories": [ "Other" ] }, { "id": "876762", "url": "https://www.iedb.org/epitope/876762", "database": "IEDB", "categories": [ "Other" ] }, { "id": "877406", "url": "https://www.iedb.org/epitope/877406", "database": "IEDB", "categories": [ "Other" ] }, { "id": "881177", "url": "https://www.iedb.org/epitope/881177", "database": "IEDB", "categories": [ "Other" ] }, { "id": "881593", "url": "https://www.iedb.org/epitope/881593", "database": "IEDB", "categories": [ "Other" ] }, { "id": "882030", "url": "https://www.iedb.org/epitope/882030", "database": "IEDB", "categories": [ "Other" ] }, { "id": "883966", "url": "https://www.iedb.org/epitope/883966", "database": "IEDB", "categories": [ "Other" ] }, { "id": "904535", "url": "https://www.iedb.org/epitope/904535", "database": "IEDB", "categories": [ "Other" ] }, { "id": "906373", "url": "https://www.iedb.org/epitope/906373", "database": "IEDB", "categories": [ "Other" ] }, { "id": "920150", "url": "https://www.iedb.org/epitope/920150", "database": "IEDB", "categories": [ "Other" ] }, { "id": "923612", "url": "https://www.iedb.org/epitope/923612", "database": "IEDB", "categories": [ "Other" ] }, { "id": "931202", "url": "https://www.iedb.org/epitope/931202", "database": "IEDB", "categories": [ "Other" ] }, { "id": "932021", "url": "https://www.iedb.org/epitope/932021", "database": "IEDB", "categories": [ "Other" ] }, { "id": "935936", "url": "https://www.iedb.org/epitope/935936", "database": "IEDB", "categories": [ "Other" ] }, { "id": "955688", "url": "https://www.iedb.org/epitope/955688", "database": "IEDB", "categories": [ "Other" ] }, { "id": "992297", "url": "https://www.iedb.org/epitope/992297", "database": "IEDB", "categories": [ "Other" ] }, { "id": "997097", "url": "https://www.iedb.org/epitope/997097", "database": "IEDB", "categories": [ "Other" ] }, { "id": "997590", "url": "https://www.iedb.org/epitope/997590", "database": "IEDB", "categories": [ "Other" ] }, { "id": "O14497", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14497*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001606", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001606", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011989", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011989", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021906", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021906", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030094", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030094", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036431", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036431", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8289", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8289", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603024", "url": "http://www.omim.org/entry/603024", "database": "MIM", "categories": [ "Other" ] }, { "id": "614607", "url": "http://www.omim.org/entry/614607", "database": "MIM", "categories": [ "Other" ] }, { "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "CRPIDMD", "url": "https://omabrowser.org/oma/group/CRPIDMD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GTU5", "url": "https://www.orthodb.org/?gene=A0A1B0GTU5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A1B0GVT5", "url": "https://www.orthodb.org/?gene=A0A1B0GVT5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "E9PQW6", "url": "https://www.orthodb.org/?gene=E9PQW6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0Y488", "url": "https://www.orthodb.org/?gene=H0Y488", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0YCU6", "url": "https://www.orthodb.org/?gene=H0YCU6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "H0YEW5", "url": "https://www.orthodb.org/?gene=H0YEW5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "O14497", "url": "https://www.orthodb.org/?gene=O14497", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12656", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12656", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12656:SF12", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12656:SF12", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "pdb_00001ryu", "url": "https://www.rcsb.org/structure/pdb_00001ryu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006lth", "url": "https://www.rcsb.org/structure/pdb_00006lth", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ltj", "url": "https://www.rcsb.org/structure/pdb_00006ltj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1RYU", "url": "https://www.rcsb.org/structure/1RYU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LTH", "url": "https://www.rcsb.org/structure/6LTH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6LTJ", "url": "https://www.rcsb.org/structure/6LTJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01388", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01388", "database": "Pfam", "categories": [ "Other", "Protein Classification" ] }, { "id": "PF12031", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF12031", "database": "Pfam", "categories": [ "Other", "Protein Classification" ] }, { "id": "O14497", "url": "https://pharos.nih.gov/targets/O14497", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:O14497", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:O14497", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-8939243", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939243", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9764790", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764790", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9845323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845323", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9933937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933937", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9933946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933946", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-HSA-9934037", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9934037", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1B0GTU5", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GTU5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GTU5-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GTU5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVT5", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVT5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVT5-1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GVT5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABJ7H312", "url": "https://www.uniprot.org/uniprotkb/A0ABJ7H312", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABJ7H312-1", "url": "https://www.uniprot.org/uniprotkb/A0ABJ7H312-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABJ7H8R8", "url": "https://www.uniprot.org/uniprotkb/A0ABJ7H8R8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABJ7H8R8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABJ7H8R8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQW6", "url": "https://www.uniprot.org/uniprotkb/E9PQW6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PQW6-1", "url": "https://www.uniprot.org/uniprotkb/E9PQW6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y488", "url": "https://www.uniprot.org/uniprotkb/H0Y488", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y488-1", "url": "https://www.uniprot.org/uniprotkb/H0Y488-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YCU6", "url": "https://www.uniprot.org/uniprotkb/H0YCU6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YCU6-1", "url": "https://www.uniprot.org/uniprotkb/H0YCU6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YEW5", "url": "https://www.uniprot.org/uniprotkb/H0YEW5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YEW5-1", "url": "https://www.uniprot.org/uniprotkb/H0YEW5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14497-1", "url": "https://www.uniprot.org/uniprotkb/O14497-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14497-2", "url": "https://www.uniprot.org/uniprotkb/O14497-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14497-3", "url": "https://www.uniprot.org/uniprotkb/O14497-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 2285, "header": "sp|O14497-1|ARI1A_HUMAN Isoform 1 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3 CANONICAL=O14497-1" }, "isoforms": [ { "isoform_ac": "A0A1B0GTU5-1", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#A0A1B0GTU5-1", "sequence": { "sequence": "SPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 1903, "header": "tr|A0A1B0GTU5-1|ARI1A_HUMAN Computationally mapped isoform of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=1 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26780753, "end_pos": 26729657, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000636219.1", "url": "https://www.ensembl.org/id/ENST00000636219.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000489842.1", "url": "https://www.ensembl.org/id/ENSP00000489842.1" } ] } }, { "isoform_ac": "A0A1B0GVT5-1", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#A0A1B0GVT5-1", "sequence": { "sequence": "MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQ", "length": 206, "header": "tr|A0A1B0GVT5-1|A0A1B0GVT5_HUMAN Computationally mapped isoform of AT-rich interaction domain 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=1 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26731568, "end_pos": 26729663, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000637465.1", "url": "https://www.ensembl.org/id/ENST00000637465.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000490650.1", "url": "https://www.ensembl.org/id/ENSP00000490650.1" } ] } }, { "isoform_ac": "A0ABJ7H312-1", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#A0ABJ7H312-1", "sequence": { "sequence": "MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 2275, "header": "tr|A0ABJ7H312-1|A0ABJ7H312_HUMAN Computationally mapped isoform of AT-rich interaction domain 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=1 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26780753, "end_pos": 26696404, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000850904.1", "url": "https://www.ensembl.org/id/ENST00000850904.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000520984.1", "url": "https://www.ensembl.org/id/ENSP00000520984.1" } ] } }, { "isoform_ac": "A0ABJ7H8R8-1", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#A0ABJ7H8R8-1", "sequence": { "sequence": "XYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQVLYIFLLKQGKGRKSGGCFWKQLQKTIC", "length": 164, "header": "tr|A0ABJ7H8R8-1|A0ABJ7H8R8_HUMAN Computationally mapped isoform of AT-rich interaction domain 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=1 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26774200, "end_pos": 26772967, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000636794.2", "url": "https://www.ensembl.org/id/ENST00000636794.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000520985.1", "url": "https://www.ensembl.org/id/ENSP00000520985.1" } ] } }, { "isoform_ac": "E9PQW6-1", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#E9PQW6-1", "sequence": { "sequence": "MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQ", "length": 122, "header": "tr|E9PQW6-1|E9PQW6_HUMAN Computationally mapped isoform of AT-rich interaction domain 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=8 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26731316, "end_pos": 26729663, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000524572.1", "url": "https://www.ensembl.org/id/ENST00000524572.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000432473.1", "url": "https://www.ensembl.org/id/ENSP00000432473.1" } ] } }, { "isoform_ac": "H0Y488-1", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#H0Y488-1", "sequence": { "sequence": "MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 1901, "header": "tr|H0Y488-1|H0Y488_HUMAN Computationally mapped isoform of AT-rich interaction domain 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=2 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26780753, "end_pos": 26729663, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000430799.7", "url": "https://www.ensembl.org/id/ENST00000430799.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000390317.3", "url": "https://www.ensembl.org/id/ENSP00000390317.3" } ] } }, { "isoform_ac": "H0YCU6-1", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#H0YCU6-1", "sequence": { "sequence": "XPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQEPRRHGG", "length": 144, "header": "tr|H0YCU6-1|H0YCU6_HUMAN Computationally mapped isoform of AT-rich interaction domain 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=1 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26775598, "end_pos": 26772964, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000466382.2", "url": "https://www.ensembl.org/id/ENST00000466382.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000432368.1", "url": "https://www.ensembl.org/id/ENSP00000432368.1" } ] } }, { "isoform_ac": "H0YEW5-1", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#H0YEW5-1", "sequence": { "sequence": "XGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQISSMPVLCFLCLWARAQDFDSNNNLFT", "length": 188, "header": "tr|H0YEW5-1|H0YEW5_HUMAN Computationally mapped isoform of AT-rich interaction domain 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=1 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26775898, "end_pos": 26774870, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000532781.1", "url": "https://www.ensembl.org/id/ENST00000532781.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000436692.1", "url": "https://www.ensembl.org/id/ENSP00000436692.1" } ] } }, { "isoform_ac": "O14497-1", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#O14497-1", "sequence": { "sequence": "MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 2285, "header": "sp|O14497-1|ARI1A_HUMAN Isoform 1 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26780753, "end_pos": 26696404, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000324856.13", "url": "https://www.ensembl.org/id/ENST00000324856.13" }, { "database": "Ensembl Peptide", "id": "ENSP00000320485.7", "url": "https://www.ensembl.org/id/ENSP00000320485.7" } ] } }, { "isoform_ac": "O14497-2", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#O14497-2", "sequence": { "sequence": "MAAQVAPAAASSLGNPPPPPPSELKKAEQQQREEAGGEAAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPAPAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLARTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 2068, "header": "sp|O14497-2|ARI1A_HUMAN Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26780753, "end_pos": 26696404, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000457599.7", "url": "https://www.ensembl.org/id/ENST00000457599.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000387636.2", "url": "https://www.ensembl.org/id/ENSP00000387636.2" } ] } }, { "isoform_ac": "O14497-3", "url": "https://www.uniprot.org/uniprotkb/O14497/entry#O14497-3", "sequence": { "sequence": "MDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGGLSYTQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQQSPAPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPAPSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQIHTGMGSYQQNSMGSYGPQGGQYGPQGGYPRQPNYNALPNANYPSAGMAGGINPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYSMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFNDGSDSTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSTGQGQPQQQQLPPAQPQPASQQQAAQPSPQQDVYNQYGNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGTNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPAYHGVNRTDEMLHTDQRANHEGSWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKVSSPAPMEGGEEEEELLGPKLEEEEEEEVVENDEEIAFSGKDKPASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHAPCPPAPRKHVTTAEGTPGTTDQEGPPPDGPPEKRITATMDDMLSTRSSTLTEDGAKSSEAIKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 1902, "header": "sp|O14497-3|ARI1A_HUMAN Isoform 3 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A PE=1 SV=3 CANONICAL=O14497-1" }, "locus": { "chromosome": "1", "start_pos": 26780753, "end_pos": 26729663, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374152.7", "url": "https://www.ensembl.org/id/ENST00000374152.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000363267.2", "url": "https://www.ensembl.org/id/ENSP00000363267.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1090, "start_aa": "Ser", "end_pos": 1090, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1090", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1091, "start_aa": "Ser", "end_pos": 1091, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1091", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1180, "start_aa": "Ser", "end_pos": 1180, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1180", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1235, "start_aa": "Ser", "end_pos": 1235, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1235", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01011" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1242, "start_aa": "Ser", "end_pos": 1242, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1242", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 128, "start_aa": "Ser", "end_pos": 128, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser128", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 129, "start_aa": "Ser", "end_pos": 129, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser129", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1348, "start_aa": "Thr", "end_pos": 1348, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1348", "evidence": [ { "id": "GLY_001151", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001151" } ], "filter_code": "00000000000000001000.00000000001000.0.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1350, "start_aa": "Ser", "end_pos": 1350, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1350", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1352, "start_aa": "Ser", "end_pos": 1352, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1352", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1356, "start_aa": "Ser", "end_pos": 1356, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1356", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 138, "start_aa": "Ser", "end_pos": 138, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser138", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1414, "start_aa": "Ser", "end_pos": 1414, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1414", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1577, "start_aa": "Ser", "end_pos": 1577, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1577", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1888, "start_aa": "Thr", "end_pos": 1888, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1888", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000001000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01011" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1888, "start_aa": "Thr", "end_pos": 1888, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1888", "evidence": [ { "id": "GLY_001151", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001151" } ], "filter_code": "00000000000000001000.00000000001000.00.01011" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 220, "start_aa": "Ser", "end_pos": 220, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser220", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 2262, "start_aa": "Ser", "end_pos": 2262, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2262", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 238, "start_aa": "Thr", "end_pos": 238, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr238", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000001000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Thr", "end_pos": 238, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr238", "evidence": [ { "id": "GLY_001151", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001151" } ], "filter_code": "00000000000000001000.00000000001000.00.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 241, "start_aa": "Ser", "end_pos": 241, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser241", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 249, "start_aa": "Ser", "end_pos": 249, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser249", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "35705054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35705054" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01000" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 254, "start_aa": "Ser", "end_pos": 254, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser254", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" }, { "id": "35705054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35705054" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 254, "start_aa": "Ser", "end_pos": 254, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser254", "evidence": [ { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "GLY_000142", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000142" } ], "filter_code": "00000000000000010000.0000000.00000000001000.1000000.0100000000.111111100011111111.01000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 255, "start_aa": "Ser", "end_pos": 255, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser255", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "37541260", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37541260" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" }, { "id": "35513511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35513511" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 255, "start_aa": "Ser", "end_pos": 255, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser255", "evidence": [ { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "GLY_000142", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000142" } ], "filter_code": "00000000000000010000.0000000.00000000001000.1000000.0100000000.111111100011111111.01000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 256, "start_aa": "Ser", "end_pos": 256, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser256", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" }, { "id": "35513511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35513511" }, { "id": "37541260", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37541260" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 256, "start_aa": "Ser", "end_pos": 256, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser256", "evidence": [ { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "GLY_000142", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000142" } ], "filter_code": "00000000000000010000.0000000.00000000001000.1000000.0100000000.111111100011111111.01000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 258, "start_aa": "Ser", "end_pos": 258, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser258", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 258, "start_aa": "Ser", "end_pos": 258, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser258", "evidence": [ { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "GLY_000142", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000142" } ], "filter_code": "00000000000000010000.0000000.00000000001000.1000000.0100000000.111111100011111111.01000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 260, "start_aa": "Ser", "end_pos": 260, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser260", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 261, "start_aa": "Ser", "end_pos": 261, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser261", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 262, "start_aa": "Ser", "end_pos": 262, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser262", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 264, "start_aa": "Ser", "end_pos": 264, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser264", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 265, "start_aa": "Ser", "end_pos": 265, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser265", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 58, "start_aa": "Ser", "end_pos": 58, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser58", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01011" }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 58, "start_aa": "Ser", "end_pos": 58, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser58", "evidence": [ { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "GLY_000142", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000142" } ], "filter_code": "00000000000000010000.0000000.00000000001000.1000000.0100000000.111111100011111111.01000.01011" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 637, "start_aa": "Ser", "end_pos": 637, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser637", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 696, "start_aa": "Ser", "end_pos": 696, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser696", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01011" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 705, "start_aa": "Ser", "end_pos": 705, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser705", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 709, "start_aa": "Ser", "end_pos": 709, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser709", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 711, "start_aa": "Ser", "end_pos": 711, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser711", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "Y", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 762, "start_aa": "Tyr", "end_pos": 762, "end_aa": "Tyr", "residue": "Tyr", "site_lbl": "Tyr762", "evidence": [ { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000000010.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 763, "start_aa": "Ser", "end_pos": 763, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser763", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "32938750", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32938750" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" }, { "id": "35705054", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35705054" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01001" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 764, "start_aa": "Ser", "end_pos": 764, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser764", "evidence": [ { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" }, { "id": "O14497", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "39534244", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39534244" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "30059200", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30059200" }, { "id": "39302247", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39302247" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "40136647", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40136647" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "39531497", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/39531497" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "27655845", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27655845" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "40307207", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40307207" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" }, { "id": "38665916", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38665916" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "O14497", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "filter_code": "00000000000000010000.0000000.00000001000000.1000000.0100000000.110100100001111011.10000.01011" } ], "phosphorylation": [ { "start_pos": 1087, "end_pos": 1087, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1087" }, { "start_pos": 1182, "end_pos": 1182, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1182" }, { "start_pos": 1184, "end_pos": 1184, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Ser1184" }, { "start_pos": 1235, "end_pos": 1235, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "site_lbl": "Ser1235" }, { "start_pos": 1604, "end_pos": 1604, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "site_lbl": "Ser1604" }, { "start_pos": 1751, "end_pos": 1751, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser1751" }, { "start_pos": 1754, "end_pos": 1754, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser1754" }, { "start_pos": 1755, "end_pos": 1755, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1755" }, { "start_pos": 1888, "end_pos": 1888, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "site_lbl": "Thr1888" }, { "start_pos": 1929, "end_pos": 1929, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "site_lbl": "Ser1929" }, { "start_pos": 1944, "end_pos": 1944, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser1944" }, { "start_pos": 233, "end_pos": 233, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Ser233" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "site_lbl": "Thr286" }, { "start_pos": 301, "end_pos": 301, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Ser301" }, { "start_pos": 363, "end_pos": 363, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser363" }, { "start_pos": 367, "end_pos": 367, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser367" }, { "start_pos": 382, "end_pos": 382, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser382" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "site_lbl": "Ser58" }, { "start_pos": 604, "end_pos": 604, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" }, { "database": "PubMed", "id": "18077418", "url": "https://glygen.org/publication/PubMed/18077418" } ], "site_lbl": "Ser604" }, { "start_pos": 696, "end_pos": 696, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "25083560", "url": "https://glygen.org/publication/PubMed/25083560" } ], "site_lbl": "Ser696" }, { "start_pos": 698, "end_pos": 698, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Ser698" }, { "start_pos": 702, "end_pos": 702, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Ser702" }, { "start_pos": 730, "end_pos": 730, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "site_lbl": "Ser730" }, { "start_pos": 764, "end_pos": 764, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser764" }, { "start_pos": 772, "end_pos": 772, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Ser772" }, { "start_pos": 79, "end_pos": 79, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "site_lbl": "Ser79" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported", "glycoprotein_predicted" ], "publication": [ { "title": "Ser298 of MITF, a mutation site in Waardenburg syndrome type 2, is a phosphorylation site with functional significance.", "journal": "Human molecular genetics", "date": "2000", "authors": "Takeda K, Takemoto C, Kobayashi I, Watanabe A, Nobukuni Y, Fisher DE, Tachibana M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "10587587", "url": "https://glygen.org/publication/PubMed/10587587" } ] }, { "title": "The human SWI-SNF complex protein p270 is an ARID family member with non-sequence-specific DNA binding activity.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Dallas PB, Pacchione S, Wilsker D, Bowrin V, Kobayashi R, Moran E", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "10757798", "url": "https://glygen.org/publication/PubMed/10757798" } ] }, { "title": "A specificity and targeting subunit of a human SWI/SNF family-related chromatin-remodeling complex.", "journal": "Mol. Cell. Biol.", "date": "2000", "authors": "Nie Z, Xue Y, Yang D, Zhou S, Deroo B J, Archer T K, Wang W", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "11073988", "url": "https://glygen.org/publication/PubMed/11073988" } ] }, { "title": "Initial sequencing and analysis of the human genome.", "journal": "Nature", "date": "2001", "authors": "Lander ES, Linton LM, Birren B, Nusbaum C, Zody MC, Baldwin J, Devon K, Dewar K, Doyle M, FitzHugh W, Funke R, Gage D, Harris K, Heaford A, Howland J, Kann L, Lehoczky J, LeVine R, McEwan P, McKernan K, Meldrim J, Mesirov JP, Miranda C, Morris W, Naylor J, Raymond C, Rosetti M, Santos R, Sheridan A, Sougnez C, Stange-Thomann Y, Stojanovic N, Subramanian A, Wyman D, Rogers J, Sulston J, Ainscough R, Beck S, Bentley D, Burton J, Clee C, Carter N, Coulson A, Deadman R, Deloukas P, Dunham A, Dunham I, Durbin R, French L, Grafham D, Gregory S, Hubbard T, Humphray S, Hunt A, Jones M, Lloyd C, McMurray A, Matthews L, Mercer S, Milne S, Mullikin JC, Mungall A, Plumb R, Ross M, Shownkeen R, Sims S, Waterston RH, Wilson RK, Hillier LW, McPherson JD, Marra MA, Mardis ER, Fulton LA, Chinwalla AT, Pepin KH, Gish WR, Chissoe SL, Wendl MC, Delehaunty KD, Miner TL, Delehaunty A, Kramer JB, Cook LL, Fulton RS, Johnson DL, Minx PJ, Clifton SW, Hawkins T, Branscomb E, Predki P, Richardson P, Wenning S, Slezak T, Doggett N, Cheng JF, Olsen A, Lucas S, Elkin C, Uberbacher E, Frazier M, Gibbs RA, Muzny DM, Scherer SE, Bouck JB, Sodergren EJ, Worley KC, Rives CM, Gorrell JH, Metzker ML, Naylor SL, Kucherlapati RS, Nelson DL, Weinstock GM, Sakaki Y, Fujiyama A, Hattori M, Yada T, Toyoda A, Itoh T, Kawagoe C, Watanabe H, Totoki Y, Taylor T, Weissenbach J, Heilig R, Saurin W, Artiguenave F, Brottier P, Bruls T, Pelletier E, Robert C, Wincker P, Smith DR, Doucette-Stamm L, Rubenfield M, Weinstock K, Lee HM, Dubois J, Rosenthal A, Platzer M, Nyakatura G, Taudien S, Rump A, Yang H, Yu J, Wang J, Huang G, Gu J, Hood L, Rowen L, Madan A, Qin S, Davis RW, Federspiel NA, Abola AP, Proctor MJ, Myers RM, Schmutz J, Dickson M, Grimwood J, Cox DR, Olson MV, Kaul R, Raymond C, Shimizu N, Kawasaki K, Minoshima S, Evans GA, Athanasiou M, Schultz R, Roe BA, Chen F, Pan H, Ramser J, Lehrach H, Reinhardt R, McCombie WR, de la Bastide M, Dedhia N, Blocker H, Hornischer K, Nordsiek G, Agarwala R, Aravind L, Bailey JA, Bateman A, Batzoglou S, Birney E, Bork P, Brown DG, Burge CB, Cerutti L, Chen HC, Church D, Clamp M, Copley RR, Doerks T, Eddy SR, Eichler EE, Furey TS, Galagan J, Gilbert JG, Harmon C, Hayashizaki Y, Haussler D, Hermjakob H, Hokamp K, Jang W, Johnson LS, Jones TA, Kasif S, Kaspryzk A, Kennedy S, Kent WJ, Kitts P, Koonin EV, Korf I, Kulp D, Lancet D, Lowe TM, McLysaght A, Mikkelsen T, Moran JV, Mulder N, Pollara VJ, Ponting CP, Schuler G, Schultz J, Slater G, Smit AF, Stupka E, Szustakowki J, Thierry-Mieg D, Thierry-Mieg J, Wagner L, Wallis J, Wheeler R, Williams A, Wolf YI, Wolfe KH, Yang SP, Yeh RF, Collins F, Guyer MS, Peterson J, Felsenfeld A, Wetterstrand KA, Patrinos A, Morgan MJ, de Jong P, Catanese JJ, Osoegawa K, Shizuya H, Choi S, Chen YJ, Szustakowki J", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GTU5", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GTU5" } ], "reference": [ { "type": "PubMed", "id": "11237011", "url": "https://glygen.org/publication/PubMed/11237011" } ] }, { "title": "Characterization of mammalian orthologues of the Drosophila osa gene: cDNA cloning, expression, chromosomal localization, and direct physical interaction with Brahma chromatin-remodeling complex.", "journal": "Genomics", "date": "2001", "authors": "Kozmik Z, Machon O, Kr\u00e1lov\u00e1 J, Kreslov\u00e1 J, Paces J, Vlcek C", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "11318604", "url": "https://glygen.org/publication/PubMed/11318604" } ] }, { "title": "Methylation of histone H3 by coactivator-associated arginine methyltransferase 1.", "journal": "Biochemistry", "date": "2001", "authors": "Schurter BT, Koh SS, Chen D, Bunick GJ, Harp JM, Hanson BL, Henschen-Edman A, Mackay DR, Stallcup MR, Aswad DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11341840", "url": "https://glygen.org/publication/PubMed/11341840" } ] }, { "title": "Methylation of histone H4 at arginine 3 occurs in vivo and is mediated by the nuclear receptor coactivator PRMT1.", "journal": "Current biology : CB", "date": "2001", "authors": "Strahl BD, Briggs SD, Brame CJ, Caldwell JA, Koh SS, Ma H, Cook RG, Shabanowitz J, Hunt DF, Stallcup MR, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11448779", "url": "https://glygen.org/publication/PubMed/11448779" } ] }, { "title": "The Usf-1 transcription factor is a novel target for the stress-responsive p38 kinase and mediates UV-induced Tyrosinase expression.", "journal": "The EMBO journal", "date": "2001", "authors": "Galibert MD, Carreira S, Goding CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "11532965", "url": "https://glygen.org/publication/PubMed/11532965" } ] }, { "title": "SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Kato Hiroyuki, Tjernberg Agneta, Zhang Wenzhu, Krutchinsky Andrew N, An Woojin, Takeuchi Tamotsu, Ohtsuki Yuji, Sugano Sumio, de Bruijn Diederik R, Chait Brian T, Roeder Robert G", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "11734557", "url": "https://glygen.org/publication/PubMed/11734557" } ] }, { "title": "Hormone-dependent, CARM1-directed, arginine-specific methylation of histone H3 on a steroid-regulated promoter.", "journal": "Current biology : CB", "date": "2001", "authors": "Ma H, Baumann CT, Li H, Strahl BD, Rice R, Jelinek MA, Aswad DW, Allis CD, Hager GL, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11747826", "url": "https://glygen.org/publication/PubMed/11747826" } ] }, { "title": "Methylation at arginine 17 of histone H3 is linked to gene activation.", "journal": "EMBO reports", "date": "2002", "authors": "Bauer UM, Daujat S, Nielsen SJ, Nightingale K, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11751582", "url": "https://glygen.org/publication/PubMed/11751582" } ] }, { "title": "A novel WD repeat protein component of the methylosome binds Sm proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Friesen WJ, Wyce A, Paushkin S, Abel L, Rappsilber J, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11756452", "url": "https://glygen.org/publication/PubMed/11756452" } ] }, { "title": "Selectivity of chromatin-remodelling cofactors for ligand-activated transcription.", "journal": "Nature", "date": "2001", "authors": "Lemon B, Inouye C, King DS, Tjian R", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "11780067", "url": "https://glygen.org/publication/PubMed/11780067" } ] }, { "title": "Slac2-a/melanophilin, the missing link between Rab27 and myosin Va: implications of a tripartite protein complex for melanosome transport.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fukuda M, Kuroda TS, Mikoshiba K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "11856727", "url": "https://glygen.org/publication/PubMed/11856727" } ] }, { "title": "MyRIP, a novel Rab effector, enables myosin VIIa recruitment to retinal melanosomes.", "journal": "EMBO reports", "date": "2002", "authors": "El-Amraoui A, Schonn JS, Kussel-Andermann P, Blanchard S, Desnos C, Henry JP, Wolfrum U, Darchen F, Petit C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "11964381", "url": "https://glygen.org/publication/PubMed/11964381" } ] }, { "title": "Cloning and characterization of hELD/OSA1, a novel BRG1 interacting protein.", "journal": "Biochem. J.", "date": "2002", "authors": "Hurlstone AF, Olave IA, Barker N, van Noort M, Clevers H", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "11988099", "url": "https://glygen.org/publication/PubMed/11988099" } ] }, { "title": "Melanophilin directly links Rab27a and myosin Va through its distinct coiled-coil regions.", "journal": "FEBS letters", "date": "2002", "authors": "Nagashima K, Torii S, Yi Z, Igarashi M, Okamoto K, Takeuchi T, Izumi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "12062444", "url": "https://glygen.org/publication/PubMed/12062444" } ] }, { "title": "Largest subunits of the human SWI/SNF chromatin-remodeling complex promote transcriptional activation by steroid hormone receptors.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Inoue Hiroko, Furukawa Takako, Giannakopoulos Stavros, Zhou Sharleen, King David S, Tanese Naoko", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "12200431", "url": "https://glygen.org/publication/PubMed/12200431" } ] }, { "title": "Identification of a polymorphic, neuron-specific chromatin remodeling complex.", "journal": "Genes & development", "date": "2002", "authors": "Olave I, Wang W, Xue Y, Kuo A, Crabtree GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9934037", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9934037" } ], "reference": [ { "type": "PubMed", "id": "12368262", "url": "https://glygen.org/publication/PubMed/12368262" } ] }, { "title": "Novel SWI/SNF chromatin-remodeling complexes contain a mixed-lineage leukemia chromosomal translocation partner.", "journal": "Mol. Cell. Biol.", "date": "2003", "authors": "Nie Zuqin, Yan Zhijiang, Chen Everett H, Sechi Salvatore, Ling Chen, Zhou Sharleen, Xue Yutong, Yang Dafeng, Murray Darryl, Kanakubo Emi, Cleary Michael L, Wang Weidong", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "12665591", "url": "https://glygen.org/publication/PubMed/12665591" } ] }, { "title": "Recent advances in understanding chromatin remodeling by Swi/Snf complexes.", "journal": "Current opinion in genetics & development", "date": "2003", "authors": "Martens JA, Winston F", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "12672490", "url": "https://glygen.org/publication/PubMed/12672490" } ] }, { "title": "Positive and negative elements regulate a melanocyte-specific promoter.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Lowings P, Yavuzer U, Goding CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "1321344", "url": "https://glygen.org/publication/PubMed/1321344" } ] }, { "title": "Structure and DNA-binding sites of the SWI1 AT-rich interaction domain (ARID) suggest determinants for sequence-specific DNA recognition.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Kim Suhkmann, Zhang Ziming, Upchurch Sean, Isern Nancy, Chen Yuan", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "14722072", "url": "https://glygen.org/publication/PubMed/14722072" } ] }, { "title": "Two related ARID family proteins are alternative subunits of human SWI/SNF complexes.", "journal": "Biochem. J.", "date": "2004", "authors": "Wang Xiaomei, Nagl Norman G, Wilsker Deborah, Van Scoy Michael, Pacchione Stephen, Yaciuk Peter, Dallas Peter B, Moran Elizabeth", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "15170388", "url": "https://glygen.org/publication/PubMed/15170388" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "A second tyrosinase-related protein, TRP-2, is a melanogenic enzyme termed DOPAchrome tautomerase.", "journal": "The EMBO journal", "date": "1992", "authors": "Tsukamoto K, Jackson IJ, Urabe K, Montague PM, Hearing VJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "1537333", "url": "https://glygen.org/publication/PubMed/1537333" } ] }, { "title": "A second tyrosinase-related protein, TRP-2, maps to and is mutated at the mouse slaty locus.", "journal": "The EMBO journal", "date": "1992", "authors": "Jackson IJ, Chambers DM, Tsukamoto K, Copeland NG, Gilbert DJ, Jenkins NA, Hearing V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "1537334", "url": "https://glygen.org/publication/PubMed/1537334" } ] }, { "title": "Human SWI/SNF-associated PRMT5 methylates histone H3 arginine 8 and negatively regulates expression of ST7 and NM23 tumor suppressor genes.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Pal S, Vishwanath SN, Erdjument-Bromage H, Tempst P, Sif S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "15485929", "url": "https://glygen.org/publication/PubMed/15485929" } ] }, { "title": "Rab27A-binding protein Slp2-a is required for peripheral melanosome distribution and elongated cell shape in melanocytes.", "journal": "Nature cell biology", "date": "2004", "authors": "Kuroda TS, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "15543135", "url": "https://glygen.org/publication/PubMed/15543135" } ] }, { "title": "MART-1 is required for the function of the melanosomal matrix protein PMEL17/GP100 and the maturation of melanosomes.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Hoashi T, Watabe H, Muller J, Yamaguchi Y, Vieira WD, Hearing VJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "15695812", "url": "https://glygen.org/publication/PubMed/15695812" } ] }, { "title": "Pax3 functions at a nodal point in melanocyte stem cell differentiation.", "journal": "Nature", "date": "2005", "authors": "Lang D, Lu MM, Huang L, Engleka KA, Zhang M, Chu EY, Lipner S, Skoultchi A, Millar SE, Epstein JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "15729346", "url": "https://glygen.org/publication/PubMed/15729346" } ] }, { "title": "The ocular albinism type 1 (OA1) gene controls melanosome maturation and size.", "journal": "Investigative ophthalmology & visual science", "date": "2005", "authors": "Cortese K, Giordano F, Surace EM, Venturi C, Ballabio A, Tacchetti C, Marigo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "16303920", "url": "https://glygen.org/publication/PubMed/16303920" } ] }, { "title": "Roles of HIPK1 and HIPK2 in AML1- and p300-dependent transcription, hematopoiesis and blood vessel formation.", "journal": "The EMBO journal", "date": "2006", "authors": "Aikawa Y, Nguyen LA, Isono K, Takakura N, Tagata Y, Schmitz ML, Koseki H, Kitabayashi I", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939243", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939243" } ], "reference": [ { "type": "PubMed", "id": "16917507", "url": "https://glygen.org/publication/PubMed/16917507" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Exophilin4/Slp2-a targets glucagon granules to the plasma membrane through unique Ca2+-inhibitory phospholipid-binding activity of the C2A domain.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Yu M, Kasai K, Nagashima K, Torii S, Yokota-Hashimoto H, Okamoto K, Takeuchi T, Gomi H, Izumi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "17182843", "url": "https://glygen.org/publication/PubMed/17182843" } ] }, { "title": "Histone arginine methylation regulates pluripotency in the early mouse embryo.", "journal": "Nature", "date": "2007", "authors": "Torres-Padilla ME, Parfitt DE, Kouzarides T, Zernicka-Goetz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17215844", "url": "https://glygen.org/publication/PubMed/17215844" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.", "journal": "Science", "date": "2007", "authors": "Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ", "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GTU5", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GTU5" }, { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" } ] }, { "title": "An essential switch in subunit composition of a chromatin remodeling complex during neural development.", "journal": "Neuron", "date": "2007-07-19", "authors": "Lessard Julie, Wu Jiang I, Ranish Jeffrey A, Wan Mimi, Winslow Monte M, Staahl Brett T, Wu Hai, Aebersold Ruedi, Graef Isabella A, Crabtree Gerald R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9933937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933937" } ], "reference": [ { "type": "PubMed", "id": "17640523", "url": "https://glygen.org/publication/PubMed/17640523" } ] }, { "title": "Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.", "journal": "Nature", "date": "2007", "authors": "Guccione E, Bassi C, Casadio F, Martinato F, Cesaroni M, Schuchlautz H, Luscher B, Amati B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17898714", "url": "https://glygen.org/publication/PubMed/17898714" } ] }, { "title": "Genetic determinants of hair, eye and skin pigmentation in Europeans.", "journal": "Nature genetics", "date": "2007", "authors": "Sulem P, Gudbjartsson DF, Stacey SN, Helgason A, Rafnar T, Magnusson KP, Manolescu A, Karason A, Palsson A, Thorleifsson G, Jakobsdottir M, Steinberg S, Palsson S, Jonasson F, Sigurgeirsson B, Thorisdottir K, Ragnarsson R, Benediktsdottir KR, Aben KK, Kiemeney LA, Olafsson JH, Gulcher J, Kong A, Thorsteinsdottir U, Stefansson K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "17952075", "url": "https://glygen.org/publication/PubMed/17952075" } ] }, { "title": "Profiling of UV-induced ATM/ATR signaling pathways.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Stokes MP, Rush J, Macneill J, Ren JM, Sprott K, Nardone J, Yang V, Beausoleil SA, Gygi SP, Livingstone M, Zhang H, Polakiewicz RD, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "18077418", "url": "https://glygen.org/publication/PubMed/18077418" } ] }, { "title": "PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.", "journal": "Genes & development", "date": "2007", "authors": "Hyllus D, Stein C, Schnabel K, Schiltz E, Imhof A, Dou Y, Hsieh J, Bauer UM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18079182", "url": "https://glygen.org/publication/PubMed/18079182" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "The histone-binding protein COPR5 is required for nuclear functions of the protein arginine methyltransferase PRMT5.", "journal": "EMBO reports", "date": "2008", "authors": "Lacroix M, El Messaoudi S, Rodier G, Le Cam A, Sardet C, Fabbrizio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18404153", "url": "https://glygen.org/publication/PubMed/18404153" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "A genome-wide association study identifies novel alleles associated with hair color and skin pigmentation.", "journal": "PLoS genetics", "date": "2008", "authors": "Han J, Kraft P, Nan H, Guo Q, Chen C, Qureshi A, Hankinson SE, Hu FB, Duffy DL, Zhao ZZ, Martin NG, Montgomery GW, Hayward NK, Thomas G, Hoover RN, Chanock S, Hunter DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "18483556", "url": "https://glygen.org/publication/PubMed/18483556" } ] }, { "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.", "journal": "Proteomics", "date": "2008", "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X", "evidence": [ { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "PEBP2-beta/CBF-beta-dependent phosphorylation of RUNX1 and p300 by HIPK2: implications for leukemogenesis.", "journal": "Blood", "date": "2008", "authors": "Wee HJ, Voon DC, Bae SC, Ito Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939243", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939243" } ], "reference": [ { "type": "PubMed", "id": "18695000", "url": "https://glygen.org/publication/PubMed/18695000" } ] }, { "title": "The ocular albinism type 1 protein, an intracellular G protein-coupled receptor, regulates melanosome transport in pigment cells.", "journal": "Human molecular genetics", "date": "2008", "authors": "Palmisano I, Bagnato P, Palmigiano A, Innamorati G, Rotondo G, Altimare D, Venturi C, Sviderskaya EV, Piccirillo R, Coppola M, Marigo V, Incerti B, Ballabio A, Surace EM, Tacchetti C, Bennett DC, Schiaffino MV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "18697795", "url": "https://glygen.org/publication/PubMed/18697795" } ] }, { "title": "Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.", "journal": "Genes Dev.", "date": "2008", "authors": "Lange M, Kaynak B, Forster UB, Tonjes M, Fischer JJ, Grimm C, Schlesinger J, Just S, Dunkel I, Krueger T, Mebus S, Lehrach H, Lurz R, Gobom J, Rottbauer W, Abdelilah-Seyfried S, Sperling S", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "Reactome", "id": "R-HSA-9933937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933937" } ], "reference": [ { "type": "PubMed", "id": "18765789", "url": "https://glygen.org/publication/PubMed/18765789" } ] }, { "title": "A newly identified isoform of Slp2a associates with Rab27a in cytotoxic T cells and participates to cytotoxic granule secretion.", "journal": "Blood", "date": "2008", "authors": "Menasche G, Menager MM, Lefebvre JM, Deutsch E, Athman R, Lambert N, Mahlaoui N, Court M, Garin J, Fischer A, de Saint Basile G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "18812475", "url": "https://glygen.org/publication/PubMed/18812475" } ] }, { "title": "PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Zhao Q, Rank G, Tan YT, Li H, Moritz RL, Simpson RJ, Cerruti L, Curtis DJ, Patel DJ, Allis CD, Cunningham JM, Jane SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "19234465", "url": "https://glygen.org/publication/PubMed/19234465" } ] }, { "title": "Target gene specificity of USF-1 is directed via p38-mediated phosphorylation-dependent acetylation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Corre S, Primot A, Baron Y, Le Seyec J, Goding C, Galibert MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "19389701", "url": "https://glygen.org/publication/PubMed/19389701" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "The ocular albinism type 1 (OA1) G-protein-coupled receptor functions with MART-1 at early stages of melanogenesis to control melanosome identity and composition.", "journal": "Human molecular genetics", "date": "2009", "authors": "Giordano F, Bonetti C, Surace EM, Marigo V, Raposo G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "19717472", "url": "https://glygen.org/publication/PubMed/19717472" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "iPTMnet", "id": "O14497-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "The human SWI/SNF complex associates with RUNX1 to control transcription of hematopoietic target genes.", "journal": "Journal of cellular physiology", "date": "2010", "authors": "Bakshi R, Hassan MQ, Pratap J, Lian JB, Montecino MA, van Wijnen AJ, Stein JL, Imbalzano AN, Stein GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939243", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939243" } ], "reference": [ { "type": "PubMed", "id": "20506188", "url": "https://glygen.org/publication/PubMed/20506188" } ] }, { "title": "Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase.", "journal": "Cancer cell", "date": "2010", "authors": "Aggarwal P, Vaites LP, Kim JK, Mellert H, Gurung B, Nakagawa H, Herlyn M, Hua X, Rustgi AK, McMahon SB, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "20951943", "url": "https://glygen.org/publication/PubMed/20951943" } ] }, { "title": "Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.", "journal": "Nature", "date": "2011", "authors": "Varela I, Tarpey P, Raine K, Huang D, Ong CK, Stephens P, Davies H, Jones D, Lin ML, Teague J, Bignell G, Butler A, Cho J, Dalgliesh GL, Galappaththige D, Greenman C, Hardy C, Jia M, Latimer C, Lau KW, Marshall J, McLaren S, Menzies A, Mudie L, Stebbings L, Largaespada DA, Wessels LF, Richard S, Kahnoski RJ, Anema J, Tuveson DA, Perez-Mancera PA, Mustonen V, Fischer A, Adams DJ, Rust A, Chan-on W, Subimerb C, Dykema K, Furge K, Campbell PJ, Teh BT, Stratton MR, Futreal PA", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "21248752", "url": "https://glygen.org/publication/PubMed/21248752" } ] }, { "title": "JAK2V617F-mediated phosphorylation of PRMT5 downregulates its methyltransferase activity and promotes myeloproliferation.", "journal": "Cancer cell", "date": "2011", "authors": "Liu F, Zhao X, Perna F, Wang L, Koppikar P, Abdel-Wahab O, Harr MW, Levine RL, Xu H, Tefferi A, Deblasio A, Hatlen M, Menendez S, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21316606", "url": "https://glygen.org/publication/PubMed/21316606" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.", "journal": "Journal of proteome research", "date": "2011", "authors": "Zhao P, Viner R, Teo CF, Boons GJ, Horn D, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "21740066", "url": "https://glygen.org/publication/PubMed/21740066" } ] }, { "title": "Methylation of H2AR29 is a novel repressive PRMT6 target.", "journal": "Epigenetics & chromatin", "date": "2011", "authors": "Waldmann T, Izzo A, Kamieniarz K, Richter F, Vogler C, Sarg B, Lindner H, Young NL, Mittler G, Garcia BA, Schneider R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21774791", "url": "https://glygen.org/publication/PubMed/21774791" } ] }, { "title": "Somatic mutations in the chromatin remodeling gene ARID1A occur in several tumor types.", "journal": "Human mutation", "date": "2012", "authors": "Jones S, Li M, Parsons DW, Zhang X, Wesseling J, Kristel P, Schmidt MK, Markowitz S, Yan H, Bigner D, Hruban RH, Eshleman JR, Iacobuzio-Donahue CA, Goggins M, Maitra A, Malek SN, Powell S, Vogelstein B, Kinzler KW, Velculescu VE, Papadopoulos N", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "22009941", "url": "https://glygen.org/publication/PubMed/22009941" } ] }, { "title": "Symmetric dimethylation of H3R2 is a newly identified histone mark that supports euchromatin maintenance.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Migliori V, Muller J, Phalke S, Low D, Bezzi M, Mok WC, Sahu SK, Gunaratne J, Capasso P, Bassi C, Cecatiello V, De Marco A, Blackstock W, Kuznetsov V, Amati B, Mapelli M, Guccione E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "22231400", "url": "https://glygen.org/publication/PubMed/22231400" } ] }, { "title": "Direct recruitment of polycomb repressive complex 1 to chromatin by core binding transcription factors.", "journal": "Molecular cell", "date": "2012", "authors": "Yu M, Mazor T, Huang H, Huang HT, Kathrein KL, Woo AJ, Chouinard CR, Labadorf A, Akie TE, Moran TB, Xie H, Zacharek S, Taniuchi I, Roeder RG, Kim CF, Zon LI, Fraenkel E, Cantor AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-8939243", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939243" } ], "reference": [ { "type": "PubMed", "id": "22325351", "url": "https://glygen.org/publication/PubMed/22325351" } ] }, { "title": "Mutations affecting components of the SWI/SNF complex cause Coffin-Siris syndrome.", "journal": "Nat. Genet.", "date": "2012", "authors": "Tsurusaki Y, Okamoto N, Ohashi H, Kosho T, Imai Y, Hibi-Ko Y, Kaname T, Naritomi K, Kawame H, Wakui K, Fukushima Y, Homma T, Kato M, Hiraki Y, Yamagata T, Yano S, Mizuno S, Sakazume S, Ishii T, Nagai T, Shiina M, Ogata K, Ohta T, Niikawa N, Miyatake S, Okada I, Mizuguchi T, Doi H, Saitsu H, Miyake N, Matsumoto N", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "22426308", "url": "https://glygen.org/publication/PubMed/22426308" } ] }, { "title": "Alternative peptide repertoire of HLA-E reveals a binding motif that is strikingly similar to HLA-A2.", "journal": "Molecular immunology", "date": "2013-01", "authors": "Lampen Margit H, Hassan Chopie, Sluijter Marjolein, Geluk Annemieke, Dijkman Karin, Tjon Jennifer M, de Ru Arnoud H, van der Burg Sjoerd H, van Veelen Peter A, van Hall Thorbald", "evidence": [ { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" } ], "reference": [ { "type": "PubMed", "id": "22898188", "url": "https://glygen.org/publication/PubMed/22898188" } ] }, { "title": "SWI/SNF chromatin-remodeling factors: multiscale analyses and diverse functions.", "journal": "The Journal of biological chemistry", "date": "2012-09-07", "authors": "Euskirchen Ghia, Auerbach Raymond K, Snyder Michael", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "Reactome", "id": "R-HSA-9933937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933937" } ], "reference": [ { "type": "PubMed", "id": "22952240", "url": "https://glygen.org/publication/PubMed/22952240" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "The human leukocyte antigen-presented ligandome of B lymphocytes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013-07", "authors": "Hassan Chopie, Kester Michel G D, de Ru Arnoud H, Hombrink Pleun, Drijfhout Jan Wouter, Nijveen Harm, Leunissen Jack A M, Heemskerk Mirjam H M, Falkenburg J H Frederik, van Veelen Peter A", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "436239", "url": "https://www.iedb.org/epitope/436239" }, { "database": "IEDB", "id": "453610", "url": "https://www.iedb.org/epitope/453610" }, { "database": "IEDB", "id": "456478", "url": "https://www.iedb.org/epitope/456478" }, { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "459252", "url": "https://www.iedb.org/epitope/459252" } ], "reference": [ { "type": "PubMed", "id": "23481700", "url": "https://glygen.org/publication/PubMed/23481700" } ] }, { "title": "Proteomic and bioinformatic analysis of mammalian SWI/SNF complexes identifies extensive roles in human malignancy.", "journal": "Nature genetics", "date": "2013-06", "authors": "Kadoch Cigall, Hargreaves Diana C, Hodges Courtney, Elias Laura, Ho Lena, Ranish Jeff, Crabtree Gerald R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9933937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933937" } ], "reference": [ { "type": "PubMed", "id": "23644491", "url": "https://glygen.org/publication/PubMed/23644491" } ] }, { "title": "Kinetic analysis of npBAF to nBAF switching reveals exchange of SS18 with CREST and integration with neural developmental pathways.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2013", "authors": "Staahl BT, Tang J, Wu W, Sun A, Gitler AD, Yoo AS, Crabtree GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9933937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933937" } ], "reference": [ { "type": "PubMed", "id": "23785148", "url": "https://glygen.org/publication/PubMed/23785148" } ] }, { "title": "A comprehensive molecular study on Coffin-Siris and Nicolaides-Baraitser syndromes identifies a broad molecular and clinical spectrum converging on altered chromatin remodeling.", "journal": "Hum. Mol. Genet.", "date": "2013", "authors": "Wieczorek D, Bogershausen N, Beleggia F, Steiner-Haldenstatt S, Pohl E, Li Y, Milz E, Martin M, Thiele H, Altmuller J, Alanay Y, Kayserili H, Klein-Hitpass L, Bohringer S, Wollstein A, Albrecht B, Boduroglu K, Caliebe A, Chrzanowska K, Cogulu O, Cristofoli F, Czeschik JC, Devriendt K, Dotti MT, Elcioglu N, Gener B, Goecke TO, Krajewska-Walasek M, Guillen-Navarro E, Hayek J, Houge G, Kilic E, Simsek-Kiper PO, Lopez-Gonzalez V, Kuechler A, Lyonnet S, Mari F, Marozza A, Mathieu Dramard M, Mikat B, Morin G, Morice-Picard F, Ozkinay F, Rauch A, Renieri A, Tinschert S, Utine GE, Vilain C, Vivarelli R, Zweier C, Nurnberg P, Rahmann S, Vermeesch J, Ludecke HJ, Zeschnigk M, Wollnik B", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "23906836", "url": "https://glygen.org/publication/PubMed/23906836" } ] }, { "title": "Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Guo A, Gu H, Zhou J, Mulhern D, Wang Y, Lee KA, Yang V, Aguiar M, Kornhauser J, Jia X, Ren J, Beausoleil SA, Silva JC, Vemulapalli V, Bedford MT, Comb MJ", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "24129315", "url": "https://glygen.org/publication/PubMed/24129315" } ] }, { "title": "A polymorphism in IRF4 affects human pigmentation through a tyrosinase-dependent MITF/TFAP2A pathway.", "journal": "Cell", "date": "2013-11-21", "authors": "Praetorius Christian, Grill Christine, Stacey Simon N, Metcalf Alexander M, Gorkin David U, Robinson Kathleen C, Van Otterloo Eric, Kim Reuben S Q, Bergsteinsdottir Kristin, Ogmundsdottir Margret H, Magnusdottir Erna, Mishra Pravin J, Davis Sean R, Guo Theresa, Zaidi M Raza, Helgason Agnar S, Sigurdsson Martin I, Meltzer Paul S, Merlino Glenn, Petit Valerie, Larue Lionel, Loftus Stacie K, Adams David R, Sobhiafshar Ulduz, Emre N C Tolga, Pavan William J, Cornell Robert, Smith Aaron G, McCallion Andrew S, Fisher David E, Stefansson Kari, Sturm Richard A, Steingrimsson Eirikur", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "24267888", "url": "https://glygen.org/publication/PubMed/24267888" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Increased diversity of the HLA-B40 ligandome by the presentation of peptides phosphorylated at their main anchor residue.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014-02", "authors": "Marcilla Miguel, Alp\u00edzar Ad\u00e1n, Lombard\u00eda Manuel, Ramos-Fernandez Antonio, Ramos Manuel, Albar Juan Pablo", "evidence": [ { "database": "IEDB", "id": "224520", "url": "https://www.iedb.org/epitope/224520" } ], "reference": [ { "type": "PubMed", "id": "24366607", "url": "https://glygen.org/publication/PubMed/24366607" } ] }, { "title": "Impact of genomic polymorphisms on the repertoire of human MHC class I-associated peptides.", "journal": "Nature communications", "date": "2014-04-09", "authors": "Granados Diana Paola, Sriranganadane Dev, Daouda Tariq, Zieger Antoine, Laumont C\u00e9line M, Caron-Lizotte Olivier, Boucher Genevi\u00e8ve, Hardy Marie-Pierre, Gendron Patrick, C\u00f4t\u00e9 Caroline, Lemieux S\u00e9bastien, Thibault Pierre, Perreault Claude", "evidence": [ { "database": "IEDB", "id": "213285", "url": "https://www.iedb.org/epitope/213285" } ], "reference": [ { "type": "PubMed", "id": "24714562", "url": "https://glygen.org/publication/PubMed/24714562" } ] }, { "title": "The nature and extent of contributions by defective ribosome products to the HLA peptidome.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014-04-22", "authors": "Bourdetsky Dmitry, Schmelzer Christian E H, Admon Arie", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "448605", "url": "https://www.iedb.org/epitope/448605" }, { "database": "IEDB", "id": "456478", "url": "https://www.iedb.org/epitope/456478" }, { "database": "IEDB", "id": "508371", "url": "https://www.iedb.org/epitope/508371" }, { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "508592", "url": "https://www.iedb.org/epitope/508592" } ], "reference": [ { "type": "PubMed", "id": "24715725", "url": "https://glygen.org/publication/PubMed/24715725" } ] }, { "title": "Mass spectrometric analysis of the phosphorylation levels of the SWI/SNF chromatin remodeling/tumor suppressor proteins ARID1A and Brg1 in ovarian clear cell adenocarcinoma cell lines.", "journal": "Journal of proteome research", "date": "2014", "authors": "Kimura A, Arakawa N, Hirano H", "evidence": [ { "database": "iPTMnet", "id": "O14497", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14497" } ], "reference": [ { "type": "PubMed", "id": "25083560", "url": "https://glygen.org/publication/PubMed/25083560" } ] }, { "title": "Revisiting the arthritogenic peptide theory: quantitative not qualitative changes in the peptide repertoire of HLA-B27 allotypes.", "journal": "Arthritis & rheumatology (Hoboken, N.J.)", "date": "2015-03", "authors": "Schittenhelm Ralf B, Sian Terry C C Lim Kam, Wilmann Pascal G, Dudek Nadine L, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "447188", "url": "https://www.iedb.org/epitope/447188" }, { "database": "IEDB", "id": "447230", "url": "https://www.iedb.org/epitope/447230" }, { "database": "IEDB", "id": "491299", "url": "https://www.iedb.org/epitope/491299" }, { "database": "IEDB", "id": "491992", "url": "https://www.iedb.org/epitope/491992" } ], "reference": [ { "type": "PubMed", "id": "25418920", "url": "https://glygen.org/publication/PubMed/25418920" } ] }, { "title": "Naturally processed non-canonical HLA-A*02:01 presented peptides.", "journal": "The Journal of biological chemistry", "date": "2015-01-30", "authors": "Hassan Chopie, Chabrol Eric, Jahn Lorenz, Kester Michel G D, de Ru Arnoud H, Drijfhout Jan W, Rossjohn Jamie, Falkenburg J H Frederik, Heemskerk Mirjam H M, Gras Stephanie, van Veelen Peter A", "evidence": [ { "database": "IEDB", "id": "240475", "url": "https://www.iedb.org/epitope/240475" }, { "database": "IEDB", "id": "240476", "url": "https://www.iedb.org/epitope/240476" }, { "database": "IEDB", "id": "240477", "url": "https://www.iedb.org/epitope/240477" } ], "reference": [ { "type": "PubMed", "id": "25505266", "url": "https://glygen.org/publication/PubMed/25505266" } ] }, { "title": "Mass spectrometry of human leukocyte antigen class I peptidomes reveals strong effects of protein abundance and turnover on antigen presentation.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015-03", "authors": "Bassani-Sternberg Michal, Pletscher-Frankild Sune, Jensen Lars Juhl, Mann Matthias", "evidence": [ { "database": "IEDB", "id": "213285", "url": "https://www.iedb.org/epitope/213285" }, { "database": "IEDB", "id": "240476", "url": "https://www.iedb.org/epitope/240476" }, { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "476936", "url": "https://www.iedb.org/epitope/476936" }, { "database": "IEDB", "id": "483492", "url": "https://www.iedb.org/epitope/483492" }, { "database": "IEDB", "id": "483557", "url": "https://www.iedb.org/epitope/483557" } ], "reference": [ { "type": "PubMed", "id": "25576301", "url": "https://glygen.org/publication/PubMed/25576301" } ] }, { "title": "Exploration of peptides bound to MHC class I molecules in melanoma.", "journal": "Pigment cell & melanoma research", "date": "2015-05", "authors": "Pritchard Antonia L, Hastie Marcus L, Neller Michelle, Gorman Jeffrey J, Schmidt Chris W, Hayward Nicholas K", "evidence": [ { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "541856", "url": "https://www.iedb.org/epitope/541856" }, { "database": "IEDB", "id": "542303", "url": "https://www.iedb.org/epitope/542303" }, { "database": "IEDB", "id": "543840", "url": "https://www.iedb.org/epitope/543840" }, { "database": "IEDB", "id": "544483", "url": "https://www.iedb.org/epitope/544483" }, { "database": "IEDB", "id": "545212", "url": "https://www.iedb.org/epitope/545212" }, { "database": "IEDB", "id": "545417", "url": "https://www.iedb.org/epitope/545417" }, { "database": "IEDB", "id": "546598", "url": "https://www.iedb.org/epitope/546598" } ], "reference": [ { "type": "PubMed", "id": "25645385", "url": "https://glygen.org/publication/PubMed/25645385" } ] }, { "title": "Early Kinetics of the HLA Class I-Associated Peptidome of MVA.HIVconsv-Infected Cells.", "journal": "Journal of virology", "date": "2015-06", "authors": "Ternette Nicola, Block Peter D, S\u00e1nchez-Bernab\u00e9u \u00c1lvaro, Borthwick Nicola, Pappalardo Elisa, Abdul-Jawad Sultan, Ondondo Beatrice, Charles Philip D, Dorrell Lucy, Kessler Benedikt M, Hanke Tom\u00e1\u0161", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" } ], "reference": [ { "type": "PubMed", "id": "25810538", "url": "https://glygen.org/publication/PubMed/25810538" } ] }, { "title": "A comprehensive analysis of peptides presented by HLA-A1.", "journal": "Tissue antigens", "date": "2015-06", "authors": "Giam K, Ayala-Perez R, Illing P T, Schittenhelm R B, Croft N P, Purcell A W, Dudek N L", "evidence": [ { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" } ], "reference": [ { "type": "PubMed", "id": "25880248", "url": "https://glygen.org/publication/PubMed/25880248" } ] }, { "title": "An open-source computational and data resource to analyze digital maps of immunopeptidomes.", "journal": "eLife", "date": "2015-07-08", "authors": "Caron Etienne, Espona Lucia, Kowalewski Daniel J, Schuster Heiko, Ternette Nicola, Alp\u00edzar Ad\u00e1n, Schittenhelm Ralf B, Ramarathinam Sri H, Lindestam Arlehamn Cecilia S, Chiek Koh Ching, Gillet Ludovic C, Rabsteyn Armin, Navarro Pedro, Kim Sangtae, Lam Henry, Sturm Theo, Marcilla Miguel, Sette Alessandro, Campbell David S, Deutsch Eric W, Moritz Robert L, Purcell Anthony W, Rammensee Hans-Georg, Stevanovic Stefan, Aebersold Ruedi", "evidence": [ { "database": "IEDB", "id": "224520", "url": "https://www.iedb.org/epitope/224520" }, { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "441790", "url": "https://www.iedb.org/epitope/441790" }, { "database": "IEDB", "id": "442275", "url": "https://www.iedb.org/epitope/442275" }, { "database": "IEDB", "id": "444635", "url": "https://www.iedb.org/epitope/444635" }, { "database": "IEDB", "id": "447188", "url": "https://www.iedb.org/epitope/447188" }, { "database": "IEDB", "id": "447230", "url": "https://www.iedb.org/epitope/447230" }, { "database": "IEDB", "id": "448605", "url": "https://www.iedb.org/epitope/448605" }, { "database": "IEDB", "id": "449301", "url": "https://www.iedb.org/epitope/449301" } ], "reference": [ { "type": "PubMed", "id": "26154972", "url": "https://glygen.org/publication/PubMed/26154972" } ] }, { "title": "Comprehensive Analysis of the Naturally Processed Peptide Repertoire: Differences between HLA-A and B in the Immunopeptidome.", "journal": "PloS one", "date": "2015", "authors": "Schellens Ingrid M M, Hoof Ilka, Meiring Hugo D, Spijkers Sanne N M, Poelen Martien C M, van Gaans-van den Brink Jacqueline A M, van der Poel Kees, Costa Ana I, van Els Cecile A C M, van Baarle Debbie, Kesmir Can", "evidence": [ { "database": "IEDB", "id": "240476", "url": "https://www.iedb.org/epitope/240476" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "436239", "url": "https://www.iedb.org/epitope/436239" }, { "database": "IEDB", "id": "440733", "url": "https://www.iedb.org/epitope/440733" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "441790", "url": "https://www.iedb.org/epitope/441790" }, { "database": "IEDB", "id": "441915", "url": "https://www.iedb.org/epitope/441915" } ], "reference": [ { "type": "PubMed", "id": "26375851", "url": "https://glygen.org/publication/PubMed/26375851" } ] }, { "title": "Mammalian SWI/SNF chromatin remodeling complexes and cancer: Mechanistic insights gained from human genomics.", "journal": "Science advances", "date": "2015-06", "authors": "Kadoch Cigall, Crabtree Gerald R", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "database": "Reactome", "id": "R-HSA-9934037", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9934037" } ], "reference": [ { "type": "PubMed", "id": "26601204", "url": "https://glygen.org/publication/PubMed/26601204" } ] }, { "title": "Identification and functional characterization of a novel bipartite nuclear localization sequence in ARID1A.", "journal": "Biochemical and biophysical research communications", "date": "2016", "authors": "Bateman NW, Shoji Y, Conrads KA, Stroop KD, Hamilton CA, Darcy KM, Maxwell GL, Risinger JI, Conrads TP", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "26614907", "url": "https://glygen.org/publication/PubMed/26614907" } ] }, { "title": "The Kringle-like Domain Facilitates Post-endoplasmic Reticulum Changes to Premelanosome Protein (PMEL) Oligomerization and Disulfide Bond Configuration and Promotes Amyloid Formation.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Ho T, Watt B, Spruce LA, Seeholzer SH, Marks MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "26694611", "url": "https://glygen.org/publication/PubMed/26694611" } ] }, { "title": "Global proteogenomic analysis of human MHC class I-associated peptides derived from non-canonical reading frames.", "journal": "Nature communications", "date": "2016-01-05", "authors": "Laumont C\u00e9line M, Daouda Tariq, Laverdure Jean-Philippe, Bonneil \u00c9ric, Caron-Lizotte Olivier, Hardy Marie-Pierre, Granados Diana P, Durette Chantal, Lemieux S\u00e9bastien, Thibault Pierre, Perreault Claude", "evidence": [ { "database": "IEDB", "id": "213285", "url": "https://www.iedb.org/epitope/213285" } ], "reference": [ { "type": "PubMed", "id": "26728094", "url": "https://glygen.org/publication/PubMed/26728094" } ] }, { "title": "Viral infection causes a shift in the self peptide repertoire presented by human MHC class I molecules.", "journal": "Proteomics. Clinical applications", "date": "2015-12", "authors": "Spencer Charles T, Bezbradica Jelena S, Ramos Mireya G, Arico Chenoa D, Conant Stephanie B, Gilchuk Pavlo, Gray Jennifer J, Zheng Mu, Niu Xinnan, Hildebrand William, Link Andrew J, Joyce Sebastian", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" } ], "reference": [ { "type": "PubMed", "id": "26768311", "url": "https://glygen.org/publication/PubMed/26768311" } ] }, { "title": "Comparative Analysis of the Endogenous Peptidomes Displayed by HLA-B*27 and Mamu-B*08: Two MHC Class I Alleles Associated with Elite Control of HIV/SIV Infection.", "journal": "Journal of proteome research", "date": "2016-03-04", "authors": "Marcilla Miguel, Alvarez I\u00f1aki, Ramos-Fern\u00e1ndez Antonio, Lombard\u00eda Manuel, Paradela Alberto, Albar Juan Pablo", "evidence": [ { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "526827", "url": "https://www.iedb.org/epitope/526827" } ], "reference": [ { "type": "PubMed", "id": "26811146", "url": "https://glygen.org/publication/PubMed/26811146" } ] }, { "title": "High-sensitivity HLA class I peptidome analysis enables a precise definition of peptide motifs and the identification of peptides from cell lines and patients' sera.", "journal": "Proteomics", "date": "2016-05", "authors": "Ritz Danilo, Gloger Andreas, Weide Benjamin, Garbe Claus, Neri Dario, Fugmann Tim", "evidence": [ { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "442275", "url": "https://www.iedb.org/epitope/442275" }, { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "483492", "url": "https://www.iedb.org/epitope/483492" }, { "database": "IEDB", "id": "599554", "url": "https://www.iedb.org/epitope/599554" }, { "database": "IEDB", "id": "613637", "url": "https://www.iedb.org/epitope/613637" }, { "database": "IEDB", "id": "619699", "url": "https://www.iedb.org/epitope/619699" }, { "database": "IEDB", "id": "623514", "url": "https://www.iedb.org/epitope/623514" }, { "database": "IEDB", "id": "626654", "url": "https://www.iedb.org/epitope/626654" }, { "database": "IEDB", "id": "626655", "url": "https://www.iedb.org/epitope/626655" } ], "reference": [ { "type": "PubMed", "id": "26992070", "url": "https://glygen.org/publication/PubMed/26992070" } ] }, { "title": "Arginine (Di)methylated Human Leukocyte Antigen Class I Peptides Are Favorably Presented by HLA-B*07.", "journal": "Journal of proteome research", "date": "2017-01-06", "authors": "Marino Fabio, Mommen Geert P M, Jeko Anita, Meiring Hugo D, van Gaans-van den Brink Jacqueline A M, Scheltema Richard A, van Els C\u00e9cile A C M, Heck Albert J R", "evidence": [ { "database": "IEDB", "id": "240476", "url": "https://www.iedb.org/epitope/240476" }, { "database": "IEDB", "id": "441915", "url": "https://www.iedb.org/epitope/441915" } ], "reference": [ { "type": "PubMed", "id": "27503676", "url": "https://glygen.org/publication/PubMed/27503676" } ] }, { "title": "Mass spectrometric analysis of the HLA class I peptidome of melanoma cell lines as a promising tool for the identification of putative tumor-associated HLA epitopes.", "journal": "Cancer immunology, immunotherapy : CII", "date": "2016-11", "authors": "Gloger Andreas, Ritz Danilo, Fugmann Tim, Neri Dario", "evidence": [ { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" } ], "reference": [ { "type": "PubMed", "id": "27600516", "url": "https://glygen.org/publication/PubMed/27600516" } ] }, { "title": "Global Analysis of O-GlcNAc Glycoproteins in Activated Human T Cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016", "authors": "Lund PJ, Elias JE, Davis MM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "27655845", "url": "https://glygen.org/publication/PubMed/27655845" } ] }, { "title": "A large fraction of HLA class I ligands are proteasome-generated spliced peptides.", "journal": "Science (New York, N.Y.)", "date": "2016-10-21", "authors": "Liepe Juliane, Marino Fabio, Sidney John, Jeko Anita, Bunting Daniel E, Sette Alessandro, Kloetzel Peter M, Stumpf Michael P H, Heck Albert J R, Mishto Michele", "evidence": [ { "database": "IEDB", "id": "213285", "url": "https://www.iedb.org/epitope/213285" }, { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "441915", "url": "https://www.iedb.org/epitope/441915" }, { "database": "IEDB", "id": "583629", "url": "https://www.iedb.org/epitope/583629" } ], "reference": [ { "type": "PubMed", "id": "27846572", "url": "https://glygen.org/publication/PubMed/27846572" } ] }, { "title": "Purification of soluble HLA class I complexes from human serum or plasma deliver high quality immuno peptidomes required for biomarker discovery.", "journal": "Proteomics", "date": "2017-01", "authors": "Ritz Danilo, Gloger Andreas, Neri Dario, Fugmann Tim", "evidence": [ { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "697408", "url": "https://www.iedb.org/epitope/697408" }, { "database": "IEDB", "id": "955688", "url": "https://www.iedb.org/epitope/955688" } ], "reference": [ { "type": "PubMed", "id": "27862975", "url": "https://glygen.org/publication/PubMed/27862975" } ] }, { "title": "A Molecular Basis for the Presentation of Phosphorylated Peptides by HLA-B Antigens.", "journal": "Molecular & cellular proteomics : MCP", "date": "2017-02", "authors": "Alp\u00edzar Ad\u00e1n, Marino Fabio, Ramos-Fern\u00e1ndez Antonio, Lombard\u00eda Manuel, Jeko Anita, Pazos Florencio, Paradela Alberto, Santiago C\u00e9sar, Heck Albert J R, Marcilla Miguel", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "224520", "url": "https://www.iedb.org/epitope/224520" }, { "database": "IEDB", "id": "240475", "url": "https://www.iedb.org/epitope/240475" }, { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "441790", "url": "https://www.iedb.org/epitope/441790" }, { "database": "IEDB", "id": "456478", "url": "https://www.iedb.org/epitope/456478" }, { "database": "IEDB", "id": "609871", "url": "https://www.iedb.org/epitope/609871" } ], "reference": [ { "type": "PubMed", "id": "27920218", "url": "https://glygen.org/publication/PubMed/27920218" } ] }, { "title": "Separate effects of the ankylosing spondylitis associated ERAP1 and ERAP2 aminopeptidases determine the influence of their combined phenotype on the HLA-B*27 peptidome.", "journal": "Journal of autoimmunity", "date": "2017-05", "authors": "Mart\u00edn-Esteban Adrian, Sanz-Bravo Alejandro, Guasp Pablo, Barnea Eilon, Admon Arie, L\u00f3pez de Castro Jos\u00e9 A", "evidence": [ { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" } ], "reference": [ { "type": "PubMed", "id": "28063628", "url": "https://glygen.org/publication/PubMed/28063628" } ] }, { "title": "MHC-I peptides get out of the groove and enable a novel mechanism of HIV-1 escape.", "journal": "Nature structural & molecular biology", "date": "2017-04", "authors": "Pymm Phillip, Illing Patricia T, Ramarathinam Sri H, O'Connor Geraldine M, Hughes Victoria A, Hitchen Corinne, Price David A, Ho Bosco K, McVicar Daniel W, Brooks Andrew G, Purcell Anthony W, Rossjohn Jamie, Vivian Julian P", "evidence": [ { "database": "IEDB", "id": "577391", "url": "https://www.iedb.org/epitope/577391" }, { "database": "IEDB", "id": "595012", "url": "https://www.iedb.org/epitope/595012" }, { "database": "IEDB", "id": "598923", "url": "https://www.iedb.org/epitope/598923" }, { "database": "IEDB", "id": "599513", "url": "https://www.iedb.org/epitope/599513" }, { "database": "IEDB", "id": "599554", "url": "https://www.iedb.org/epitope/599554" } ], "reference": [ { "type": "PubMed", "id": "28218747", "url": "https://glygen.org/publication/PubMed/28218747" } ] }, { "title": "Mass Spectrometry Profiling of HLA-Associated Peptidomes in Mono-allelic Cells Enables More Accurate Epitope Prediction.", "journal": "Immunity", "date": "2017-02-21", "authors": "Abelin Jennifer G, Keskin Derin B, Sarkizova Siranush, Hartigan Christina R, Zhang Wandi, Sidney John, Stevens Jonathan, Lane William, Zhang Guang Lan, Eisenhaure Thomas M, Clauser Karl R, Hacohen Nir, Rooney Michael S, Carr Steven A, Wu Catherine J", "evidence": [ { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "637907", "url": "https://www.iedb.org/epitope/637907" } ], "reference": [ { "type": "PubMed", "id": "28228285", "url": "https://glygen.org/publication/PubMed/28228285" } ] }, { "title": "The Intergenic Recombinant HLA-B *46:01 Has a Distinctive Peptidome that Includes KIR2DL3 Ligands.", "journal": "Cell reports", "date": "2017", "authors": "Hilton HG, McMurtrey CP, Han AS, Djaoud Z, Guethlein LA, Blokhuis JH, Pugh JL, Goyos A, Horowitz A, Buchli R, Jackson KW, Bardet W, Bushnell DA, Robinson PJ, Mendoza JL, Birnbaum ME, Nielsen M, Garcia KC, Hildebrand WH, Parham P", "evidence": [ { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "572840", "url": "https://www.iedb.org/epitope/572840" }, { "database": "IEDB", "id": "640768", "url": "https://www.iedb.org/epitope/640768" }, { "database": "IEDB", "id": "641008", "url": "https://www.iedb.org/epitope/641008" }, { "database": "IEDB", "id": "644019", "url": "https://www.iedb.org/epitope/644019" }, { "database": "IEDB", "id": "650344", "url": "https://www.iedb.org/epitope/650344" }, { "database": "IEDB", "id": "651211", "url": "https://www.iedb.org/epitope/651211" }, { "database": "IEDB", "id": "652672", "url": "https://www.iedb.org/epitope/652672" }, { "database": "IEDB", "id": "652694", "url": "https://www.iedb.org/epitope/652694" } ], "reference": [ { "type": "PubMed", "id": "28514659", "url": "https://glygen.org/publication/PubMed/28514659" } ] }, { "title": "Histone-binding of DPF2 mediates its repressive role in myeloid differentiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017", "authors": "Huber FM, Greenblatt SM, Davenport AM, Martinez C, Xu Y, Vu LP, Nimer SD, Hoelz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9933937", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933937" } ], "reference": [ { "type": "PubMed", "id": "28533407", "url": "https://glygen.org/publication/PubMed/28533407" } ] }, { "title": "Structural and regulatory diversity shape HLA-C protein expression levels.", "journal": "Nature communications", "date": "2017", "authors": "Kaur G, Gras S, Mobbs JI, Vivian JP, Cortes A, Barber T, Kuttikkatte SB, Jensen LT, Attfield KE, Dendrou CA, Carrington M, McVean G, Purcell AW, Rossjohn J, Fugger L", "evidence": [ { "database": "IEDB", "id": "692890", "url": "https://www.iedb.org/epitope/692890" } ], "reference": [ { "type": "PubMed", "id": "28649982", "url": "https://glygen.org/publication/PubMed/28649982" } ] }, { "title": "Deciphering HLA-I motifs across HLA peptidomes improves neo-antigen predictions and identifies allostery regulating HLA specificity.", "journal": "PLoS computational biology", "date": "2017-08", "authors": "Bassani-Sternberg Michal, Chong Chlo\u00e9, Guillaume Philippe, Solleder Marthe, Pak HuiSong, Gannon Philippe O, Kandalaft Lana E, Coukos George, Gfeller David", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "441915", "url": "https://www.iedb.org/epitope/441915" }, { "database": "IEDB", "id": "447188", "url": "https://www.iedb.org/epitope/447188" }, { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "470058", "url": "https://www.iedb.org/epitope/470058" }, { "database": "IEDB", "id": "483557", "url": "https://www.iedb.org/epitope/483557" }, { "database": "IEDB", "id": "623514", "url": "https://www.iedb.org/epitope/623514" }, { "database": "IEDB", "id": "626654", "url": "https://www.iedb.org/epitope/626654" }, { "database": "IEDB", "id": "626655", "url": "https://www.iedb.org/epitope/626655" }, { "database": "IEDB", "id": "700079", "url": "https://www.iedb.org/epitope/700079" }, { "database": "IEDB", "id": "720643", "url": "https://www.iedb.org/epitope/720643" }, { "database": "IEDB", "id": "726204", "url": "https://www.iedb.org/epitope/726204" }, { "database": "IEDB", "id": "727324", "url": "https://www.iedb.org/epitope/727324" } ], "reference": [ { "type": "PubMed", "id": "28832583", "url": "https://glygen.org/publication/PubMed/28832583" } ] }, { "title": "Data-Independent Acquisition of HLA Class I Peptidomes on the Q Exactive Mass Spectrometer Platform.", "journal": "Proteomics", "date": "2017-10", "authors": "Ritz Danilo, Kinzi Jonny, Neri Dario, Fugmann Tim", "evidence": [ { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "623514", "url": "https://www.iedb.org/epitope/623514" }, { "database": "IEDB", "id": "626655", "url": "https://www.iedb.org/epitope/626655" } ], "reference": [ { "type": "PubMed", "id": "28834231", "url": "https://glygen.org/publication/PubMed/28834231" } ] }, { "title": "Unveiling the Peptide Motifs of HLA-C and HLA-G from Naturally Presented Peptides and Generation of Binding Prediction Matrices.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2017-10-15", "authors": "Di Marco Moreno, Schuster Heiko, Backert Linus, Ghosh Michael, Rammensee Hans-Georg, Stevanovi\u0107 Stefan", "evidence": [ { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "447188", "url": "https://www.iedb.org/epitope/447188" }, { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "613637", "url": "https://www.iedb.org/epitope/613637" }, { "database": "IEDB", "id": "691226", "url": "https://www.iedb.org/epitope/691226" }, { "database": "IEDB", "id": "697408", "url": "https://www.iedb.org/epitope/697408" }, { "database": "IEDB", "id": "697433", "url": "https://www.iedb.org/epitope/697433" }, { "database": "IEDB", "id": "708629", "url": "https://www.iedb.org/epitope/708629" }, { "database": "IEDB", "id": "711189", "url": "https://www.iedb.org/epitope/711189" }, { "database": "IEDB", "id": "712707", "url": "https://www.iedb.org/epitope/712707" } ], "reference": [ { "type": "PubMed", "id": "28904123", "url": "https://glygen.org/publication/PubMed/28904123" } ] }, { "title": "High-throughput and Sensitive Immunopeptidomics Platform Reveals Profound Interferon\u03b3-Mediated Remodeling of the Human Leukocyte Antigen (HLA) Ligandome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2018-03", "authors": "Chong Chloe, Marino Fabio, Pak HuiSong, Racle Julien, Daniel Roy T, M\u00fcller Markus, Gfeller David, Coukos George, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "441915", "url": "https://www.iedb.org/epitope/441915" }, { "database": "IEDB", "id": "483557", "url": "https://www.iedb.org/epitope/483557" }, { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "572840", "url": "https://www.iedb.org/epitope/572840" }, { "database": "IEDB", "id": "626654", "url": "https://www.iedb.org/epitope/626654" }, { "database": "IEDB", "id": "626655", "url": "https://www.iedb.org/epitope/626655" }, { "database": "IEDB", "id": "650344", "url": "https://www.iedb.org/epitope/650344" }, { "database": "IEDB", "id": "700079", "url": "https://www.iedb.org/epitope/700079" }, { "database": "IEDB", "id": "720643", "url": "https://www.iedb.org/epitope/720643" }, { "database": "IEDB", "id": "726204", "url": "https://www.iedb.org/epitope/726204" }, { "database": "IEDB", "id": "868772", "url": "https://www.iedb.org/epitope/868772" }, { "database": "IEDB", "id": "877406", "url": "https://www.iedb.org/epitope/877406" }, { "database": "IEDB", "id": "881177", "url": "https://www.iedb.org/epitope/881177" }, { "database": "IEDB", "id": "883966", "url": "https://www.iedb.org/epitope/883966" }, { "database": "IEDB", "id": "1922148", "url": "https://www.iedb.org/epitope/1922148" } ], "reference": [ { "type": "PubMed", "id": "29242379", "url": "https://glygen.org/publication/PubMed/29242379" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" }, { "database": "Data Submission", "id": "GLY_000142", "url": "http://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "The Peptide Repertoire of HLA-B27 may include Ligands with Lysine at P2 Anchor Position.", "journal": "Proteomics", "date": "2018-05", "authors": "Yair-Sabag Shira, Tedeschi Valentina, Vitulano Carolina, Barnea Eilon, Glaser Fabian, Melamed Kadosh Dganit, Taurog Joel D, Fiorillo Maria Teresa, Sorrentino Rosa, Admon Arie", "evidence": [ { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "447230", "url": "https://www.iedb.org/epitope/447230" }, { "database": "IEDB", "id": "823871", "url": "https://www.iedb.org/epitope/823871" } ], "reference": [ { "type": "PubMed", "id": "29393594", "url": "https://glygen.org/publication/PubMed/29393594" } ] }, { "title": "Identification of Native and Posttranslationally Modified HLA-B*57:01-Restricted HIV Envelope Derived Epitopes Using Immunoproteomics.", "journal": "Proteomics", "date": "2018-06", "authors": "Ramarathinam Sri H, Gras Stephanie, Alcantara Sheilajen, Yeung Amanda W S, Mifsud Nicole A, Sonza Secondo, Illing Patricia T, Glaros Elias N, Center Robert J, Thomas Shane R, Kent Stephen J, Ternette Nicola, Purcell Damian F J, Rossjohn Jamie, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "577391", "url": "https://www.iedb.org/epitope/577391" }, { "database": "IEDB", "id": "595012", "url": "https://www.iedb.org/epitope/595012" }, { "database": "IEDB", "id": "599513", "url": "https://www.iedb.org/epitope/599513" }, { "database": "IEDB", "id": "599554", "url": "https://www.iedb.org/epitope/599554" }, { "database": "IEDB", "id": "599847", "url": "https://www.iedb.org/epitope/599847" } ], "reference": [ { "type": "PubMed", "id": "29437277", "url": "https://glygen.org/publication/PubMed/29437277" } ] }, { "title": "T-Cell Immunopeptidomes Reveal Cell Subtype Surface Markers Derived From Intracellular Proteins.", "journal": "Proteomics", "date": "2018-06", "authors": "Olsson Niclas, Schultz Liora M, Zhang Lichao, Khodadoust Michael S, Narayan Rupa, Czerwinski Debra K, Levy Ronald, Elias Joshua E", "evidence": [ { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "645878", "url": "https://www.iedb.org/epitope/645878" }, { "database": "IEDB", "id": "931202", "url": "https://www.iedb.org/epitope/931202" } ], "reference": [ { "type": "PubMed", "id": "29493099", "url": "https://glygen.org/publication/PubMed/29493099" } ] }, { "title": "Comparison of the MHC I Immunopeptidome Repertoire of B-Cell Lymphoblasts Using Two Isolation Methods.", "journal": "Proteomics", "date": "2018-06", "authors": "Lanoix Jo\u00ebl, Durette Chantal, Courcelles Mathieu, Cossette \u00c9milie, Comtois-Marotte Simon, Hardy Marie-Pierre, C\u00f4t\u00e9 Caroline, Perreault Claude, Thibault Pierre", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "441915", "url": "https://www.iedb.org/epitope/441915" }, { "database": "IEDB", "id": "448605", "url": "https://www.iedb.org/epitope/448605" }, { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "469718", "url": "https://www.iedb.org/epitope/469718" }, { "database": "IEDB", "id": "697408", "url": "https://www.iedb.org/epitope/697408" }, { "database": "IEDB", "id": "697433", "url": "https://www.iedb.org/epitope/697433" }, { "database": "IEDB", "id": "836958", "url": "https://www.iedb.org/epitope/836958" } ], "reference": [ { "type": "PubMed", "id": "29508533", "url": "https://glygen.org/publication/PubMed/29508533" } ] }, { "title": "The natural HLA ligandome of glioblastoma stem-like cells: antigen discovery for T cell-based immunotherapy.", "journal": "Acta neuropathologica", "date": "2018-06", "authors": "Neidert Marian Christoph, Kowalewski Daniel Johannes, Silginer Manuela, Kapolou Konstantina, Backert Linus, Freudenmann Lena Katharina, Peper Janet Kerstin, Marcu Ana, Wang Sophie Shih-Y\u00fcng, Walz Juliane Sarah, Wolpert Fabian, Rammensee Hans-Georg, Henschler Reinhard, Lamszus Katrin, Westphal Manfred, Roth Patrick, Regli Luca, Stevanovi\u0107 Stefan, Weller Michael, Eisele G\u00fcnter", "evidence": [ { "database": "IEDB", "id": "161881", "url": "https://www.iedb.org/epitope/161881" }, { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "572840", "url": "https://www.iedb.org/epitope/572840" }, { "database": "IEDB", "id": "697433", "url": "https://www.iedb.org/epitope/697433" }, { "database": "IEDB", "id": "935936", "url": "https://www.iedb.org/epitope/935936" }, { "database": "IEDB", "id": "1113188", "url": "https://www.iedb.org/epitope/1113188" } ], "reference": [ { "type": "PubMed", "id": "29557506", "url": "https://glygen.org/publication/PubMed/29557506" } ] }, { "title": "Ranking the Contribution of Ankylosing Spondylitis-associated Endoplasmic Reticulum Aminopeptidase 1 (ERAP1) Polymorphisms to Shaping the HLA-B*27 Peptidome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2018-07", "authors": "Sanz-Bravo Alejandro, Alvarez-Navarro Carlos, Mart\u00edn-Esteban Adrian, Barnea Eilon, Admon Arie, L\u00f3pez de Castro Jos\u00e9 A", "evidence": [ { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" } ], "reference": [ { "type": "PubMed", "id": "29632046", "url": "https://glygen.org/publication/PubMed/29632046" } ] }, { "title": "HLA ligandome analysis of primary chronic lymphocytic leukemia (CLL) cells under lenalidomide treatment confirms the suitability of lenalidomide for combination with T-cell-based immunotherapy.", "journal": "Oncoimmunology", "date": "2018", "authors": "Nelde Annika, Kowalewski Daniel J, Backert Linus, Schuster Heiko, Werner Jan-Ole, Klein Reinhild, Kohlbacher Oliver, Kanz Lothar, Salih Helmut R, Rammensee Hans-Georg, Stevanovi\u0107 Stefan, Walz Juliane S", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "436239", "url": "https://www.iedb.org/epitope/436239" }, { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" } ], "reference": [ { "type": "PubMed", "id": "29632711", "url": "https://glygen.org/publication/PubMed/29632711" } ] }, { "title": "Allele-specific Alterations in the Peptidome Underlie the Joint Association of HLA-A*29:02 and Endoplasmic Reticulum Aminopeptidase 2 (ERAP2) with Birdshot Chorioretinopathy.", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Sanz-Bravo A, Martin-Esteban A, Kuiper JJW, Garcia-Peydro M, Barnea E, Admon A, Lopez de Castro JA", "evidence": [ { "database": "IEDB", "id": "839182", "url": "https://www.iedb.org/epitope/839182" } ], "reference": [ { "type": "PubMed", "id": "29769354", "url": "https://glygen.org/publication/PubMed/29769354" } ] }, { "title": "Immunopeptidomic Profiling of HLA-A2-Positive Triple Negative Breast Cancer Identifies Potential Immunotherapy Target Antigens.", "journal": "Proteomics", "date": "2018-06", "authors": "Ternette Nicola, Olde Nordkamp Marloes J M, M\u00fcller Julius, Anderson Amanda P, Nicastri Annalisa, Hill Adrian V S, Kessler Benedikt M, Li Demin", "evidence": [ { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "774973", "url": "https://www.iedb.org/epitope/774973" } ], "reference": [ { "type": "PubMed", "id": "29786170", "url": "https://glygen.org/publication/PubMed/29786170" } ] }, { "title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.", "journal": "ACS chemical biology", "date": "2018", "authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "reference": [ { "type": "PubMed", "id": "30059200", "url": "https://glygen.org/publication/PubMed/30059200" } ] }, { "title": "Chemical Derivatization Strategy for Extending the Identification of MHC Class I Immunopeptides.", "journal": "Analytical chemistry", "date": "2018-10-02", "authors": "Chen Rui, Fauteux Francois, Foote Simon, Stupak Jacek, Tremblay Tammy-Lynn, Gurnani Komal, Fulton Kelly M, Weeratna Risini D, Twine Susan M, Li Jianjun", "evidence": [ { "database": "IEDB", "id": "865132", "url": "https://www.iedb.org/epitope/865132" } ], "reference": [ { "type": "PubMed", "id": "30192525", "url": "https://glygen.org/publication/PubMed/30192525" } ] }, { "title": "ARHGAP9 suppresses the migration and invasion of hepatocellular carcinoma cells through up-regulating FOXJ2/E-cadherin.", "journal": "Cell death & disease", "date": "2018", "authors": "Zhang H, Tang QF, Sun MY, Zhang CY, Zhu JY, Shen YL, Zhao B, Shao ZY, Zhang LJ, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764790", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764790" } ], "reference": [ { "type": "PubMed", "id": "30206221", "url": "https://glygen.org/publication/PubMed/30206221" } ] }, { "title": "A subset of HLA-I peptides are not genomically templated: Evidence for cis- and trans-spliced peptide ligands.", "journal": "Science immunology", "date": "2018-10-12", "authors": "Faridi Pouya, Li Chen, Ramarathinam Sri H, Vivian Julian P, Illing Patricia T, Mifsud Nicole A, Ayala Rochelle, Song Jiangning, Gearing Linden J, Hertzog Paul J, Ternette Nicola, Rossjohn Jamie, Croft Nathan P, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "441915", "url": "https://www.iedb.org/epitope/441915" }, { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "577391", "url": "https://www.iedb.org/epitope/577391" }, { "database": "IEDB", "id": "595012", "url": "https://www.iedb.org/epitope/595012" }, { "database": "IEDB", "id": "904535", "url": "https://www.iedb.org/epitope/904535" }, { "database": "IEDB", "id": "906373", "url": "https://www.iedb.org/epitope/906373" } ], "reference": [ { "type": "PubMed", "id": "30315122", "url": "https://glygen.org/publication/PubMed/30315122" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "The Length Distribution and Multiple Specificity of Naturally Presented HLA-I Ligands.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2018-12-15", "authors": "Gfeller David, Guillaume Philippe, Michaux Justine, Pak Hui-Song, Daniel Roy T, Racle Julien, Coukos George, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "240476", "url": "https://www.iedb.org/epitope/240476" }, { "database": "IEDB", "id": "240477", "url": "https://www.iedb.org/epitope/240477" }, { "database": "IEDB", "id": "876762", "url": "https://www.iedb.org/epitope/876762" }, { "database": "IEDB", "id": "877406", "url": "https://www.iedb.org/epitope/877406" }, { "database": "IEDB", "id": "883966", "url": "https://www.iedb.org/epitope/883966" } ], "reference": [ { "type": "PubMed", "id": "30429286", "url": "https://glygen.org/publication/PubMed/30429286" } ] }, { "title": "BAF60A mediates interactions between the microphthalmia-associated transcription factor and the BRG1-containing SWI/SNF complex during melanocyte differentiation.", "journal": "Journal of cellular physiology", "date": "2019", "authors": "Aras S, Saladi SV, Basuroy T, Marathe HG, Lores P, de la Serna IL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "30515787", "url": "https://glygen.org/publication/PubMed/30515787" } ] }, { "title": "Specific MHC-I Peptides Are Induced Using PROTACs.", "journal": "Frontiers in immunology", "date": "2018", "authors": "Jensen Stephanie M, Potts Gregory K, Ready Damien B, Patterson Melanie J", "evidence": [ { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "626654", "url": "https://www.iedb.org/epitope/626654" }, { "database": "IEDB", "id": "868772", "url": "https://www.iedb.org/epitope/868772" } ], "reference": [ { "type": "PubMed", "id": "30524438", "url": "https://glygen.org/publication/PubMed/30524438" } ] }, { "title": "Expression of KLF9 in pancreatic cancer and its effects on the invasion, migration, apoptosis, cell cycle distribution, and proliferation of pancreatic cancer cell lines.", "journal": "Oncology reports", "date": "2018", "authors": "Zhong Z, Zhou F, Wang D, Wu M, Zhou W, Zou Y, Li J, Wu L, Yin X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764790", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764790" } ], "reference": [ { "type": "PubMed", "id": "30542730", "url": "https://glygen.org/publication/PubMed/30542730" } ] }, { "title": "Pro-inflammatory Cytokines Alter the Immunopeptidome Landscape by Modulation of HLA-B Expression.", "journal": "Frontiers in immunology", "date": "2019", "authors": "Javitt Aaron, Barnea Eilon, Kramer Matthias P, Wolf-Levy Hila, Levin Yishai, Admon Arie, Merbl Yifat", "evidence": [ { "database": "IEDB", "id": "935936", "url": "https://www.iedb.org/epitope/935936" } ], "reference": [ { "type": "PubMed", "id": "30833945", "url": "https://glygen.org/publication/PubMed/30833945" } ] }, { "title": "Naturally processed HLA-DR3-restricted HHV-6B peptides are recognized broadly with polyfunctional and cytotoxic CD4 T-cell responses.", "journal": "European journal of immunology", "date": "2019-08", "authors": "Becerra-Artiles Aniuska, Cruz John, Leszyk John D, Sidney John, Sette Alessandro, Shaffer Scott A, Stern Lawrence J", "evidence": [ { "database": "IEDB", "id": "920150", "url": "https://www.iedb.org/epitope/920150" } ], "reference": [ { "type": "PubMed", "id": "31020640", "url": "https://glygen.org/publication/PubMed/31020640" } ] }, { "title": "Redundancy and Complementarity between ERAP1 and ERAP2 Revealed by their Effects on the Behcet's Disease-associated HLA-B*51 Peptidome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2019-08", "authors": "Guasp Pablo, Lorente Elena, Mart\u00edn-Esteban Adrian, Barnea Eilon, Romania Paolo, Fruci Doriana, Kuiper JonasJ W, Admon Arie, L\u00f3pez de Castro Jos\u00e9 A", "evidence": [ { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "546598", "url": "https://www.iedb.org/epitope/546598" } ], "reference": [ { "type": "PubMed", "id": "31092671", "url": "https://glygen.org/publication/PubMed/31092671" } ] }, { "title": "Identification of Tumor Antigens Among the HLA Peptidomes of Glioblastoma Tumors and Plasma.", "journal": "Molecular & cellular proteomics : MCP", "date": "2019-06", "authors": "Shraibman Bracha, Barnea Eilon, Kadosh Dganit Melamed, Haimovich Yael, Slobodin Gleb, Rosner Itzhak, L\u00f3pez-Larrea Carlos, Hilf Norbert, Kuttruff Sabrina, Song Colette, Britten Cedrik, Castle John, Kreiter Sebastian, Frenzel Katrin, Tatagiba Marcos, Tabatabai Ghazaleh, Dietrich Pierre-Yves, Dutoit Val\u00e9rie, Wick Wolfgang, Platten Michael, Winkler Frank, von Deimling Andreas, Kroep Judith, Sahuquillo Juan, Martinez-Ricarte Francisco, Rodon Jordi, Lassen Ulrik, Ottensmeier Christian, van der Burg Sjoerd H, Thor Straten Per, Poulsen Hans Skovgaard, Ponsati Berta, Okada Hideho, Rammensee Hans-Georg, Sahin Ugur, Singh Harpreet, Admon Arie", "evidence": [ { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "483492", "url": "https://www.iedb.org/epitope/483492" }, { "database": "IEDB", "id": "483557", "url": "https://www.iedb.org/epitope/483557" }, { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "613637", "url": "https://www.iedb.org/epitope/613637" }, { "database": "IEDB", "id": "935936", "url": "https://www.iedb.org/epitope/935936" } ], "reference": [ { "type": "PubMed", "id": "31154438", "url": "https://glygen.org/publication/PubMed/31154438" } ] }, { "title": "Identification of Immunodominant HIV-1 Epitopes Presented by HLA-C*12:02, a Protective Allele, Using an Immunopeptidomics Approach.", "journal": "Journal of virology", "date": "2019-09-01", "authors": "Chikata Takayuki, Paes Wayne, Akahoshi Tomohiro, Partridge Thomas, Murakoshi Hayato, Gatanaga Hiroyuki, Ternette Nicola, Oka Shinichi, Borrow Persephone, Takiguchi Masafumi", "evidence": [ { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "932021", "url": "https://www.iedb.org/epitope/932021" } ], "reference": [ { "type": "PubMed", "id": "31217245", "url": "https://glygen.org/publication/PubMed/31217245" } ] }, { "title": "Editing the immunopeptidome of melanoma cells using a potent inhibitor of endoplasmic reticulum aminopeptidase 1 (ERAP1).", "journal": "Cancer immunology, immunotherapy : CII", "date": "2019-08", "authors": "Koumantou Despoina, Barnea Eilon, Martin-Esteban Adrian, Maben Zachary, Papakyriakou Athanasios, Mpakali Anastasia, Kokkala Paraskevi, Pratsinis Harris, Georgiadis Dimitris, Stern Lawrence J, Admon Arie, Stratikos Efstratios", "evidence": [ { "database": "IEDB", "id": "923612", "url": "https://www.iedb.org/epitope/923612" } ], "reference": [ { "type": "PubMed", "id": "31222486", "url": "https://glygen.org/publication/PubMed/31222486" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "Substantial Influence of ERAP2 on the HLA-B*40:02 Peptidome: Implications for HLA-B*27-Negative Ankylosing Spondylitis.", "journal": "Molecular & cellular proteomics : MCP", "date": "2019-11", "authors": "Lorente Elena, Redondo-Ant\u00f3n Jennifer, Mart\u00edn-Esteban Adrian, Guasp Pablo, Barnea Eilon, Lauzurica Pilar, Admon Arie, L\u00f3pez de Castro Jos\u00e9 A", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" } ], "reference": [ { "type": "PubMed", "id": "31530632", "url": "https://glygen.org/publication/PubMed/31530632" } ] }, { "title": "A large peptidome dataset improves HLA class I epitope prediction across most of the human population.", "journal": "Nature biotechnology", "date": "2020-02", "authors": "Sarkizova Siranush, Klaeger Susan, Le Phuong M, Li Letitia W, Oliveira Giacomo, Keshishian Hasmik, Hartigan Christina R, Zhang Wandi, Braun David A, Ligon Keith L, Bachireddy Pavan, Zervantonakis Ioannis K, Rosenbluth Jennifer M, Ouspenskaia Tamara, Law Travis, Justesen Sune, Stevens Jonathan, Lane William J, Eisenhaure Thomas, Lan Zhang Guang, Clauser Karl R, Hacohen Nir, Carr Steven A, Wu Catherine J, Keskin Derin B", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "213285", "url": "https://www.iedb.org/epitope/213285" }, { "database": "IEDB", "id": "224520", "url": "https://www.iedb.org/epitope/224520" }, { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "442275", "url": "https://www.iedb.org/epitope/442275" }, { "database": "IEDB", "id": "447188", "url": "https://www.iedb.org/epitope/447188" }, { "database": "IEDB", "id": "456478", "url": "https://www.iedb.org/epitope/456478" }, { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "483492", "url": "https://www.iedb.org/epitope/483492" }, { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" }, { "database": "IEDB", "id": "545212", "url": "https://www.iedb.org/epitope/545212" }, { "database": "IEDB", "id": "572840", "url": "https://www.iedb.org/epitope/572840" }, { "database": "IEDB", "id": "623514", "url": "https://www.iedb.org/epitope/623514" }, { "database": "IEDB", "id": "626654", "url": "https://www.iedb.org/epitope/626654" }, { "database": "IEDB", "id": "626655", "url": "https://www.iedb.org/epitope/626655" }, { "database": "IEDB", "id": "629085", "url": "https://www.iedb.org/epitope/629085" }, { "database": "IEDB", "id": "633468", "url": "https://www.iedb.org/epitope/633468" }, { "database": "IEDB", "id": "637907", "url": "https://www.iedb.org/epitope/637907" }, { "database": "IEDB", "id": "651211", "url": "https://www.iedb.org/epitope/651211" }, { "database": "IEDB", "id": "839182", "url": "https://www.iedb.org/epitope/839182" }, { "database": "IEDB", "id": "881177", "url": "https://www.iedb.org/epitope/881177" }, { "database": "IEDB", "id": "931202", "url": "https://www.iedb.org/epitope/931202" }, { "database": "IEDB", "id": "935936", "url": "https://www.iedb.org/epitope/935936" }, { "database": "IEDB", "id": "955688", "url": "https://www.iedb.org/epitope/955688" }, { "database": "IEDB", "id": "997097", "url": "https://www.iedb.org/epitope/997097" }, { "database": "IEDB", "id": "997590", "url": "https://www.iedb.org/epitope/997590" }, { "database": "IEDB", "id": "1000044", "url": "https://www.iedb.org/epitope/1000044" }, { "database": "IEDB", "id": "1017450", "url": "https://www.iedb.org/epitope/1017450" }, { "database": "IEDB", "id": "1028352", "url": "https://www.iedb.org/epitope/1028352" }, { "database": "IEDB", "id": "1028425", "url": "https://www.iedb.org/epitope/1028425" }, { "database": "IEDB", "id": "1030852", "url": "https://www.iedb.org/epitope/1030852" }, { "database": "IEDB", "id": "1030897", "url": "https://www.iedb.org/epitope/1030897" }, { "database": "IEDB", "id": "1032688", "url": "https://www.iedb.org/epitope/1032688" }, { "database": "IEDB", "id": "1037914", "url": "https://www.iedb.org/epitope/1037914" }, { "database": "IEDB", "id": "1051296", "url": "https://www.iedb.org/epitope/1051296" }, { "database": "IEDB", "id": "1052424", "url": "https://www.iedb.org/epitope/1052424" }, { "database": "IEDB", "id": "1054561", "url": "https://www.iedb.org/epitope/1054561" }, { "database": "IEDB", "id": "1055061", "url": "https://www.iedb.org/epitope/1055061" } ], "reference": [ { "type": "PubMed", "id": "31844290", "url": "https://glygen.org/publication/PubMed/31844290" } ] }, { "title": "Mass Spectrometry Based Immunopeptidomics Leads to Robust Predictions of Phosphorylated HLA Class I Ligands.", "journal": "Molecular & cellular proteomics : MCP", "date": "2020-02", "authors": "Solleder Marthe, Guillaume Philippe, Racle Julien, Michaux Justine, Pak Hui-Song, M\u00fcller Markus, Coukos George, Bassani-Sternberg Michal, Gfeller David", "evidence": [ { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "444635", "url": "https://www.iedb.org/epitope/444635" }, { "database": "IEDB", "id": "483492", "url": "https://www.iedb.org/epitope/483492" }, { "database": "IEDB", "id": "583629", "url": "https://www.iedb.org/epitope/583629" }, { "database": "IEDB", "id": "992297", "url": "https://www.iedb.org/epitope/992297" } ], "reference": [ { "type": "PubMed", "id": "31848261", "url": "https://glygen.org/publication/PubMed/31848261" } ] }, { "title": "Silencing of FOXA2 decreases E-cadherin expression and is associated with lymph node metastasis in oral cancer.", "journal": "Oral diseases", "date": "2020", "authors": "Bow YD, Wang YY, Chen YK, Su CW, Hsu CW, Xiao LY, Yuan SS, Li RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764790", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764790" } ], "reference": [ { "type": "PubMed", "id": "31957176", "url": "https://glygen.org/publication/PubMed/31957176" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Integrated proteogenomic deep sequencing and analytics accurately identify non-canonical peptides in tumor immunopeptidomes.", "journal": "Nature communications", "date": "2020-03-10", "authors": "Chong Chloe, M\u00fcller Markus, Pak HuiSong, Harnett Dermot, Huber Florian, Grun Delphine, Leleu Marion, Auger Aymeric, Arnaud Marion, Stevenson Brian J, Michaux Justine, Bilic Ilija, Hirsekorn Antje, Calviello Lorenzo, Sim\u00f3-Riudalbas Laia, Planet Evarist, Lubi\u0144ski Jan, Bry\u015bkiewicz Marta, Wiznerowicz Maciej, Xenarios Ioannis, Zhang Lin, Trono Didier, Harari Alexandre, Ohler Uwe, Coukos George, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "483557", "url": "https://www.iedb.org/epitope/483557" }, { "database": "IEDB", "id": "508371", "url": "https://www.iedb.org/epitope/508371" }, { "database": "IEDB", "id": "583629", "url": "https://www.iedb.org/epitope/583629" }, { "database": "IEDB", "id": "645878", "url": "https://www.iedb.org/epitope/645878" }, { "database": "IEDB", "id": "727324", "url": "https://www.iedb.org/epitope/727324" }, { "database": "IEDB", "id": "868772", "url": "https://www.iedb.org/epitope/868772" }, { "database": "IEDB", "id": "876762", "url": "https://www.iedb.org/epitope/876762" }, { "database": "IEDB", "id": "881177", "url": "https://www.iedb.org/epitope/881177" }, { "database": "IEDB", "id": "883966", "url": "https://www.iedb.org/epitope/883966" }, { "database": "IEDB", "id": "931202", "url": "https://www.iedb.org/epitope/931202" }, { "database": "IEDB", "id": "1325886", "url": "https://www.iedb.org/epitope/1325886" }, { "database": "IEDB", "id": "2061182", "url": "https://www.iedb.org/epitope/2061182" }, { "database": "IEDB", "id": "2061527", "url": "https://www.iedb.org/epitope/2061527" }, { "database": "IEDB", "id": "2071581", "url": "https://www.iedb.org/epitope/2071581" } ], "reference": [ { "type": "PubMed", "id": "32157095", "url": "https://glygen.org/publication/PubMed/32157095" } ] }, { "title": "Identification of an Unconventional Subpeptidome Bound to the Beh\u00e7et's Disease-associated HLA-B*51:01 that is Regulated by Endoplasmic Reticulum Aminopeptidase 1 (ERAP1).", "journal": "Molecular & cellular proteomics : MCP", "date": "2020-05", "authors": "Chen Liye, Shi Hui, Koftori Danai, Sekine Takuya, Nicastri Annalisa, Ternette Nicola, Bowness Paul", "evidence": [ { "database": "IEDB", "id": "546598", "url": "https://www.iedb.org/epitope/546598" } ], "reference": [ { "type": "PubMed", "id": "32161166", "url": "https://glygen.org/publication/PubMed/32161166" } ] }, { "title": "Immunopeptidome Analysis of HLA-DPB1 Allelic Variants Reveals New Functional Hierarchies.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2020-06-15", "authors": "van Balen Peter, Kester Michel G D, de Klerk Wendy, Crivello Pietro, Arrieta-Bola\u00f1os Esteban, de Ru Arnoud H, Jedema Inge, Mohammed Yassene, Heemskerk Mirjam H M, Fleischhauer Katharina, van Veelen Peter A, Falkenburg J H Frederik", "evidence": [ { "database": "IEDB", "id": "1160352", "url": "https://www.iedb.org/epitope/1160352" }, { "database": "IEDB", "id": "1171723", "url": "https://www.iedb.org/epitope/1171723" }, { "database": "IEDB", "id": "1176351", "url": "https://www.iedb.org/epitope/1176351" } ], "reference": [ { "type": "PubMed", "id": "32350084", "url": "https://glygen.org/publication/PubMed/32350084" } ] }, { "title": "Immunopeptidomic Analysis Reveals That Deamidated HLA-bound Peptides Arise Predominantly from Deglycosylated Precursors.", "journal": "Molecular & cellular proteomics : MCP", "date": "2020-07", "authors": "Mei Shutao, Ayala Rochelle, Ramarathinam Sri H, Illing Patricia T, Faridi Pouya, Song Jiangning, Purcell Anthony W, Croft Nathan P", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "442275", "url": "https://www.iedb.org/epitope/442275" }, { "database": "IEDB", "id": "483557", "url": "https://www.iedb.org/epitope/483557" }, { "database": "IEDB", "id": "545212", "url": "https://www.iedb.org/epitope/545212" }, { "database": "IEDB", "id": "629085", "url": "https://www.iedb.org/epitope/629085" }, { "database": "IEDB", "id": "1319447", "url": "https://www.iedb.org/epitope/1319447" }, { "database": "IEDB", "id": "1325886", "url": "https://www.iedb.org/epitope/1325886" } ], "reference": [ { "type": "PubMed", "id": "32357974", "url": "https://glygen.org/publication/PubMed/32357974" } ] }, { "title": "In-depth mining of the immunopeptidome of an acute myeloid leukemia cell line using complementary ligand enrichment and data acquisition strategies.", "journal": "Molecular immunology", "date": "2020-07", "authors": "Pandey Kirti, Mifsud Nicole A, Lim Kam Sian Terry C C, Ayala Rochelle, Ternette Nicola, Ramarathinam Sri H, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "419703", "url": "https://www.iedb.org/epitope/419703" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "442275", "url": "https://www.iedb.org/epitope/442275" }, { "database": "IEDB", "id": "545212", "url": "https://www.iedb.org/epitope/545212" }, { "database": "IEDB", "id": "637907", "url": "https://www.iedb.org/epitope/637907" }, { "database": "IEDB", "id": "1366388", "url": "https://www.iedb.org/epitope/1366388" }, { "database": "IEDB", "id": "1368900", "url": "https://www.iedb.org/epitope/1368900" }, { "database": "IEDB", "id": "1370066", "url": "https://www.iedb.org/epitope/1370066" } ], "reference": [ { "type": "PubMed", "id": "32387766", "url": "https://glygen.org/publication/PubMed/32387766" } ] }, { "title": "Extending the Comprehensiveness of Immunopeptidome Analyses Using Isobaric Peptide Labeling.", "journal": "Analytical chemistry", "date": "2020-07-07", "authors": "Pfammatter Sibylle, Bonneil Eric, Lanoix Joel, Vincent Krystel, Hardy Marie-Pierre, Courcelles Mathieu, Perreault Claude, Thibault Pierre", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "931202", "url": "https://www.iedb.org/epitope/931202" } ], "reference": [ { "type": "PubMed", "id": "32502341", "url": "https://glygen.org/publication/PubMed/32502341" } ] }, { "title": "Solving an MHC allele-specific bias in the reported immunopeptidome.", "journal": "JCI insight", "date": "2020-10-02", "authors": "Klatt Martin G, Mack Kyeara N, Bai Yang, Aretz Zita E H, Nathan Levy I, Mun Sung Soo, Dao Tao, Scheinberg David A", "evidence": [ { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "577391", "url": "https://www.iedb.org/epitope/577391" }, { "database": "IEDB", "id": "626654", "url": "https://www.iedb.org/epitope/626654" } ], "reference": [ { "type": "PubMed", "id": "32897882", "url": "https://glygen.org/publication/PubMed/32897882" } ] }, { "title": "Spliced Peptides and Cytokine-Driven Changes in the Immunopeptidome of Melanoma.", "journal": "Cancer immunology research", "date": "2020-10", "authors": "Faridi Pouya, Woods Katherine, Ostrouska Simone, Deceneux Cyril, Aranha Ritchlynn, Duscharla Divya, Wong Stephen Q, Chen Weisan, Ramarathinam Sri H, Lim Kam Sian Terry C C, Croft Nathan P, Li Chen, Ayala Rochelle, Cebon Jonathan S, Purcell Anthony W, Schittenhelm Ralf B, Behren Andreas", "evidence": [ { "database": "IEDB", "id": "224520", "url": "https://www.iedb.org/epitope/224520" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "543840", "url": "https://www.iedb.org/epitope/543840" }, { "database": "IEDB", "id": "545212", "url": "https://www.iedb.org/epitope/545212" }, { "database": "IEDB", "id": "637907", "url": "https://www.iedb.org/epitope/637907" }, { "database": "IEDB", "id": "691226", "url": "https://www.iedb.org/epitope/691226" }, { "database": "IEDB", "id": "1370066", "url": "https://www.iedb.org/epitope/1370066" }, { "database": "IEDB", "id": "1975389", "url": "https://www.iedb.org/epitope/1975389" }, { "database": "IEDB", "id": "1989675", "url": "https://www.iedb.org/epitope/1989675" }, { "database": "IEDB", "id": "1989736", "url": "https://www.iedb.org/epitope/1989736" }, { "database": "IEDB", "id": "1997222", "url": "https://www.iedb.org/epitope/1997222" } ], "reference": [ { "type": "PubMed", "id": "32938616", "url": "https://glygen.org/publication/PubMed/32938616" } ] }, { "title": "Methods for Enrichment and Assignment of N-Acetylglucosamine Modification Sites.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Maynard JC, Chalkley RJ", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "reference": [ { "type": "PubMed", "id": "32938750", "url": "https://glygen.org/publication/PubMed/32938750" } ] }, { "title": "Biogenesis of HLA Ligand Presentation in Immune Cells Upon Activation Reveals Changes in Peptide Length Preference.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Marino Fabio, Semilietof Aikaterini, Michaux Justine, Pak Hui-Song, Coukos George, M\u00fcller Markus, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" } ], "reference": [ { "type": "PubMed", "id": "32983136", "url": "https://glygen.org/publication/PubMed/32983136" } ] }, { "title": "Dopachrome tautomerase variants in patients with oculocutaneous albinism.", "journal": "Genetics in medicine : official journal of the American College of Medical Genetics", "date": "2021", "authors": "Pennamen P, Tingaud-Sequeira A, Gazova I, Keighren M, McKie L, Marlin S, Gherbi Halem S, Kaplan J, Delevoye C, Lacombe D, Plaisant C, Michaud V, Lasseaux E, Javerzat S, Jackson I, Arveiler B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "33100333", "url": "https://glygen.org/publication/PubMed/33100333" } ] }, { "title": "Mild Acid Elution and MHC Immunoaffinity Chromatography Reveal Similar Albeit Not Identical Profiles of the HLA Class I Immunopeptidome.", "journal": "Journal of proteome research", "date": "2021-01-01", "authors": "Sturm Theo, Sautter Benedikt, W\u00f6rner Tobias P, Stevanovi\u0107 Stefan, Rammensee Hans-Georg, Planz Oliver, Heck Albert J R, Aebersold Ruedi", "evidence": [ { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "448605", "url": "https://www.iedb.org/epitope/448605" }, { "database": "IEDB", "id": "1337127", "url": "https://www.iedb.org/epitope/1337127" } ], "reference": [ { "type": "PubMed", "id": "33141586", "url": "https://glygen.org/publication/PubMed/33141586" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Thermostability profiling of MHC-bound peptides: a new dimension in immunopeptidomics and aid for immunotherapy design.", "journal": "Nature communications", "date": "2020-12-09", "authors": "Jappe Emma C, Garde Christian, Ramarathinam Sri H, Passantino Ethan, Illing Patricia T, Mifsud Nicole A, Trolle Thomas, Kringelum Jens V, Croft Nathan P, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "441915", "url": "https://www.iedb.org/epitope/441915" }, { "database": "IEDB", "id": "456478", "url": "https://www.iedb.org/epitope/456478" }, { "database": "IEDB", "id": "545212", "url": "https://www.iedb.org/epitope/545212" }, { "database": "IEDB", "id": "576755", "url": "https://www.iedb.org/epitope/576755" }, { "database": "IEDB", "id": "619699", "url": "https://www.iedb.org/epitope/619699" }, { "database": "IEDB", "id": "931202", "url": "https://www.iedb.org/epitope/931202" }, { "database": "IEDB", "id": "1365654", "url": "https://www.iedb.org/epitope/1365654" }, { "database": "IEDB", "id": "1376934", "url": "https://www.iedb.org/epitope/1376934" } ], "reference": [ { "type": "PubMed", "id": "33298915", "url": "https://glygen.org/publication/PubMed/33298915" } ] }, { "title": "The Impact of Biomaterial Cell Contact on the Immunopeptidome.", "journal": "Frontiers in bioengineering and biotechnology", "date": "2020", "authors": "Ghosh Michael, Hartmann Hanna, Jakobi Meike, M\u00e4rz L\u00e9o, Bichmann Leon, Freudenmann Lena K, M\u00fchlenbruch Lena, Segan S\u00f6ren, Rammensee Hans-Georg, Schneiderhan-Marra Nicole, Shipp Christopher, Stevanovi\u0107 Stefan, Joos Thomas O", "evidence": [ { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "1343458", "url": "https://www.iedb.org/epitope/1343458" } ], "reference": [ { "type": "PubMed", "id": "33392160", "url": "https://glygen.org/publication/PubMed/33392160" } ] }, { "title": "CIITA-Transduced Glioblastoma Cells Uncover a Rich Repertoire of Clinically Relevant Tumor-Associated HLA-II Antigens.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Forlani Greta, Michaux Justine, Pak HuiSong, Huber Florian, Marie Joseph Elodie Lauret, Ramia Elise, Stevenson Brian J, Linnebacher Michael, Accolla Roberto S, Bassani-Sternberg Michal", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "224520", "url": "https://www.iedb.org/epitope/224520" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "447188", "url": "https://www.iedb.org/epitope/447188" }, { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" } ], "reference": [ { "type": "PubMed", "id": "33592498", "url": "https://glygen.org/publication/PubMed/33592498" } ] }, { "title": "Alterations in the HLA-B*57:01 Immunopeptidome by Flucloxacillin and Immunogenicity of Drug-Haptenated Peptides.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Puig Montserrat, Ananthula Suryatheja, Venna Ramesh, Kumar Polumuri Swamy, Mattson Elliot, Walker Lacey M, Cardone Marco, Takahashi Mayumi, Su Shan, Boyd Lisa F, Natarajan Kannan, Abdoulaeva Galina, Wu Wells W, Roderiquez Gregory, Hildebrand William H, Beaucage Serge L, Li Zhihua, Margulies David H, Norcross Michael A", "evidence": [ { "database": "IEDB", "id": "508467", "url": "https://www.iedb.org/epitope/508467" } ], "reference": [ { "type": "PubMed", "id": "33633747", "url": "https://glygen.org/publication/PubMed/33633747" } ] }, { "title": "ERAP2 Increases the Abundance of a Peptide Submotif Highly Selective for the Birdshot Uveitis-Associated HLA-A29.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Venema Wouter J, Hiddingh Sanne, de Boer Joke H, Claas Frans H J, Mulder Arend, den Hollander Anneke I, Stratikos Efstratios, Sarkizova Siranush, van der Veken Lars T, Janssen George M C, van Veelen Peter A, Kuiper Jonas J W", "evidence": [ { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" } ], "reference": [ { "type": "PubMed", "id": "33717175", "url": "https://glygen.org/publication/PubMed/33717175" } ] }, { "title": "Carbamazepine Induces Focused T Cell Responses in Resolved Stevens-Johnson Syndrome and Toxic Epidermal Necrolysis Cases But Does Not Perturb the Immunopeptidome for T Cell Recognition.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Mifsud Nicole A, Illing Patricia T, Lai Jeffrey W, Fettke Heidi, Hensen Luca, Huang Ziyi, Rossjohn Jamie, Vivian Julian P, Kwan Patrick, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "650344", "url": "https://www.iedb.org/epitope/650344" }, { "database": "IEDB", "id": "1566681", "url": "https://www.iedb.org/epitope/1566681" }, { "database": "IEDB", "id": "1584717", "url": "https://www.iedb.org/epitope/1584717" } ], "reference": [ { "type": "PubMed", "id": "33912179", "url": "https://glygen.org/publication/PubMed/33912179" } ] }, { "title": "An Integrated Genomic, Proteomic, and Immunopeptidomic Approach to Discover Treatment-Induced Neoantigens.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Olsson Niclas, Heberling Marlene L, Zhang Lichao, Jhunjhunwala Suchit, Phung Qui T, Lin Sarah, Anania Veronica G, Lill Jennie R, Elias Joshua E", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "931202", "url": "https://www.iedb.org/epitope/931202" }, { "database": "IEDB", "id": "1588548", "url": "https://www.iedb.org/epitope/1588548" } ], "reference": [ { "type": "PubMed", "id": "33936100", "url": "https://glygen.org/publication/PubMed/33936100" } ] }, { "title": "IFN\u03b3 Modulates the Immunopeptidome of Triple Negative Breast Cancer Cells by Enhancing and Diversifying Antigen Processing and Presentation.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Goncalves Gabriel, Mullan Kerry A, Duscharla Divya, Ayala Rochelle, Croft Nathan P, Faridi Pouya, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "224520", "url": "https://www.iedb.org/epitope/224520" }, { "database": "IEDB", "id": "545212", "url": "https://www.iedb.org/epitope/545212" }, { "database": "IEDB", "id": "637907", "url": "https://www.iedb.org/epitope/637907" }, { "database": "IEDB", "id": "1370066", "url": "https://www.iedb.org/epitope/1370066" }, { "database": "IEDB", "id": "1881392", "url": "https://www.iedb.org/epitope/1881392" }, { "database": "IEDB", "id": "1899658", "url": "https://www.iedb.org/epitope/1899658" } ], "reference": [ { "type": "PubMed", "id": "33968037", "url": "https://glygen.org/publication/PubMed/33968037" } ] }, { "title": "NMD inhibition by 5-azacytidine augments presentation of immunogenic frameshift-derived neoepitopes.", "journal": "iScience", "date": "2021-04-23", "authors": "Becker Jonas P, Helm Dominic, Rettel Mandy, Stein Frank, Hernandez-Sanchez Alejandro, Urban Katharina, Gebert Johannes, Kloor Matthias, Neu-Yilik Gabriele, von Knebel Doeberitz Magnus, Hentze Matthias W, Kulozik Andreas E", "evidence": [ { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "619699", "url": "https://www.iedb.org/epitope/619699" }, { "database": "IEDB", "id": "868772", "url": "https://www.iedb.org/epitope/868772" }, { "database": "IEDB", "id": "1712787", "url": "https://www.iedb.org/epitope/1712787" }, { "database": "IEDB", "id": "1715179", "url": "https://www.iedb.org/epitope/1715179" }, { "database": "IEDB", "id": "1715606", "url": "https://www.iedb.org/epitope/1715606" } ], "reference": [ { "type": "PubMed", "id": "33981976", "url": "https://glygen.org/publication/PubMed/33981976" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "The Effect of Interferons on Presentation of Defective Ribosomal Products as HLA Peptides.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Komov Liran, Melamed Kadosh Dganit, Barnea Eilon, Admon Arie", "evidence": [ { "database": "IEDB", "id": "691226", "url": "https://www.iedb.org/epitope/691226" } ], "reference": [ { "type": "PubMed", "id": "34087483", "url": "https://glygen.org/publication/PubMed/34087483" } ] }, { "title": "Profiling SARS-CoV-2 HLA-I peptidome reveals T\u00a0cell epitopes from out-of-frame ORFs.", "journal": "Cell", "date": "2021-07-22", "authors": "Weingarten-Gabbay Shira, Klaeger Susan, Sarkizova Siranush, Pearlman Leah R, Chen Da-Yuan, Gallagher Kathleen M E, Bauer Matthew R, Taylor Hannah B, Dunn W Augustine, Tarr Christina, Sidney John, Rachimi Suzanna, Conway Hasahn L, Katsis Katelin, Wang Yuntong, Leistritz-Edwards Del, Durkin Melissa R, Tomkins-Tinch Christopher H, Finkel Yaara, Nachshon Aharon, Gentili Matteo, Rivera Keith D, Carulli Isabel P, Chea Vipheaviny A, Chandrashekar Abishek, Bozkus Cansu Cimen, Carrington Mary, , Bhardwaj Nina, Barouch Dan H, Sette Alessandro, Maus Marcela V, Rice Charles M, Clauser Karl R, Keskin Derin B, Pregibon Daniel C, Hacohen Nir, Carr Steven A, Abelin Jennifer G, Saeed Mohsan, Sabeti Pardis C", "evidence": [ { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "935936", "url": "https://www.iedb.org/epitope/935936" } ], "reference": [ { "type": "PubMed", "id": "34171305", "url": "https://glygen.org/publication/PubMed/34171305" } ] }, { "title": "HLA-B and cysteinylated ligands distinguish the antigen presentation landscape of extracellular vesicles.", "journal": "Communications biology", "date": "2021-07-01", "authors": "Bauz\u00e1-Martinez Julia, Heck Albert J R, Wu Wei", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "469718", "url": "https://www.iedb.org/epitope/469718" } ], "reference": [ { "type": "PubMed", "id": "34211107", "url": "https://glygen.org/publication/PubMed/34211107" } ] }, { "title": "HLA class II immunopeptidomics reveals that co-inherited HLA-allotypes within an extended haplotype can improve proteome coverage for immunosurveillance.", "journal": "Proteomics", "date": "2021-09", "authors": "Ramarathinam Sri H, Ho Bosco K, Dudek Nadine L, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "1768012", "url": "https://www.iedb.org/epitope/1768012" } ], "reference": [ { "type": "PubMed", "id": "34357683", "url": "https://glygen.org/publication/PubMed/34357683" } ] }, { "title": "Immunopeptidogenomics: Harnessing RNA-Seq to Illuminate the Dark Immunopeptidome.", "journal": "Molecular & cellular proteomics : MCP", "date": "2021", "authors": "Scull Katherine E, Pandey Kirti, Ramarathinam Sri H, Purcell Anthony W", "evidence": [ { "database": "IEDB", "id": "545212", "url": "https://www.iedb.org/epitope/545212" }, { "database": "IEDB", "id": "637907", "url": "https://www.iedb.org/epitope/637907" }, { "database": "IEDB", "id": "1370066", "url": "https://www.iedb.org/epitope/1370066" } ], "reference": [ { "type": "PubMed", "id": "34509645", "url": "https://glygen.org/publication/PubMed/34509645" } ] }, { "title": "Characterization of HLA-A*33:03 epitopes via immunoprecipitation and LC-MS/MS.", "journal": "Proteomics", "date": "2022", "authors": "Khan A, Shin JY, So MK, Na JH, Justesen S, Ansari AA, Ko BJ, Ahn SM", "evidence": [ { "database": "IEDB", "id": "881177", "url": "https://www.iedb.org/epitope/881177" }, { "database": "IEDB", "id": "1028352", "url": "https://www.iedb.org/epitope/1028352" }, { "database": "IEDB", "id": "1715179", "url": "https://www.iedb.org/epitope/1715179" } ], "reference": [ { "type": "PubMed", "id": "34561969", "url": "https://glygen.org/publication/PubMed/34561969" } ] }, { "title": "HLA Allele-Specific Quantitative Profiling of Type 1 Diabetic B Lymphocyte Immunopeptidome.", "journal": "Journal of proteome research", "date": "2022-01-07", "authors": "Sudhir Putty-Reddy, Lin Tai-Du, Zhang Qibin", "evidence": [ { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "483492", "url": "https://www.iedb.org/epitope/483492" }, { "database": "IEDB", "id": "935936", "url": "https://www.iedb.org/epitope/935936" } ], "reference": [ { "type": "PubMed", "id": "34932366", "url": "https://glygen.org/publication/PubMed/34932366" } ] }, { "title": "Immunopeptidomic analysis of influenza A virus infected human tissues identifies internal proteins as a rich source of HLA ligands.", "journal": "PLoS pathogens", "date": "2022-01", "authors": "Nicholas Ben, Bailey Alistair, Staples Karl J, Wilkinson Tom, Elliott Tim, Skipp Paul", "evidence": [ { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "456478", "url": "https://www.iedb.org/epitope/456478" }, { "database": "IEDB", "id": "545212", "url": "https://www.iedb.org/epitope/545212" }, { "database": "IEDB", "id": "599554", "url": "https://www.iedb.org/epitope/599554" }, { "database": "IEDB", "id": "637907", "url": "https://www.iedb.org/epitope/637907" }, { "database": "IEDB", "id": "868772", "url": "https://www.iedb.org/epitope/868772" }, { "database": "IEDB", "id": "935936", "url": "https://www.iedb.org/epitope/935936" }, { "database": "IEDB", "id": "2006533", "url": "https://www.iedb.org/epitope/2006533" }, { "database": "IEDB", "id": "2014460", "url": "https://www.iedb.org/epitope/2014460" }, { "database": "IEDB", "id": "2014638", "url": "https://www.iedb.org/epitope/2014638" }, { "database": "IEDB", "id": "2021950", "url": "https://www.iedb.org/epitope/2021950" }, { "database": "IEDB", "id": "2037222", "url": "https://www.iedb.org/epitope/2037222" }, { "database": "IEDB", "id": "2044118", "url": "https://www.iedb.org/epitope/2044118" }, { "database": "IEDB", "id": "2049312", "url": "https://www.iedb.org/epitope/2049312" }, { "database": "IEDB", "id": "2050913", "url": "https://www.iedb.org/epitope/2050913" }, { "database": "IEDB", "id": "2053584", "url": "https://www.iedb.org/epitope/2053584" } ], "reference": [ { "type": "PubMed", "id": "35051231", "url": "https://glygen.org/publication/PubMed/35051231" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Tumour-associated antigenic peptides are present in the HLA class I ligandome of cancer cell line derived extracellular vesicles.", "journal": "Immunology", "date": "2022-06", "authors": "Kumar Pankaj, Boyne Caitlin, Brown Sydney, Qureshi Ayesha, Thorpe Peter, Synowsky Silvia A, Shirran Sally, Powis Simon J", "evidence": [ { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" } ], "reference": [ { "type": "PubMed", "id": "35318648", "url": "https://glygen.org/publication/PubMed/35318648" } ] }, { "title": "Cell-type-specific labeling and profiling of glycans in living mice.", "journal": "Nature chemical biology", "date": "2022-06", "authors": "Fan Xinqi, Song Qitao, Sun De-En, Hao Yi, Wang Jingyang, Wang Chunting, Chen Xing", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "reference": [ { "type": "PubMed", "id": "35513511", "url": "https://glygen.org/publication/PubMed/35513511" } ] }, { "title": "Unmasking the suppressed immunopeptidome of EZH2-mutated diffuse large B-cell lymphomas through combination drug treatment.", "journal": "Blood advances", "date": "2022-07-26", "authors": "Bourne Christopher M, Mun Sung Soo, Dao Tao, Aretz Zita E H, Molvi Zaki, Gejman Ron S, Daman Andrew, Takata Katsuyoshi, Steidl Christian, Klatt Martin G, Scheinberg David A", "evidence": [ { "database": "IEDB", "id": "572840", "url": "https://www.iedb.org/epitope/572840" }, { "database": "IEDB", "id": "726204", "url": "https://www.iedb.org/epitope/726204" } ], "reference": [ { "type": "PubMed", "id": "35561310", "url": "https://glygen.org/publication/PubMed/35561310" } ] }, { "title": "TFAP2 paralogs facilitate chromatin access for MITF at pigmentation and cell proliferation genes.", "journal": "PLoS genetics", "date": "2022-05", "authors": "Kenny Colin, Dilshat Ramile, Seberg Hannah E, Van Otterloo Eric, Bonde Gregory, Helverson Annika, Franke Christopher M, Steingr\u00edmsson Eir\u00edkur, Cornell Robert A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "35580127", "url": "https://glygen.org/publication/PubMed/35580127" } ] }, { "title": "Soluble HLA peptidome of pleural effusions is a valuable source for tumor antigens.", "journal": "Journal for immunotherapy of cancer", "date": "2022-05", "authors": "Khazan-Kost Sofia, Cafri Gal, Melamed Kadosh Dganit, Mooshayef Navit, Chatterji Sumit, Dominissini Dan, Manor Sigal, Zisser Bracha, Broday Limor, Talalai Efrosiniia, Shemer Anat, Zadok Oranit, Ofek Efrat, Onn Amir, Admon Arie, Peled Michael", "evidence": [ { "database": "IEDB", "id": "162627", "url": "https://www.iedb.org/epitope/162627" }, { "database": "IEDB", "id": "419513", "url": "https://www.iedb.org/epitope/419513" }, { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" }, { "database": "IEDB", "id": "483492", "url": "https://www.iedb.org/epitope/483492" }, { "database": "IEDB", "id": "868772", "url": "https://www.iedb.org/epitope/868772" }, { "database": "IEDB", "id": "881177", "url": "https://www.iedb.org/epitope/881177" }, { "database": "IEDB", "id": "2259393", "url": "https://www.iedb.org/epitope/2259393" } ], "reference": [ { "type": "PubMed", "id": "35580925", "url": "https://glygen.org/publication/PubMed/35580925" } ] }, { "title": "Spatial and temporal proteomics reveals the distinct distributions and dynamics of O-GlcNAcylated proteins.", "journal": "Cell reports", "date": "2022-06-14", "authors": "Xu Senhan, Tong Ming, Suttapitugsakul Suttipong, Wu Ronghu", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "reference": [ { "type": "PubMed", "id": "35705054", "url": "https://glygen.org/publication/PubMed/35705054" } ] }, { "title": "Multi-Omic Analysis of Two Common P53 Mutations: Proteins Regulated by Mutated P53 as Potential Targets for Immunotherapy.", "journal": "Cancers", "date": "2022-08-17", "authors": "Vadakekolathu Jayakumar, Boocock David J, Pandey Kirti, Guinn Barbara-Ann, Legrand Antoine, Miles Amanda K, Coveney Clare, Ayala Rochelle, Purcell Anthony W, McArdle Stephanie E", "evidence": [ { "database": "IEDB", "id": "457558", "url": "https://www.iedb.org/epitope/457558" }, { "database": "IEDB", "id": "2142198", "url": "https://www.iedb.org/epitope/2142198" } ], "reference": [ { "type": "PubMed", "id": "36010968", "url": "https://glygen.org/publication/PubMed/36010968" } ] }, { "title": "Immunopeptidomics-based design of mRNA vaccine formulations against Listeria monocytogenes.", "journal": "Nature communications", "date": "2022-10-14", "authors": "Mayer Rupert L, Verbeke Rein, Asselman Caroline, Aernout Ilke, Gul Adillah, Eggermont Denzel, Boucher Katie, Thery Fabien, Maia Teresa M, Demol Hans, Gabriels Ralf, Martens Lennart, B\u00e9cavin Christophe, De Smedt Stefaan C, Vandekerckhove Bart, Lentacker Ine, Impens Francis", "evidence": [ { "database": "IEDB", "id": "543840", "url": "https://www.iedb.org/epitope/543840" } ], "reference": [ { "type": "PubMed", "id": "36241641", "url": "https://glygen.org/publication/PubMed/36241641" } ] }, { "title": "Direct identification of HLA class I and class II-restricted T cell epitopes in pancreatic cancer tissues by mass spectrometry.", "journal": "Journal of hematology & oncology", "date": "2022-10-25", "authors": "Fujiwara Kenji, Shao Yingkuan, Niu Nan, Zhang Tengyi, Herbst Brian, Henderson Mackenzie, Muth Stephen, Zhang Pingbo, Zheng Lei", "evidence": [ { "database": "IEDB", "id": "431661", "url": "https://www.iedb.org/epitope/431661" }, { "database": "IEDB", "id": "572840", "url": "https://www.iedb.org/epitope/572840" }, { "database": "IEDB", "id": "583629", "url": "https://www.iedb.org/epitope/583629" }, { "database": "IEDB", "id": "652672", "url": "https://www.iedb.org/epitope/652672" }, { "database": "IEDB", "id": "935936", "url": "https://www.iedb.org/epitope/935936" } ], "reference": [ { "type": "PubMed", "id": "36284347", "url": "https://glygen.org/publication/PubMed/36284347" } ] }, { "title": "ARID1A downregulation promotes cell proliferation and migration of colon cancer via VIM activation and CDH1 suppression.", "journal": "Journal of cellular and molecular medicine", "date": "2022-12", "authors": "Baldi Salem, Zhang Qianshi, Zhang Zhenyu, Safi Mohammed, Khamgan Hassan, Wu Han, Zhang Mengyan, Qian Yuanyuan, Gao Yina, Shopit Abdullah, Al-Danakh Abdullah, Alradhi Mohammed, Al-Nusaif Murad, Zuo Yunfei", "evidence": [ { "database": "Reactome", "id": "R-HSA-9764790", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764790" } ], "reference": [ { "type": "PubMed", "id": "36420658", "url": "https://glygen.org/publication/PubMed/36420658" } ] }, { "title": "O-GlcNAcylation of Raptor transduces glucose signals to mTORC1.", "journal": "Molecular cell", "date": "2023-08-17", "authors": "Xu Chenchen, Pan Xiaoqing, Wang Dong, Guan Yuanyuan, Yang Wenyu, Chen Xing, Liu Ying", "evidence": [ { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "reference": [ { "type": "PubMed", "id": "37541260", "url": "https://glygen.org/publication/PubMed/37541260" } ] }, { "title": "Targeting of intracellular oncoproteins with peptide-centric CARs.", "journal": "Nature", "date": "2023-11", "authors": "Yarmarkovich Mark, Marshall Quinlen F, Warrington John M, Premaratne Rasika, Farrel Alvin, Groff David, Li Wei, di Marco Moreno, Runbeck Erin, Truong Hau, Toor Jugmohit S, Tripathi Sarvind, Nguyen Son, Shen Helena, Noel Tiffany, Church Nicole L, Weiner Amber, Kendsersky Nathan, Martinez Dan, Weisberg Rebecca, Christie Molly, Eisenlohr Laurence, Bosse Kristopher R, Dimitrov Dimiter S, Stevanovic Stefan, Sgourakis Nikolaos G, Kiefel Ben R, Maris John M", "evidence": [ { "database": "IEDB", "id": "420212", "url": "https://www.iedb.org/epitope/420212" }, { "database": "IEDB", "id": "441344", "url": "https://www.iedb.org/epitope/441344" } ], "reference": [ { "type": "PubMed", "id": "37938771", "url": "https://glygen.org/publication/PubMed/37938771" } ] }, { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "C19ORF84 connects piRNA and DNA methylation machineries to defend the mammalian germ line.", "journal": "Molecular cell", "date": "2024-02-07", "authors": "Zoch Ansgar, Konieczny Gabriela, Auchynnikava Tania, Stallmeyer Birgit, Rotte Nadja, Heep Madeleine, Berrens Rebecca V, Schito Martina, Kabayama Yuka, Sch\u00f6pp Theresa, Kliesch Sabine, Houston Brendan, Nagirnaja Liina, O'Bryan Moira K, Aston Kenneth I, Conrad Donald F, Rappsilber Juri, Allshire Robin C, Cook Atlanta G, T\u00fcttelmann Frank, O'Carroll D\u00f3nal", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845323", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845323" } ], "reference": [ { "type": "PubMed", "id": "38359823", "url": "https://glygen.org/publication/PubMed/38359823" } ] }, { "title": "O-GlcNAc transferase regulates collagen deposition and fibrosis resolution in idiopathic pulmonary fibrosis.", "journal": "Frontiers in immunology", "date": "2024", "authors": "Vang Shia, Helton Eric Scott, Guo Yiming, Burpee Bailey, Rose Elex, Easter Molly, Bollenbecker Seth, Hirsch Meghan June, Matthews Emma Lea, Jones Luke Isaac, Howze Patrick Henry, Rajasekaran Vasanthi, Denson Rebecca, Cochran Phillip, Attah Isaac Kwame, Olson Heather, Clair Geremy, Melkani Girish, Krick Stefanie, Barnes Jarrod Wesley", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "38665916", "url": "https://glygen.org/publication/PubMed/38665916" } ] }, { "title": "ARID1A suppresses R-loop-mediated STING-type I interferon pathway activation of anti-tumor immunity.", "journal": "Cell", "date": "2024-06-20", "authors": "Maxwell Matthew B, Hom-Tedla Marianne S, Yi Jawoon, Li Shitian, Rivera Samuel A, Yu Jingting, Burns Mannix J, McRae Helen M, Stevenson Braden T, Coakley Katherine E, Ho Josephine, Gastelum Kameneff Bojorquez, Bell Joshua C, Jones Alexander C, Eskander Ramez N, Dykhuizen Emily C, Shadel Gerald S, Kaech Susan M, Hargreaves Diana C", "evidence": [ { "database": "RefSeq", "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ], "reference": [ { "type": "PubMed", "id": "38754421", "url": "https://glygen.org/publication/PubMed/38754421" } ] }, { "title": "Genome-wide DNA methylation in relation to ARID1A deficiency in ovarian clear cell carcinoma.", "journal": "Journal of translational medicine", "date": "2024-06-10", "authors": "Li Shang, Meersma Gert Jan, Kupryjanczyk Jolanta, de Jong Steven, Wisman G Bea A", "evidence": [ { "database": "RefSeq", "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ], "reference": [ { "type": "PubMed", "id": "38858765", "url": "https://glygen.org/publication/PubMed/38858765" } ] }, { "title": "ARID1A restrains EMT and stemness of ovarian cancer cells through the Hippo pathway.", "journal": "International journal of oncology", "date": "2024-08", "authors": "Xu Shouying, Zhu Chongying, Xu Qiang, An Zihao, Xu Shu, Xuan Ge, Lin Chao, Tang Chao", "evidence": [ { "database": "RefSeq", "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ], "reference": [ { "type": "PubMed", "id": "38873993", "url": "https://glygen.org/publication/PubMed/38873993" } ] }, { "title": "ARID1A-Deficient Tumors Acquire Immunogenic Neoantigens during the Development of Resistance to Targeted Therapy.", "journal": "Cancer research", "date": "2024-09-04", "authors": "Okada Masahiro, Yamasaki Satoru, Nakazato Hiroshi, Hirahara Yuhya, Ishibashi Takuya, Kawamura Masami, Shimizu Kanako, Fujii Shin-Ichiro", "evidence": [ { "database": "RefSeq", "id": "NP_006006", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006006" } ], "reference": [ { "type": "PubMed", "id": "39228255", "url": "https://glygen.org/publication/PubMed/39228255" } ] }, { "title": "Systematic Evaluation of Affinity Enrichment Methods for O-GlcNAc Proteomics.", "journal": "Journal of proteome research", "date": "2024-10-04", "authors": "Hou Chunyan, Wu Ci, Wu Zichun, Cheng Yifan, Li Weiyu, Sun Hui, Ma Junfeng", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "39302247", "url": "https://glygen.org/publication/PubMed/39302247" } ] }, { "title": "Ultradeep O-GlcNAc proteomics reveals widespread O-GlcNAcylation on tyrosine residues of proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2024-11-19", "authors": "Hou Chunyan, Deng Jingtao, Wu Ci, Zhang Jing, Byers Stephen, Moremen Kelley W, Pei Huadong, Ma Junfeng", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "reference": [ { "type": "PubMed", "id": "39531497", "url": "https://glygen.org/publication/PubMed/39531497" } ] }, { "title": "Rapid and large-scale glycopeptide enrichment strategy based on chemical ligation.", "journal": "National science review", "date": "2024-11", "authors": "Xiong Yingying, Lu Zhuoer, Shao Yuyin, Meng Peiyi, Wang Guoli, Zhou Xinwen, Yao Jun, Bao Huimin, Lu Haojie", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" }, { "database": "O-GlcNAc Atlas", "id": "O14497", "url": "https://oglcnac.org/atlas/detail/O14497" } ], "reference": [ { "type": "PubMed", "id": "39534244", "url": "https://glygen.org/publication/PubMed/39534244" } ] }, { "title": "GATAD2B O-GlcNAcylation Regulates Breast Cancer Stem-like Potential and Drug Resistance.", "journal": "Cells", "date": "2025-03-08", "authors": "Le Minh Giang, Merzy Jessica, Esquea Emily M, Ahmed Nusaiba N, Young Riley G, Sharp Ryan J, Dhameliya Tejsi T, Agana Bernice, Lee Mi-Hye, Bethard Jennifer R, Comte-Walters Susana, Ball Lauren E, Reginato Mauricio J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "40136647", "url": "https://glygen.org/publication/PubMed/40136647" } ] }, { "title": "O-GlcNAcylation reduces proteome solubility and regulates the formation of biomolecular condensates in human cells.", "journal": "Nature communications", "date": "2025-04-30", "authors": "Xu Senhan, Yin Kejun, Xu Xing, Fu Longping, Wu Ronghu", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14497", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14497" } ], "reference": [ { "type": "PubMed", "id": "40307207", "url": "https://glygen.org/publication/PubMed/40307207" } ] }, { "title": "Tyrosinase related protein 1 (TRP1) functions as a DHICA oxidase in melanin biosynthesis.", "journal": "The EMBO journal", "date": "1994-12-15", "authors": "Kobayashi T, Urabe K, Winder A, Jim\u00e9nez-Cervantes C, Imokawa G, Brewington T, Solano F, Garc\u00eda-Borr\u00f3n J C, Hearing V J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "7813420", "url": "https://glygen.org/publication/PubMed/7813420" } ] }, { "title": "Molecular characterization of a human tyrosinase-related-protein-2 cDNA. Patterns of expression in melanocytic cells.", "journal": "European journal of biochemistry", "date": "1994", "authors": "Bouchard B, Del Marmol V, Jackson IJ, Cherif D, Dubertret L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "8306979", "url": "https://glygen.org/publication/PubMed/8306979" } ] }, { "title": "Diversity and specialization of mammalian SWI/SNF complexes.", "journal": "Genes Dev.", "date": "1996", "authors": "Wang W, Xue Y, Zhou S, Kuo A, Cairns B R, Crabtree G R", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "8804307", "url": "https://glygen.org/publication/PubMed/8804307" } ] }, { "title": "Cloning of human lymphocyte-specific interferon regulatory factor (hLSIRF/hIRF4) and mapping of the gene to 6p23-p25.", "journal": "Genomics", "date": "1996-10-15", "authors": "Grossman A, Mittr\u00fccker H W, Nicholl J, Suzuki A, Chung S, Antonio L, Suggs S, Sutherland G R, Siderovski D P, Mak T W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "8921401", "url": "https://glygen.org/publication/PubMed/8921401" } ] }, { "title": "Molecular cloning and expression of a novel human cDNA containing CAG repeats.", "journal": "Gene", "date": "1997", "authors": "Takeuchi T, Chen B K, Qiu Y, Sonobe H, Ohtsuki Y", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "reference": [ { "type": "PubMed", "id": "9434167", "url": "https://glygen.org/publication/PubMed/9434167" } ] }, { "title": "PRMT 3, a type I protein arginine N-methyltransferase that differs from PRMT1 in its oligomerization, subcellular localization, substrate specificity, and regulation.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Tang J, Gary JD, Clarke S, Herschman HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "9642256", "url": "https://glygen.org/publication/PubMed/9642256" } ] }, { "title": "Human tyrosinase related protein-1 (TRP-1) does not function as a DHICA oxidase activity in contrast to murine TRP-1.", "journal": "Experimental dermatology", "date": "1998-08", "authors": "Boissy R E, Sakai C, Zhao H, Kobayashi T, Hearing V J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9824585", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585" } ], "reference": [ { "type": "PubMed", "id": "9758418", "url": "https://glygen.org/publication/PubMed/9758418" } ] } ], "pathway": [ { "id": "hsa:8289", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?hsa:8289", "resource": "KEGG Pathway" }, { "id": "R-HSA-3214858", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "resource": "Reactome", "description": "RMTs methylate histone arginines" }, { "id": "R-HSA-8939243", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8939243", "resource": "Reactome", "description": "RUNX1 interacts with co-factors whose precise effect on RUNX1 targets is not known" }, { "id": "R-HSA-9764790", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9764790", "resource": "Reactome", "description": "Positive Regulation of CDH1 Gene Transcription" }, { "id": "R-HSA-9824585", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9824585", "resource": "Reactome", "description": "Regulation of MITF-M-dependent genes involved in pigmentation" }, { "id": "R-HSA-9845323", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845323", "resource": "Reactome", "description": "Regulation of endogenous retroelements by Piwi-interacting RNAs (piRNAs)" }, { "id": "R-HSA-9933937", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933937", "resource": "Reactome", "description": "Formation of the canonical BAF (cBAF) complex" }, { "id": "R-HSA-9933946", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9933946", "resource": "Reactome", "description": "Formation of the embryonic stem cell BAF (esBAF) complex" }, { "id": "R-HSA-9934037", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9934037", "resource": "Reactome", "description": "Formation of neuronal progenitor and neuronal BAF (npBAF and nBAF)" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A3Q1M2B9-1", "protein_name": "AT-rich interaction domain 1A", "gene_name": "ARID1A", "tax_id": 9913, "organism": "Bos taurus", "sequence": { "sequence": "MAAQVAPAAASSLGNPPPPPPSELKKAEQQQQQQREEAGGEAAAAVAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPPQAYALSSPRGGTPGSGAAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAAGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYGGGPQDGGAGKGPADMASQCWGAAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLVRTPQPSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSTMGGLSYAQQIPPYGQQGPSGYGQQGQTPYYNQQSPHPQQQQPPYSQQPPSQTPHAQPSYQQQPQSQPPQLQSSQPPYSQQPSQPPHQPSPTPYPSQQSSTQQHPQSQPPYSQPQAQSPYQQQQPQQPASSTLSQQAAYPQPQSQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYSSPQPGSALSPRQPSGGQMHTGMGSYQQNSMGSYGPQGSQYGPQGGYPRQPNYNALPNANYPSAGMAGSMNPMGAGGQMHGQPGIPPYGTLPPGRMSHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQETAVAMHVAANSIQNRPPGYPNMNQGGIMGTGPPYGQGINSMAGMINPQGPPYPMGGTMANNSAGMAASPEMMGLGDVKLTPASKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFPDGSDPTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMGTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQRHDSYGNQFSAQGTPSGSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSAGQGQPQQQQLPPAQPPPANQQQAAQPPPQQDVYNQYGNAYPATAAAATERRPAGGPQNQFPFQFGRDRVSAPPGSNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQSTGSAPQGPTYHGVNRTDEMLHTDQRANHEGPWPSHGTRQPPYGPSAPVPPMTRPPPANYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPAPVQPPLIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFSKASSPAPVEGEEEEDLLGPKLEEEEEEEVIENDEEMAFSGKDKAASENSEEKLISKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKTELLPSRPHVPCPPVPRKYVTAVEGTPGTAEQEGPPPDGPPEKRITATMDDMLSTRSSTLTEEGAKSVEATKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCICVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 2286 }, "evidence": [ { "id": "O14497", "url": "https://omabrowser.org/oma/group/O14497/", "database": "OMA" } ], "glygen_name": "Bovine", "common_name": "Bovine" }, { "uniprot_canonical_ac": "A0A8M2B773-1", "protein_name": "AT-rich interactive domain-containing protein 1B isoform X1", "gene_name": "arid1b", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "METGLVANHQVKNVGRGDPPPSPHHRTPPQQQSRAFHQQHQQRAAHNNNNISITIHSSSNRADPQHGGKEDALEAQVDRHPRLLNTGDEEDRSSKTGGDRMGSRYEHSNFGPASNNNNNNNSGGGGSASQSGSSSVSEFNNYYGNGRGGPCFDQHGGQQSPRTALIHQAPGNMDQVQNSHEGYHNNPYNHYPNYRPGYGGAGYGMMSPSRQGNMMGPGTNSPTAAAASHGKAAMASTTPAPGANVGSFQRFPGQNQQHPSGATPTLNQLLTSPSPMMRGYGGGYQDYSNPPSQQQQSGMGLGKDMSSPYSPAASHSWAAQQRNHPAMSPGNNGNSRAQVATMDPMTMKRSQMYGMGNSPYSQQGTYAGQPYGSPTAHRYPMGMQGRGQVGIGGMQYSQQQQMPAQYGPQGMSGYCQQGQPPYFSPPQQQSAAPSQPPYMQQRAPTQQDTLQEGYGSRGQSGKPNHDDMGLTQQDRPSSLPDLSGSIDDLPTGTEAGLSSAVSASGSTSSQGEQSNPAQSPFSPHASPRVPSMRSGPSPSPVGSPVGSSQSRSGPISPASGPGTQMAPQTPGNVPDVGSHSTHSQSPMSQERGYASNMQRNAPGSQFGGQQPGPSMSPHSCPTGPMHHSVGSYQMGPSYGPQSGQYGPSGNYPRPANYGGAPGANYSGPGPGMGNSLGMNASSPMHGQGPGQPCGSMTTARGPGHAAGGRPYPAGSSSVAPTSPNMPQSAGPGMGPPPPNVGRKPHESGPASAQQNLVPSSQARPPFGRSPVYPGLSGPGGRPPASFSLPQPHHPHYSSGQGQGQPHAELYGPAGYQGGSHMLGMGPGGPYSLPPSNSSARMTPQGPSYNTMPTGPMTGSGDTMMPTDPKQRAEHKEEGSTPATEPPKPKDNYGSQCVSQPPTPSPLSPSPASLSSYQGDDSDSISSPAWPKNPSSPKHSTVNMTNEKITRLYDMGCEPERRAWVDRYIAFMEERGTPVPNLPSVGKKPLDLCRLYLCVREIGGLAMVNKNKKWRELSTHLNVGTSSSSASSLKKQYIQYLFAYECKVERGEEPPPDAFAMGDGKKQQQQAKIQPPSPANSGSLQGPQTPQSTGSSTMTEMPGDLKPPTPATTPHGQVTPQPAVRNSGISVQDPFSEGSDPAFQKRGPMHGGSGDATSRMQFDTSKDPFGAARKGGSESFVPGQMPGSGMQEMYSRGPSSGMGMGPRPQYSYNPGFERRPDHVMGPEGGIAASGNQNNMVPSSSDPSMFSGSRYASHQSRHGHDGYGQQYPHSMPYGAHGMYPQQQGYKRPGEGMYGPPAKRHESEAYGMQYGGQQPDMYSQYGYPERRPMQSPFPYGYGRDRMQPGGQGPPQHSMMSGGPPPSSNSSGGPQGNMWHTRHDMGYPYPTRQSHGPPYPSMSRGDDPEARVSQESQWPGQRQSPYPSHSSSSSSSMPPMASRQPPSSYQSPPAMPNHISRVPSPAPFPRSVGGSMSPTKAHMMASLKQMQKPGGPVSMPSSQSGGLPGQGFPSIHREVNYPLDSVEATQPQLKPRRRLTSKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNTVSSFGLSQLPGFLELIVEFFRRCLIEIFGILEEYEVGTEGQKTLLGSCSEPTEKQQPSTPDFKSQSIAEHVEKRLDVEPEKPQPSSSAAALVMEKKEESAEDKADDEEKNTGKDPCPPVEPRPKQASKYDRLPVKIEEKDAEEDCVEDRSELLGLAGEFKSGLLHWKAGGGDSTAHIQTYFERSWEEEQPLENQEGVQAIGKKTVEEQPRGQEELKRELPGPSEENLTATVDDVLKSNPGSISEGESQTFPFRTRENKSSITLLEDEPRCWDEAPLSVAESWQDELAKRCICVSNIIRGLSFVPGNDSELARHPGLVLILGKLVLLHHEHPKRKRMPATYQREEERGLACSKDEWWWDCLGALRENTLVTLANISGQLDLSVYPESICLPILDGLLHWMVCPSAEAQDPFCTANGFSSLTPQRLVLECLCKLSIQDSNVDLLLATPPFGRQERLFATLVRHVGDRKSQVCREMAVAVLSNLAQGDPTAARAVALQKGSVGALISFLEDSVAMAQYQQSPHSLLHMGHSTQHEPPSINMMCRAAKALLAMAQVEENRPEFVLYESRLLDISLSSVLNSGVAAILCEVLFKLGRS", "length": 2169 }, "evidence": [ { "id": "FB:FBgn0261885", "url": "https://alliancegenome.org/gene/FB:FBgn0261885#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M9PDQ2-1", "protein_name": "AT-rich interactive domain-containing protein 1A isoform X1", "gene_name": "arid1aa", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MAAQVASATSLNTSPPSELKKPDRDPKEESVPGEKQQENKEPGLESGSPARGELQDRADVGNAGGGGESEMKNGNGNPSRVNNNQNDSTGAEGNNHPGMVHHHAPGYQPASYSYAQHYGRAPFHQHGGQQSPGMAAAAGPGALSGSMMDPYQPNSHDHSFPNHQYNSYSPFGNRSPYPGQGYGMSSPRSAPQAQAVGGQSAKQQQPAAAASYSNQRYNMGNPQPTSTPTLNQLLTSPSGARSYPNYPPSDYNSQDGAKGPADMASSGGQYGGGHPGWQQRSHHPPPMSPGSTGQPLGRNQTPGSMDQMGKMRSQPYGSGGPYSQQPHQGTPSGPQQGPAYPGQGYGPPGPQRYPMGMQGRMQYGQQMPSYGQQGPGGYMQQGQQSYYGQHGPSPHPGQQQSPYPQPSPGQAGGQGPYSQQPHATQSSGPHGQTGTPYQQPHMSQQPQGQMTGPSPGPSQSPYSQSSAAASAVPQSSQSPYSQQQVPQSQPSQQASSQAPPASQTQPSYPPGQGPQQQQQPSASQQPPQTPTPASQTPAGHAQMPQGQPTSYSQNPPQQQQPQQQQQQSPYQRFPPPPQEISQESFSSQSSAPPSGPPLASKSSTEDMQGRPSSLPDLSGSIDDLPTGTEGALSPGVSTSGVSSSQGEQSNPAQSPFSPHTSPPVGSPASASASRSGPLSPTTMPGNQMPPRPSSGQSDGIIHPSMNQPGMGPDRGYMQRNPQMAPYGSPQSSSALSPRQSSGGQVHPGMVPYQQNNSMANYGPQGGQYGPQGYPRQPGYSGMPNANYQGPGIGGSMNPMSGQGGGPMFAGMPSARMPHGQMGARPYGPNMGPNMSPNMGPNMGNMPPQVASGMCPPPGLNRKPQDAGAMQHGPTNSIHNRLPGYPNMSPGPGMMGSGYGPSMNNMPGMMNTQGSPYPMGANMTNNTSGMSPGPDFGMDGKLNQAQKMNNKVEGTPKTESKSKKSSSSTTTSEKITRLYELGPEPERKMWVDRYLAFIEEKAMGMTNLPAVGRKPLDLFRLYMSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIMSGDNKKNQPKIQPPSPAGSGSLQGPQTPQSTSSSMAESGDLKPPTPASTPHSQMPPIPSGRSSVNLQDPFADSDFSRRNTMTPNSGYQSGMSTPEMPGRMGPYEPNKDHFSGMRKVGEQFMPSGQGQNSSLGDQYNRGPPGPMGNMPMGQRHQYPYGTNYERRPESGMGPDGSIGPGVPQPNMMPSNAESGMYSPNRYPPQQQRHDSYSSQYPGQSAPPAGSYPNQQPGMFPQQQSNYKRPGDGSYPPAKRHHDGEMFGGPYNAQQPQPPTQAPPSGPTSAQQEMYNQYNSSYPGSERRPPGAQNQFPFPFGRDRMQPGTGPNSQGSMPPQMMGSQMQSAPDGPQGGMWQGRGDMGYSNYPNRQGPPAGPGQGPGYHTMNRSEDMMSSEPRMNHDGQWPGPRQPPFGPGGAGPPISRPLQSNYQSPQTMQNHIPQVSSPTPMPRPMESRTSPSKSPYMPSNIKMQKAGPPVPASHIVPPSVQPPMMRRDLSFPPGSIEATPPVLKSRRRLTMKEIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSISNFNLMQLPGFLELIVEYFRRCLIEIFGILREYEVGDPGQRALLDPNVLKEENTVEDEAFMEGMEEDGETEEEEEGEEVQRSKHQEQHAAQVPLQIKQEEKPMTLEESVKKEDSQGIEGESSAETKASEPPCLELAVTQEKPKQASKFDKLPLKIVRKKDPFVVDCSNKLGRLQEFDSGLLHWSIGGGDTTEHIQTHFESKIELLCQRTCLPAQGSDRKKGAQKESQAPSLPLSSEEHRKEVDRQPSPESSTEKVPDEISDPRDNRPADCLDAASEGTSHIEKDQEKQELELTTPESIRPAAPSPLLQGRRSVLEDEPHSKDEAPLVTLSEWQDSLARRCICVSNIVRSLSFVPGNDTEMSKHPGLLLLLGRLLLLHHRHPERKQAPLTYEKEEEVDESLGSKKDEWWWDCLELLRENCLVTLSNISGQLDFSVYTESICLPLLDGLLHWAVCPSAEAQDPFPSLGLNGALSPQRLVLETLCKLSVQDNNVDLILATAPFSRLEKLFGNLVRLVGERKVPVCREMAVVLLANLAQGDSMAARAIAVQKASVGNLLGFLEDSLAATQFQQSQGSLLHMQGSHFEPTSVDMMRRAARALLALAKVEENHSEFTLYESRLLDLSVSPLMNSMVSHVICDVLFLIGQS", "length": 2280 }, "evidence": [ { "id": "RGD:1310500", "url": "https://alliancegenome.org/gene/RGD:1310500#orthology", "database": "AGR" }, { "id": "HGNC:11110", "url": "https://alliancegenome.org/gene/HGNC:11110#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-080220-35", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-080220-35#orthology", "database": "AGR" }, { "id": "MGI:1935147", "url": "https://alliancegenome.org/gene/MGI:1935147#orthology", "database": "AGR" }, { "id": "FB:FBgn0261885", "url": "https://alliancegenome.org/gene/FB:FBgn0261885#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8M9PSC1-1", "protein_name": "AT-rich interactive domain-containing protein 1A", "gene_name": "arid1ab", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MAAQVATLNTSPPAELKKPEREPQDESVIGEKQQESKEPRADGGSPGQKELQDGADVGNAAGGGGAGGDPDMKNGNGNPSRVNNNNSQNDSGGPEGNSHPGMAPHHPGAFPPPPYSYNQHYNRAPFHQHGGQQSPGMAGPAVMDPYPPNSHEHGYPNHFNNYSPFPNRTPYHQGQGYGMNSPRNSQPPAAGGQPGKQPPTGGTTPLATAASYNNQRYNMGNPQPTSTPTLNQLLTSPSSTRSYQNYPASEYGGQEGAAKGPGDMGSSSQYGGGHPAWQQRSHHPPPMSPGNTGQANRTQPPGPMDQVGKIRGQHYGAGNPYSQQQGPPPSSQQGPPYPGQGYGPPGPQRYPMGMQGRTSGNLSGIQYGQQMGYGQHGPGGYGQNQAGYYGQQGPSPHGGPQQSSYPQQPSTGPGSQPPYSQQPSGTPHGQSGTSYGQPQGPHVPNQGQPPYSQTPQSQSGQSPFPQSQGPTQSQGPSQGQQGSQSQPGYTHPPSGSGQPAQQQGPSQQQQGPPQSQTPSSAPPQPSQQTSGQGQPSPYSQTPPLQTQQQQQQQQQSPFQRFPPPPQELSQDSFSSQSSAPSSNQPIVSSKSGQDDTMQGRPSSLPDLSGSIDDLPTGTEGALSPGVSTSGVSSSQGEQSNPAQSPFSPHTSPHLSGIRGPSPSPVGSPASGPASRTGPLSPGTMPGNQMPPRPSSVQSDGMLHSSMGQDRVYMRNPQMPYGSPQSGSTLSPRQTSGSQMHAGMGSYPQNNSMGNYGPQSGQYGPQGYPRPPGYGGMPNANYPGGPGMGGSMNPMAGQGGGGPYGGMPPGRMGPGQMGTRPYGPGMGPNMGGMPPQVASGMCPPPGMNRKPQDPAAAGMHHGPSNSIHRPPGYPNMNQGMMGAGSPYAPPMNSMQGMMNQAGQYPMPGNMSNNSAGMAPSPEFGMDKLNQSQKLNNKVDGTPKTESKKKSSSSTTTNEKITRLYELGPEPERKLWVDRYLAFAEEKAMGMSNLPAVGRKPLDLFRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDFFNNDPKKNQAKVQPPSPAGSGSLQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQMPPMPGARSSVNLQDPFADGGDPAFSRRNSVTPNSGYQPGMGGPDMMGRMGPFEPNKDPFGGMRKAGEQFMNPGQGPNSGMGEQYNRASQGPMGNMQMGQRQQYPYGPGYDRRPDSSMGPDGNMGPQPNMMPSGADAGMYSPNRPPQQQRHDSYSNQYAGQGAPPSGPYPNQQSGMYPQQQPNYTQKRPVDGVYGPPAKRHEGDMYPFSGQQQGPQAPGAPQSQSDMYNQYNTYPGSERRPPGPQSQFPFGFGRDRGPNVGGPNSQPSMPPQMMGSSMSGTMPSVPDGPQGPMWPGRNEMNYPNYHNRQGPPGVPSQSQVYHGMNRSEDMMPSDQRMNQEGPWPGHVNQRQPPYGPVASGPPMSRPLQPNYQSSQNHIPQVSSPAPMPRPMENRTSPNKSPYMHPGMKIQKAGPPVPASHIAQPPVQPPMIRRDIAFPPGSIEASQPILKPRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSISNFNLNQLPGFLELVVEYFRRCLIEIFGILKEYEVGDPGQRTLIDPEAIDPEMSDEEGPEAEQMEEDDEDDEEDLENNTVQTSQVQIKQEKEESMESPKSNDKNELEDREGEDNSCKDHLRSSTPLQDTSASQERPKQASKFDKLPIKIMRKKDPFVIGHTSKLGRRQAFDSGLIHWSVGGGDTTEHIQTHFESKMELLKHRKRVPVNVEPRKKVSQILETVTGEAEKVQTNEGPQQVQVLASKDQPSLEGKSTTTSSTSTSITATIDDVLSARRGSATEEAVRGNQDSDKEKNTFLFGIDLAQQSRNIKILEDEPHSKDETPLCTLSDWQDALARRCICVSNIVRSLSFIPGNDLEMSKHPGLLLLLGRLVLLHHWHPERKQAPVTYEKEEEEDEGVSCERDEWWWDCLEVLRENCLVTLANISGQLDLSIYPESICLPLLDGLLHWAVCPSAEAIDPFPTLGLNGTLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYGSLVRMVGDRKVTVCREMAVVLLANLAQGDTVAARAIAVQKGSVGNLLGFLEDSLAATQFQQSQGSLLHLQGSPFEPTSVDMMRRAARALHALAKVEENHSEFTLYESRLLDISVSPLMNSLVSHVICDVLFLIGQS", "length": 2261 }, "evidence": [ { "id": "RGD:1310500", "url": "https://alliancegenome.org/gene/RGD:1310500#orthology", "database": "AGR" }, { "id": "HGNC:11110", "url": "https://alliancegenome.org/gene/HGNC:11110#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-030131-5725", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-5725#orthology", "database": "AGR" }, { "id": "MGI:1935147", "url": "https://alliancegenome.org/gene/MGI:1935147#orthology", "database": "AGR" }, { "id": "FB:FBgn0261885", "url": "https://alliancegenome.org/gene/FB:FBgn0261885#orthology", "database": "AGR" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "A0A8V0YQD7-1", "protein_name": "AT-rich interaction domain 1A", "gene_name": "ARID1A", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MAAQVVPAAASSLGAPAPAELKKAEAQQRDCPPEEAGGEAAAERGGEKQAESEGPPGKELQDAAESNGGGAGAESDLKSSNGNPGPRPAAAAATLNNNLPEPPGGGGISDGVGAPQQQQPPQQPPPSHPAALPPPAYGFGQPYGRGAQAAAAAAAAAAAAAAFHQHGGQQSPGMAALQSGGLEQSYPGPAGAPAGPPPPQNSHGGTEHGFPNHQYNSYYAAGAGRSAGSYPPPPQAYALSSPRGSAQSSAQAAAGAKSPAAAFQQQRFGVMGPSAAGGAGGGGATPQPTATPTLNQLLTSPSSARGYQGYPGGDYSGGPQDGGAAGKGPAAVDMVSQYGGGNSQGWAAAPGGAPPRSHHAPMSPGSSGGGGGGQSLGRSQQPSSPMDQMGKMRPQPYGGNNPYTQQQGPQAGPQQGHGYPGQPYGPQTPQRYPMGMQSRTQSTMGSISYAQQIPPYGQQGPNAYGQQSQTPYYNQQSPHPQQQQPPYSQQTPSQTPHSQPSYQQQQQPQSQAPQLQTSQPAYSQQQSQPPHQQSPTPYPQQQSTAQQHQQNQPPYSQQQSQSPYQQQQQTQQTASSALSQQSSSYPQSQPQQQQSAYSQQRFPPPQELSQESFGSQTSSAPSMASSKGQEDMNLNIQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYLQRNPQMPQYSSPQPGSALSPRQSSGGQMHAGMGPYQQNSMGSYGPQAGQYGPQGGYPRQPNYNALSNANYPSPGMGGSMNPMAAGSQMHGQSGVPPYSGLPPGRMSHAAMGNRPYGPNMANMPPQVGTGMCPPPGSMNRKAQEAAAAAMHAAANSIQNRPAGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYPMGGNMANNSAGMAASPEMMGLADVKLTPATKMNNKADGTPKAESKSKKSSSSTTTNEKITKLYELGGEPERKIWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYISVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQTKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQMPPLPGIRSNSVGLQDAFTDGSDPTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYSSMRKAPGSDPFMSSGQGPNSGMGDPYNRAAGPGMGNMAMGQRPHYPYGGPYDRVRTEPGMGPEGNLAAGTPQPNIMPSTSESGMYSPSRYPQQQQQQQRHDSYGNQFSTQGTSSGSPFPSQQTTMYQQQQQNYKRPMDGSYGPPAKRHEGEMYNVPYSAGQGQTQQQLPPAQTQQPSQQQAAQPSPQQDLYNQYGSTYPAADRRSAGGPQNQFPFQFGRDRVSAPPGSNAQQNMPPQMMGGPIQSAPEGPQQGAMWQGRNEIGYSYPNRQSTGSAPQGPAYHGVTRTDDILHSEQRVNHEGPWPSHGNRQPPYGPSAPVPPMTRPPQSNYQTPPSMQNHIPQVSSPAPLPRPLENRTSPSKSPFLHSGMKMQKAGPPVPASHITPAAVQPPMIRRDITFPPGSVEATQPVLKQRRRLTAKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPQRFCRSSASSHEEGEEDEELRSLNNEEEEDDEEEEEAAFSSKDKAPLECSEEKLVSKFDKLPIKIVQKNDPFVVDYSDKLGRVQEFESGLLHWRIGGGDTTEHIQTHFESKMELPMIHKRASCNSVSRKRAAAESNPSTREGEALPSDSSSEKRITATMDDMLSARPSSLSGEEEEAKASETEKESKFPFGISPAQSHRNIKILEDEPHSKDETPLCTIQDWQDSLAKRCICVSNIIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEVLRENTLVTLANISGQLDLSPYPESICLPILDGLLHWAVCPSAEAQDPFPTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTLVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQAGLMHMQNAPFESTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 2277 }, "evidence": [ { "id": "O14497", "url": "https://omabrowser.org/oma/group/O14497/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "A0ABK0M6J6-1", "protein_name": "AT-rich interaction domain 1B", "gene_name": "Arid1b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAARSAAAARARAGSCERRAPSGPRPAPGARDLETGARGAVAAAAPGPILGGGDGGLNNVHHHPLHPRHDLNMAHSASAAAAASSNSAQSGGSEAALKEGGSAAALSSSAAVAASSSSAGPGSAMETGLLPNHKLKAVGEAPAAPPHQQHHHHHAHHHHHHHAHHLHHHHHALQQQLNQFQQPPQPQQQPPPPPPQQQQHPTANNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGSQADPQGQPLLSKPGDEDDAPPKMGEPAGSRYEHPGLGAQQQPAPVAVPGGGGGGPAAVSEFNNYYGSAASASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAGAPSSMDPLQNSHEGYPNSQYNHYPGYSRPGAGGGGGGGGGGGGSGGGGGGGGAGGAGGAAAAAAAAGAGAVAAAAAAAAAAAAGGGGGGGYGGSSSGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGAAAAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPDYSSSSAPPPPSQPQSQAAAAAGAAAGGQQAAAGMGLGKDLGAQYAAASPAWAAAQQRNHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGTHPHSQPQQSSPYPGGAYGPPGAQRYPLGMQGRAPGALGGLQYPQQQMPPQYGQQGVSGYCQQGQQPYYNQQPQPSHLPPQAQYLQPQSQQRYQPQQDMSQEGYGTRAQPPLAPGKSNHEDLNLIQQERPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPGSQSESSSHPALSQSPMPQERGFMAGTQRNPQMSQYGPQQTGPSMSPHPSPGGQMHPGISNFQQSNSSGTYGPQMSQYGPQGNYSRTPTYSGVPSASYSGPGPGMGINANNQMHGQGPTQPCGAMPLGRMPSAGMQSRPFPGNMSSVPPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGSFPGMNQSGLVASSSPYSQPMNNNSNLMGTQAQPYSMTPTMVNSSTASMGLTDMMSPSESKLSVPLKADGKEEGVPQPESKSKDSYSSQGISQPPTPGNLPVPSPMSPSSASISSFHGDESDSISSPGWPKTPSSPKSSSSSTTGEKITKVYELGTEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPPPEVFSTGDAKKQPKLQPPSPANSGSLQGPQTPQSTGSSSMAEVPGDLKPPTPASTPHGQGTPMQSGRSSTVSVHDPFSDVSDSAYPKRNSMTPNAPYQQGMGMPDMMGRMPYEPNKDPFSGMRKVPGSSEPFMTQGQMPNSSMQDMYNQSPSGAMSNLGMGQRQQFPYGTSYDRRHEAYGQQYPGQGPPTGQPPYGGHQPGLYPQQPNYKRHMDGMYGPPAKRHEGDMYNMQYGSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYNRERMQGPGQMQPHGIPPQMMGGPMQSSSNEGPQQNMWATRNDMPYPYQNRQGPGGPAQAPPYPGMNRTDDMMVPDQRINHESQWPSHVSQRQPYMSSSASMQPITRPPQSSYQTPPSLPNHISRAPSPASFPRSLESRMSPSKSPFLPAMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFGILMEYEVGDPSQRALDHRTGKKDDSQSSEDDSGKEEDDAECLEEEEEEEEEEEEEEEEEEEEEEDSKKTESEGKSSSALAAPDTTADPKETPRQASKFDKLPIKIVKKNNLFVVDRSDRLGRVQEFNSGLLHWQLGGGDTTEHILTHFESKMEIPPRRRPPAPLSSTGKKKELAGKGDSEEQPEKSIIATIDDVLSARPGALPEDSNPGPQTESGKFPFGIQQAKSHRNIRLLEDEPRSRDETPLCTIAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYATLVRYVGDRKNPVCREMSMALLSNLAQGDTLAARAIAVQKGSIGNLIGFLEDGVTMAQYQQSQHTLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNSLVASVICDVLFQIGQL", "length": 2375 }, "evidence": [ { "id": "FB:FBgn0261885", "url": "https://alliancegenome.org/gene/FB:FBgn0261885#orthology", "database": "AGR" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "A2BH40-1", "protein_name": "AT-rich interactive domain-containing protein 1A", "gene_name": "Arid1a", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAQVAPAAASSLGNPPPPPSELKKAEQQQREEAGGEAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLPEPPGGGGGGGSSSSDGVGAPPHSAAAALPPPAYGFGQAYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPPQAYALSSPRGGTPGSGAAAAAGSKPPPSSSASASSSSSSFAQQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYGGGPQDGGAGKGPADMASQCWGAAAAAAAAAAAVSGGAQQRSHHAPMSPGSSGGGGQPLARTPQSSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGSLSYAQQIPPYGQQGPSAYGQQGQTPYYNQQSPHPQQQPPYAQQPPSQTPHAQPSYQQQPQTQQPQLQSSQPPYSQQPSQPPHQQSPTPYPSQQSTTQQHPQSQPPYSQPQAQSPYQQQQPQQPASSSLSQQAAYPQPQPQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYTSPQPGSALSPRQPSGGQMHSGVGSYQQNSMGSYGPQGSQYGPQGGYPRQPNYNALPNANYPNAGMAGSMNPMGAGGQMHGQPGIPPYGTLPPGRMAHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQESAVAMHVAANSIQNRPPGYPNMNQGGMMGTGPPYGQGINSMAGMINPQGPPYPMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFPDGSDPTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGSVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMGTGAPQPNLMPSTPDSGMYSPSRYPPQQQQQQQQQHDSYGNQFSTQGTPSSSPFPSQQTTMYQQQQQNYKRPMDGTYGPPAKRHEGEMYSVPYSAGQGQPQQQQLPAAQSQPASQPQAAQPSPQQDVYNQYSNAYPASATAATDRRPAGGPQNQFPFQFGRDRVSAPPGSSAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQNTGSATQGPAYHGVNRTDEMLHTDQRANHEGPWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMPNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPTPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRFTKVYSPAHTEEEEEEHLDPKLEEEEEEGVGNDEEMAFLGKDKPSSENNEEKLVSKFDKLPVKIVQRNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKIELLPSRPYVPCPTPPRKHLTTVEGTPGTTEQEGPPPDGLPEKRITATMDDMLSTRSSTLTDEGAKSAEATKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCDKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 2283 }, "evidence": [ { "id": "RGD:1310500", "url": "https://alliancegenome.org/gene/RGD:1310500#orthology", "database": "AGR" }, { "id": "HGNC:11110", "url": "https://alliancegenome.org/gene/HGNC:11110#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-080220-35", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-080220-35#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-030131-5725", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-5725#orthology", "database": "AGR" }, { "id": "MGI:1935147", "url": "https://alliancegenome.org/gene/MGI:1935147#orthology", "database": "AGR" }, { "id": "FB:FBgn0261885", "url": "https://alliancegenome.org/gene/FB:FBgn0261885#orthology", "database": "AGR" }, { "id": "O14497", "url": "https://omabrowser.org/oma/group/O14497/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "D4A3E3-1", "protein_name": "AT-rich interaction domain 1A", "gene_name": "Arid1a", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAQVAPAAASSLGNPPPPPSELKKAEQQQREEAGGEAAAAAAERGEMKAAAGQESEGPAVGPPQPLGKELQDGAESNGGGGGGGAGSGGGPGAEPDLKNSNGNAGPRPALNNNLTEPPGGGGGSSDGVGAPPHSAAAALPPPAYGFGQPYGRSPSAVAAAAAAVFHQQHGGQQSPGLAALQSGGGGGLEPYAGPQQNSHDHGFPNHQYNSYYPNRSAYPPPPQAYALSSPRGGTPGSGAAAAGSKPPPSSSASASSSSSSFAPQRFGAMGGGGPSAAGGGTPQPTATPTLNQLLTSPSSARGYQGYPGGDYGGGPQDGGAGKGPADMASQCWGAAAAAAAAAAASGGAQQRSHHAPMSPGSSGGGGQPLARTPQSSSPMDQMGKMRPQPYGGTNPYSQQQGPPSGPQQGHGYPGQPYGSQTPQRYPMTMQGRAQSAMGSLSYAQQIPPYGQQGPSAYGQQGQTPYYNQQSPHPQQQQQPPYSQQPPSQTPHAQPSYQQQPQTQQPQLQSSQPPYSQQPSQPPHQQSQTPYPSQQSTTQQHPQSQPPYSQPQAQAPYQQQQPQQPASSTLSQQAAYPQPQPQQSQQTAYSQQRFPPPQELSQDSFGSQASSAPSMTSSKGGQEDMNLSLQSRPSSLPDLSGSIDDLPMGTEGALSPGVSTSGISSSQGEQSNPAQSPFSPHTSPHLPGIRGPSPSPVGSPASVAQSRSGPLSPAAVPGNQMPPRPPSGQSDSIMHPSMNQSSIAQDRGYMQRNPQMPQYTSPQPGSALSPRQPSGGQMHSGMGSYQQNSMGSYGPQGSQYGPQGGYPRQPNYNALPNANYPSAGMAGSMNPLGAGGQMHGQPGIPPYGTLPPGRMTHASMGNRPYGPNMANMPPQVGSGMCPPPGGMNRKTQESAVAMHVAANSIQNRPPGYPNMNQGGIMGTGPPYGQGINSMAGMINPQGPPYPMGGTMANNSAGMAASPEMMGLGDVKLTPATKMNNKADGTPKTESKSKKSSSSTTTNEKITKLYELGGEPERKMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYRLYVSVKEIGGLTQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQCLYAFECKIERGEDPPPDIFAAADSKKSQPKIQPPSPAGSGSMQGPQTPQSTSSSMAEGGDLKPPTPASTPHSQIPPLPGMSRSNSVGIQDAFPDGSEPTFQKRNSMTPNPGYQPSMNTSDMMGRMSYEPNKDPYGGMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMGTGAPQPNLMPSTPDSGMYSPSRYPPQQQQQQQQQQQQQQQQQQRHDSYGNQFSTQGTPSSSPFPSQQTTMYQQQQQQNYKRPMDGTYGPPAKRHEGELYSVPYSTGQGQPQQQQLPAAQSQSASQPQAAQPSPQQDVYNQYSNAYPATATAATERRPAGGPQNQFPFQFGRDRVSAPPGSNAQQNMPPQMMGGPIQASAEVAQQGTMWQGRNDMTYNYANRQNTGSAPQGPAYHGVNRTDEMLHTDQRANHEGPWPSHGTRQPPYGPSAPVPPMTRPPPSNYQPPPSMQNHIPQVSSPAPLPRPMENRTSPSKSPFLHSGMKMQKAGPPVPASHIAPTPVQPPMIRRDITFPPGSVEATQPVLKQRRRLTMKDIGTPEAWRVMMSLKSGLLAESTWALDTINILLYDDNSIMTFNLSQLPGLLELLVEYFRRCLIEIFGILKEYEVGDPGQRTLLDPGRLTKVSSPAPTEEEEEEEHVDPKLEEEEEEGVENDEEMAFLGKDKPPSEKSEEKLVSKFDKLPVKIVQKNDPFVVDCSDKLGRVQEFDSGLLHWRIGGGDTTEHIQTHFESKIELLPSRPCVPSPVPPRKHVTTVEGTPGTTEQEGPPPDGLPEKRITATMDDMLSTRSSTLTDEGTKSTEANKESSKFPFGISPAQSHRNIKILEDEPHSKDETPLCTLLDWQDSLAKRCVCVSNAIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCDKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQSPPFEPTSVDMMRRAARALLALAKVDENHSEFTLYESRLLDISVSPLMNSLVSQVICDVLFLIGQS", "length": 2291 }, "evidence": [ { "id": "RGD:1310500", "url": "https://alliancegenome.org/gene/RGD:1310500#orthology", "database": "AGR" }, { "id": "HGNC:11110", "url": "https://alliancegenome.org/gene/HGNC:11110#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-080220-35", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-080220-35#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-030131-5725", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-5725#orthology", "database": "AGR" }, { "id": "MGI:1935147", "url": "https://alliancegenome.org/gene/MGI:1935147#orthology", "database": "AGR" }, { "id": "FB:FBgn0261885", "url": "https://alliancegenome.org/gene/FB:FBgn0261885#orthology", "database": "AGR" }, { "id": "O14497", "url": "https://omabrowser.org/oma/group/O14497/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "E9Q4N7-1", "protein_name": "AT-rich interactive domain-containing protein 1B", "gene_name": "Arid1b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAARAAAAARARAGSGERRAPSGPRPAPGARDLETGARGAVAAPGPILGGGDGGLNNVHHHPLHPRHDLNMAHSASAAAAASSNSAQSGRSEAALKEGGSAAALSSSAAVAASSSSAGPGSTMETGLLPNHKLKAVGEAPAAPPHQQHHHHHAHHHHHHHAHHLHHLHHHHALQQQLNQFQQPQPPQPQQQQPPPPPQQQHPTANNSLGGAGGGAPQPGPDMEQPQHGGAKDSVAGNQADPQGQPLLSKPGDEDDAPPKMGEPAGSRYEHPGLGAQQQPAPVAVPGGGGGPAAVSEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAGAPSSMDPLQNSHEGYPNSQYNHYPGYSRPGAGGGGGGGGGGGGSGGGGGGGGAGGAGGAAAAAAGAGAVAAAAAAAAAAAAAAGGGGGGGYGSSSSGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGAAAAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPDYSSSSAPPPPSQPQSQAAAGAAAGGQQAAAGMGLGKDLGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGTHPHSQPQQSSPYPGGSYGPPGAQRYPLGMQGRAPGALGGLQYPQQQMPPQYGQQAVSGYCQQGQQPYYNQQPQPSHLPPQAQYLQPAAAQSQQRYQPQQDMSQEGYGTRSQPPLAPGKSNHEDLNLIQQERPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPGSQSESSSHPALSQSPMPQERGNYSRTPTYSGVPSASYSGPGPGMGINANNQMHGQGPAQPCGAMPLGRMPSAGMQNRPFPGTMSSVTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGSFPGMNQSGLVASSSPYSQSMNNNSSLMSTQAQPYSMTPTMVNSSTASMGLADMMSPSESKLSVPLKADGKEEGVSQPESKSKDSYGSQGISQPPTPGNLPVPSPMSPSSASISSFHGDESDSISSPGWPKTPSSPKSSSSSTTGEKITKVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKTERGEEPPPEVFSTGDSKKQPKLQPPSPANSGSLQGPQTPQSTGSNSMAEVPGDLKPPTPASTPHGQMTPMQSGRSSTVSVHDPFSDVSDSAYPKRNSMTPNAPYQQGMGMPDMMGRMPYEPNKDPFSGMRKVPGSSEPFMTQGQVPNSGMQDMYNQSPSGAMSNLGMGQRQQFPYGTSYDRRHEAYGQQYPGQGPPTGQPPYGGHQPGLYPQQPNYKRHMDGMYGPPAKRHEGDMYNMQYGSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYNRERMQGPGQMQPHGIPPQMMGGPMQSSSSEGPQQNMWATRNDMPYPYQSRQGPGGPAQAPPYPGMNRTDDMMVPEQRINHESQWPSHVSQRQPYMSSSASMQPITRPPQSSYQTPPSLPNHISRAPSPASFQRSLESRMSPSKSPFLPTMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPILKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFGILMEYEVGDPSQKALDHRSGKKDDSQSLEDDSGKEDDDAECLVEEEEEEEEEEEDSEKIESEGKSSPALAAPDASVDPKETPKQASKFDKLPIKIVKKNKLFVVDRSDKLGRVQEFSSGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPLSSTGKKKELEGKGDSEEQPEKSIIATIDDVLSARPGALPEDTNPGPQTDSGKFPFGIQQAKSHRNIRLLEDEPRSRDETPLCTIAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYATLVRYVGDRKNPVCREMSMALLSNLAQGDTLAARAIAVQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNSLVASVICDVLFQIGQL", "length": 2306 }, "evidence": [ { "id": "FB:FBgn0261885", "url": "https://alliancegenome.org/gene/FB:FBgn0261885#orthology", "database": "AGR" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8IN94-1", "protein_name": "Trithorax group protein osa", "gene_name": "osa", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MNEKIKSPQTQQQQQGGAPAPAATPPSAGAAPGAATPPTSGPPTPNNNSNNGSDPSIQQQQQNVAPHPYGAPPPPGSGPGGPPGPDPAAVMHYHHLHQQQQQHPPPPHMQQQQHHGGPAPPPPGGAPEHAPGVKEEYTHLPPPHPHPAYGRYHADPNMDPYRYGQPLPGGKPPQQQQPHPQQQPPQQPGPGGSPNRPPQQRYIPGQPPQGPTPTLNSLLQSSNPPPPPQHRYANTYDPQQAAASAAAAAAAQQQQAGGPPPPGHGPPPPQHQPSPYGGQQGGWAPPPRPYSPQLGPSQQYRTPPPTNTSRGQSPYPPAHGQNSGSYPSSPQQQQQQQQQQQQQAGQQPGGPVPGGPPPGTGQQPPQQNTPPTSQYSPYPQRYPTPPGLPAGGSNHRTAYSTHQYPEPNRPWPGGSSPSPGSGHPLPPASPHHVPPLQQQPPPPPHVSAGGPPPSSSPGHAPSPSPQPSQASPSPHQELIGQNSNDSSSGGAHSGMGSGPPGTPNPQQVMRPTPSPTGSSGSRSMSPAVAQNHPISRPASNQSSSGGPMQQPPVGAGGPPPMPPHPGMPGGPPQQQQSQQQQASNSASSASNSPQQTPPPAPPPNQGMNNMATPPPPPQGAAGGGYPMPPHMHGGYKMGGPGQSPGAQGYPPQQPQQYPPGNYPPRPQYPPGAYATGPPPPPTSQAGAGGANSMPSGAQAGGYPGRGMPNHTGQYPPYQWVPPSPQQTVPGGAPGGAMVGNHVQGKGTPPPPVVGGPPPPQGSGSPRPLNYLKQHLQHKGGYGGSPTPPQGPQGYGNGPTGMHPGMPMGPPHHMGPPHGPTNMGPPTSTPPQSQMLQGGQPQGQGASGGPESGGPEHISQDNGISSSGPTGAAGMHAVTSVVTTGPDGTSMDEVSQQSTLSNASAASGEDPQCTTPKSRKNDPYSQSHLAPPSTSPHPVVMHPGGGPGEEYDMSSPPNWPRPAGSPQVFNHVPVPQEPFRSTITTTKKSDSLCKLYEMDDNPDRRGWLDKLRAFMEERRTPITACPTISKQPLDLYRLYIYVKERGGFVEVTKSKTWKDIAGLLGIGASSSAAYTLRKHYTKNLLTFECHFDRGDIDPLPIIQQVEAGSKKKTAKAASVPSPGGGHLDAGTTNSTGSSNSQDSFPAPPGSAPNAAIDGYPGYPGGSPYPVASGPQPDYATAGQMQRPPSQNNPQTPHPGAAAAVAAGDNISVSNPFEDPIAAGGGPGSGTGPGPGQGPGPGAASGGAGAVGAVGGGPQPHPPPPHSPHTAAQQAAGQHQQQHPQHQHPGLPGPPPPQQQQGQQGQQPPPSVGGGPPPAPQQHGPGQVPPSPQQHVRPAAGAPYPPGGSGYPTPVSRTPGSPYPSQPGAYGQYGSSDQYNATGPPGQPFGQGPGQYPPQNRNMYPPYGPEGEAPPTGANQYGPYGSRPYSQPPPGGPQPPTQTVAGGPPAGGAPGAPPSSAYPTGRPSQQDYYQPPPDQSPQPRRHPDFIKDSQPYPGYNARPQIYGAWQSGTQQYRPQYPSSPAPQNWGGAPPRGAAPPPGAPHGPPIQQPAGVAQWDQHRYPPQQGPPPPPQQQQQPQQQQQQPPYQQVAGPPGQQPPQAPPQWAQMNPGQTAQSGIAPPGSPLRPPSGPGQQNRMPGMPAQQQQSQQQGGVPQPPPQQASHGGVPSPGLPQVGPGGMVKPPYAMPPPPSQGVGQQVGQGPPGGMMSQKPPPMPGQAMQQQPLQQQPPSHQHPHPHQHPQHQHPHQMPPNQTAPGGYGPPGMPGGGAQLVKKELIFPHDSVESTTPVLYRRKRLMKADVCPVDPWRIFMAMRSGLLTECTWALDVLNVLLFDDSTVQFFGISNLPGLLTLLLEHFQKNLAEMFDERENEEQSALLAEDADDDADSGTVMCEKLRTSGRQPRCVRSISSYNRRRHYENMDRSGKDGAGNGSDSEDADEGIDLGQVRVQPNPEERSLLLSFTPNYTMVTRKGVPVRIQPAENDIFVDERQKAWDIDTNRLYEQLEPVGSDAWTYGFTEPDPLDGIIDVFKSEIVNIPFARYIRSDKKGRKRTELASSSRKPEIKTEENSTEEQTFNKKRRLVSGGSSSSGAHAEGKKSKLTSEEFAQPNAEVKKEPGTADSDCRPVDMDIEAPQQRLTNGVAPCSSTPAIFDPRTTAKDEARVLQRRRDSSFEDECYTRDEASLHLVSESQDSLARRCIALSNIFRNLTFVPGNETVLAKSTRFLAVLGRLLLLNHEHLRRTPKTRNYDREEDTDFSDSCSSLQGEREWWWDYLITIRENMLVAMANIAGHLELSRYDELIARPLIDGLLHWAVCPSAHGQDPFPSCGPNSVLSPQRLALEALCKLCVTDANVDLVIATPPFSRLEKLCAVLTRHLCRNEDQVLREFSVNLLHYLAAADSAMARTVALQSPCISYLVAFIEQAEQTALGVANQHGINYLRENPDSMGTSLDMLRRAAGTLLHLAKHPDNRSLFMQQEQRLLGLVMSHILDQQVALIISRVLYQVSRGTGPIHSVEFRLLQQRQQQQLRPGPAGKQAASAGGSATVKAETASTETSSTEAKPAPAATTAVVNDENSNSSQQLPPAATFNDVSNSSTNSNSCGTASSNQTNNSTTNSSHSSSAISSQSAITVAAPSAAATGAGSATAAAIASDQQQVSKVAAAAAAAAALSNASAAAAAAAAAAAASVGPPTSSSVSAGAAVAQPAAPPPTNAGTTTAVA", "length": 2716 }, "evidence": [ { "id": "RGD:1310500", "url": "https://alliancegenome.org/gene/RGD:1310500#orthology", "database": "AGR" }, { "id": "HGNC:11110", "url": "https://alliancegenome.org/gene/HGNC:11110#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-080220-35", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-080220-35#orthology", "database": "AGR" }, { "id": "ZFIN:ZDB-GENE-030131-5725", "url": "https://alliancegenome.org/gene/ZFIN:ZDB-GENE-030131-5725#orthology", "database": "AGR" }, { "id": "MGI:1935147", "url": "https://alliancegenome.org/gene/MGI:1935147#orthology", "database": "AGR" }, { "id": "FB:FBgn0261885", "url": "https://alliancegenome.org/gene/FB:FBgn0261885#orthology", "database": "AGR" }, { "id": "O14497", "url": "https://omabrowser.org/oma/group/O14497/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8NFD5-5", "protein_name": "AT-rich interactive domain-containing protein 1B", "gene_name": "ARID1B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MAARAAAAAAAAAARARARAGSGERRAPPGPRPAPGARDLEAGARGAAAAAAAPGPMLGGGGDGGGGLNSVHHHPLLPRHELNMAHNAGAAAAAGTHSAKSGGSEAALKEGGSAAALSSSSSSSAAAAAASSSSSSGPGSAMETGLLPNHKLKTVGEAPAAPPHQQHHHHHHAHHHHHHAHHLHHHHALQQQLNQFQQQQQQQQQQQQQQQQQQHPISNNNSLGGAGGGAPQPGPDMEQPQHGGAKDSAAGGQADPPGPPLLSKPGDEDDAPPKMGEPAGGRYEHPGLGALGTQQPPVAVPGGGGGPAAVPEFNNYYGSAAPASGGPGGRAGPCFDQHGGQQSPGMGMMHSASAAAAGAPGSMDPLQNSHEGYPNSQCNHYPGYSRPGAGGGGGGGGGGGGGSGGGGGGGGAGAGGAGAGAVAAAAAAAAAAAGGGGGGGYGGSSAGYGVLSSPRQQGGGMMMGPGGGGAASLSKAAAGSAAGGFQRFAGQNQHPSGATPTLNQLLTSPSPMMRSYGGSYPEYSSPSAPPPPPSQPQSQAAAAGAAAGGQQAAAGMGLGKDMGAQYAAASPAWAAAQQRSHPAMSPGTPGPTMGRSQGSPMDPMVMKRPQLYGMGSNPHSQPQQSSPYPGGSYGPPGPQRYPIGIQGRTPGAMAGMQYPQQQMPPQYGQQGVSGYCQQGQQPYYSQQPQPPHLPPQAQYLPSQSQQRYQPQQDMSQEGYGTRSQPPLAPGKPNHEDLNLIQQERPSSLPDLSGSIDDLPTGTEATLSSAVSASGSTSSQGDQSNPAQSPFSPHASPHLSSIPGGPSPSPVGSPVGSNQSRSGPISPASIPGSQMPPQPPGSQSESSSHPALSQSPMPQERGFMAGTQRNPQMAQYGPQQTGPSMSPHPSPGGQMHAGISSFQQSNSSGTYGPQMSQYGPQGNYSRPPAYSGVPSASYSGPGPGMGISANNQMHGQGPSQPCGAVPLGRMPSAGMQNRPFPGNMSSMTPSSPGMSQQGGPGMGPPMPTVNRKAQEAAAAVMQAAANSAQSRQGSFPGMNQSGLMASSSPYSQPMNNSSSLMNTQAPPYSMAPAMVNSSAASVGLADMMSPGESKLPLPLKADGKEEGTPQPESKSKKSSSSTTTGEKITKVYELGNEPERKLWVDRYLTFMEERGSPVSSLPAVGKKPLDLFRLYVCVKEIGGLAQVNKNKKWRELATNLNVGTSSSAASSLKKQYIQYLFAFECKIERGEEPPPEVFSTGDTKKQPKLQPPSPANSGSLQGPQTPQSTGSNSMAEVPGDLKPPTPASTPHGQMTPMQGGRSSTISVHDPFSDVSDSSFPKRNSMTPNAPYQQGMSMPDVMGRMPYEPNKDPFGGMRKVPGSSEPFMTQGQMPNSSMQDMYNQSPSGAMSNLGMGQRQQFPYGASYDRRHEPYGQQYPGQGPPSGQPPYGGHQPGLYPQQPNYKRHMDGMYGPPAKRHEGDMYNMQYSSQQQEMYNQYGGSYSGPDRRPIQGQYPYPYSRERMQGPGQIQTHGIPPQMMGGPLQSSSSEGPQQNMWAARNDMPYPYQNRQGPGGPTQAPPYPGMNRTDDMMVPDQRINHESQWPSHVSQRQPYMSSSASMQPITRPPQPSYQTPPSLPNHISRAPSPASFQRSLENRMSPSKSPFLPSMKMQKVMPTVPTSQVTGPPPQPPPIRREITFPPGSVEASQPVLKQRRKITSKDIVTPEAWRVMMSLKSGLLAESTWALDTINILLYDDSTVATFNLSQLSGFLELLVEYFRKCLIDIFGILMEYEVGDPSQKALDHNAARKDDSQSLADDSGKEEEDAECIDDDEEDEEDEEEDSEKTESDEKSSIALTAPDAAADPKEKPKQASKFDKLPIKIVKKNNLFVVDRSDKLGRVQEFNSGLLHWQLGGGDTTEHIQTHFESKMEIPPRRRPPPPLSSAGRKKEQEGKGDSEEQQEKSIIATIDDVLSARPGALPEDANPGPQTESSKFPFGIQQAKSHRNIKLLEDEPRSRDETPLCTIAHWQDSLAKRCICVSNIVRSLSFVPGNDAEMSKHPGLVLILGKLILLHHEHPERKRAPQTYEKEEDEDKGVACSKDEWWWDCLEVLRDNTLVTLANISGQLDLSAYTESICLPILDGLLHWMVCPSAEAQDPFPTVGPNSVLSPQRLVLETLCKLSIQDNNVDLILATPPFSRQEKFYATLVRYVGDRKNPVCREMSMALLSNLAQGDALAARAIAVQKGSIGNLISFLEDGVTMAQYQQSQHNLMHMQPPPLEPPSVDMMCRAAKALLAMARVDENRSEFLLHEGRLLDISISAVLNSLVASVICDVLFQIGQL", "length": 2319 }, "evidence": [ { "id": "FB:FBgn0261885", "url": "https://alliancegenome.org/gene/FB:FBgn0261885#orthology", "database": "AGR" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "positive regulation of stem cell population maintenance", "id": "GO:1902459", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902459", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "regulation of nucleotide-excision repair", "id": "GO:2000819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000819", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "nervous system development", "id": "GO:0007399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007399", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "positive regulation of cell differentiation", "id": "GO:0045597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045597", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "transcription initiation-coupled chromatin remodeling", "id": "GO:0045815", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045815", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "regulation of mitotic metaphase/anaphase transition", "id": "GO:0030071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030071", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "nucleosome disassembly", "id": "GO:0006337", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006337", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "positive regulation of double-strand break repair", "id": "GO:2000781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000781", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "positive regulation of T cell differentiation", "id": "GO:0045582", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045582", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "regulation of G1/S transition of mitotic cell cycle", "id": "GO:2000045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000045", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "positive regulation of myoblast differentiation", "id": "GO:0045663", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045663", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "regulation of G0 to G1 transition", "id": "GO:0070316", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070316", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "nuclear receptor binding", "id": "GO:0016922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016922", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "SWI/SNF complex", "id": "GO:0016514", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016514", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "npBAF complex", "id": "GO:0071564", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071564", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "nBAF complex", "id": "GO:0071565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071565", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" }, { "name": "brahma complex", "id": "GO:0035060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035060", "evidence": [ { "database": "UniProtKB", "id": "O14497", "url": "https://www.uniprot.org/uniprotkb/O14497" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 116, "end_pos": 118, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1216, "end_pos": 1218, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1299, "end_pos": 1301, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1527, "end_pos": 1529, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1597, "end_pos": 1599, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1705, "end_pos": 1707, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2066, "end_pos": 2068, "annotation": "n_glycosylation_sequon" }, { "start_pos": 218, "end_pos": 220, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2247, "end_pos": 2249, "annotation": "n_glycosylation_sequon" }, { "start_pos": 629, "end_pos": 631, "annotation": "n_glycosylation_sequon" }, { "start_pos": 742, "end_pos": 744, "annotation": "n_glycosylation_sequon" }, { "start_pos": 956, "end_pos": 958, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [ { "pdb_id": "AF-O14497-F1", "pdb_chain": "global", "start_pos": 1, "end_pos": 2285, "overlap": "1.0", "method": "AlphaFold", "type": "alphafold", "resolution": -1.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/AF-O14497-F1.pdb", "url_external": "https://alphafold.ebi.ac.uk/entry/O14497" }, { "pdb_id": "1ryu", "pdb_chain": "a", "start_pos": 1000, "end_pos": 1119, "overlap": "0.05", "method": "NMR_Spectroscopy", "type": "experimental", "resolution": 100.0, "url": "https://data.glygen.org/ln2downloads/pdb/current/1ryu.pdb", "url_external": "https://www.rcsb.org/structure/1ryu" } ], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "id": "PRU00355", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00355" }, { "id": "A0A1B0GTU5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GTU5" }, { "id": "PS51011", "database": "PROSITE", "url": "https://prosite.expasy.org/PS51011" }, { "id": "H0Y488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/H0Y488" }, { "id": "A0ABJ7H312", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABJ7H312" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "ARID", "eco_id": "ECO_0000255", "start_pos": 1017, "end_pos": 1108, "start_aa": "Glu", "end_aa": "Glu", "glycosite_overlap": "Ser1090,Ser1091" }, { "evidence": [ { "id": "O14497", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O14497" }, { "id": "26614907", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26614907" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "Nuclear localization signal", "eco_id": "ECO_0000269", "start_pos": 1368, "end_pos": 1387, "start_aa": "Asn", "end_aa": "Glu", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.agr", "label": "AGR Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 58, 128, 129, 138, 220, 238, 241, 249, 254, 255, 256, 258, 260, 261, 262, 264, 265, 637, 696, 705, 709, 711, 762, 763, 764, 1090, 1091, 1180, 1235, 1242, 1348, 1350, 1352, 1356, 1414, 1577, 1888, 2262 ], "snv_sites": [ 2, 5, 10, 11, 14, 16, 17, 21, 22, 28, 29, 38, 42, 44, 46, 47, 50, 53, 54, 56, 58, 59, 62, 63, 66, 67, 71, 72, 74, 78, 85, 87, 89, 90, 91, 94, 95, 98, 99, 103, 104, 105, 106, 108, 109, 112, 118, 119, 120, 122, 124, 125, 126, 128, 129, 130, 131, 136, 137, 138, 140, 144, 148, 152, 153, 154, 156, 158, 161, 162, 163, 164, 165, 166, 171, 172, 173, 174, 176, 177, 178, 179, 180, 183, 185, 186, 187, 189, 191, 192, 193, 194, 198, 200, 201, 202, 203, 204, 208, 211, 212, 214, 215, 216, 217, 219, 220, 222, 226, 227, 229, 236, 237, 238, 239, 241, 243, 245, 246, 247, 248, 250, 252, 253, 254, 255, 256, 258, 260, 261, 262, 264, 265, 266, 268, 269, 275, 276, 280, 281, 285, 286, 288, 289, 290, 291, 292, 293, 294, 295, 297, 301, 303, 304, 309, 312, 313, 315, 316, 317, 320, 321, 322, 323, 325, 334, 335, 336, 337, 339, 340, 341, 342, 343, 344, 349, 350, 351, 352, 354, 355, 356, 357, 360, 365, 370, 372, 373, 375, 377, 379, 380, 381, 383, 384, 385, 386, 387, 388, 389, 393, 394, 395, 396, 399, 401, 403, 404, 405, 407, 408, 409, 410, 411, 412, 413, 414, 416, 420, 421, 423, 425, 426, 427, 428, 431, 433, 435, 437, 438, 439, 441, 443, 444, 447, 449, 450, 452, 453, 454, 456, 457, 458, 459, 461, 462, 463, 464, 467, 469, 471, 472, 473, 474, 478, 479, 480, 481, 482, 486, 487, 489, 490, 491, 492, 494, 495, 497, 499, 500, 501, 502, 503, 505, 507, 508, 509, 510, 512, 514, 515, 517, 520, 521, 522, 523, 524, 526, 528, 529, 531, 533, 534, 536, 537, 538, 539, 540, 542, 543, 545, 546, 548, 550, 551, 552, 553, 555, 557, 558, 559, 560, 561, 562, 563, 564, 566, 567, 569, 570, 571, 572, 573, 575, 576, 577, 581, 582, 583, 584, 585, 586, 588, 589, 592, 593, 594, 595, 596, 598, 599, 600, 601, 602, 605, 607, 610, 611, 614, 616, 617, 618, 619, 620, 622, 623, 624, 626, 628, 629, 633, 634, 636, 637, 640, 641, 645, 647, 648, 649, 650, 651, 652, 653, 654, 655, 656, 659, 660, 661, 662, 664, 665, 666, 668, 670, 671, 672, 673, 674, 676, 678, 680, 683, 684, 687, 690, 692, 693, 696, 697, 698, 699, 701, 703, 704, 705, 708, 709, 710, 711, 715, 718, 720, 722, 723, 726, 727, 732, 733, 734, 735, 737, 739, 740, 741, 743, 744, 745, 747, 748, 750, 754, 755, 758, 759, 761, 762, 763, 764, 766, 769, 770, 772, 773, 774, 776, 778, 779, 780, 784, 787, 789, 790, 791, 794, 796, 797, 798, 799, 800, 802, 803, 806, 809, 812, 815, 816, 817, 819, 820, 822, 823, 824, 825, 830, 835, 836, 837, 838, 840, 842, 844, 848, 849, 850, 854, 855, 856, 860, 861, 863, 864, 865, 866, 867, 868, 869, 870, 872, 873, 874, 875, 876, 878, 881, 882, 883, 884, 886, 889, 892, 894, 895, 896, 898, 900, 904, 908, 909, 911, 912, 915, 917, 918, 919, 920, 922, 923, 924, 925, 927, 929, 930, 931, 934, 935, 936, 937, 938, 939, 940, 941, 943, 944, 945, 946, 948, 949, 951, 952, 955, 956, 957, 959, 960, 961, 965, 966, 967, 969, 972, 974, 975, 981, 983, 985, 986, 989, 992, 995, 996, 997, 999, 1000, 1001, 1002, 1004, 1006, 1007, 1010, 1011, 1013, 1015, 1017, 1019, 1020, 1021, 1023, 1025, 1027, 1028, 1031, 1032, 1035, 1037, 1042, 1043, 1044, 1045, 1046, 1048, 1049, 1050, 1051, 1052, 1053, 1054, 1055, 1057, 1058, 1060, 1061, 1062, 1063, 1065, 1066, 1067, 1072, 1073, 1074, 1077, 1081, 1083, 1085, 1089, 1090, 1091, 1092, 1094, 1095, 1096, 1098, 1100, 1102, 1104, 1105, 1106, 1108, 1109, 1110, 1111, 1112, 1114, 1115, 1117, 1118, 1122, 1123, 1124, 1125, 1126, 1127, 1129, 1131, 1133, 1135, 1136, 1138, 1139, 1142, 1143, 1144, 1145, 1147, 1148, 1149, 1150, 1151, 1153, 1154, 1156, 1157, 1158, 1160, 1165, 1166, 1167, 1169, 1170, 1171, 1172, 1173, 1175, 1179, 1180, 1182, 1184, 1186, 1188, 1193, 1194, 1195, 1196, 1197, 1200, 1202, 1203, 1206, 1209, 1210, 1211, 1212, 1213, 1215, 1217, 1219, 1220, 1221, 1222, 1223, 1224, 1225, 1226, 1227, 1230, 1232, 1233, 1234, 1235, 1236, 1237, 1239, 1242, 1243, 1244, 1246, 1248, 1250, 1253, 1255, 1259, 1262, 1263, 1265, 1266, 1272, 1273, 1274, 1276, 1277, 1278, 1279, 1280, 1281, 1283, 1284, 1285, 1287, 1288, 1290, 1291, 1292, 1293, 1296, 1297, 1298, 1300, 1302, 1305, 1306, 1307, 1308, 1309, 1312, 1313, 1316, 1317, 1319, 1320, 1321, 1323, 1324, 1325, 1326, 1327, 1328, 1329, 1330, 1331, 1332, 1333, 1335, 1337, 1338, 1339, 1342, 1343, 1345, 1346, 1348, 1349, 1350, 1351, 1352, 1353, 1355, 1356, 1357, 1358, 1359, 1361, 1362, 1363, 1364, 1365, 1366, 1367, 1369, 1371, 1372, 1373, 1374, 1375, 1376, 1377, 1380, 1381, 1382, 1383, 1384, 1385, 1387, 1389, 1390, 1392, 1393, 1394, 1396, 1397, 1399, 1400, 1401, 1402, 1403, 1404, 1405, 1406, 1409, 1411, 1414, 1415, 1416, 1417, 1419, 1420, 1422, 1424, 1425, 1426, 1428, 1430, 1434, 1435, 1436, 1439, 1440, 1441, 1444, 1445, 1446, 1447, 1450, 1452, 1455, 1456, 1457, 1458, 1460, 1461, 1463, 1464, 1465, 1466, 1473, 1474, 1475, 1477, 1478, 1481, 1483, 1484, 1485, 1486, 1487, 1488, 1490, 1491, 1493, 1494, 1495, 1496, 1497, 1498, 1499, 1500, 1501, 1503, 1504, 1505, 1507, 1508, 1509, 1511, 1512, 1513, 1514, 1515, 1517, 1518, 1519, 1520, 1521, 1522, 1524, 1526, 1527, 1528, 1531, 1535, 1536, 1537, 1539, 1540, 1542, 1543, 1544, 1545, 1546, 1547, 1549, 1550, 1551, 1552, 1554, 1556, 1557, 1558, 1560, 1562, 1563, 1564, 1566, 1568, 1569, 1570, 1572, 1573, 1575, 1577, 1578, 1579, 1582, 1583, 1584, 1586, 1590, 1593, 1595, 1596, 1598, 1599, 1600, 1601, 1602, 1605, 1609, 1610, 1611, 1612, 1614, 1616, 1618, 1619, 1623, 1629, 1631, 1632, 1633, 1636, 1637, 1638, 1642, 1646, 1647, 1648, 1650, 1651, 1654, 1655, 1656, 1657, 1658, 1661, 1663, 1664, 1668, 1670, 1672, 1673, 1683, 1686, 1688, 1689, 1690, 1698, 1701, 1703, 1704, 1705, 1706, 1708, 1709, 1711, 1712, 1713, 1714, 1718, 1719, 1720, 1721, 1722, 1724, 1726, 1731, 1732, 1733, 1735, 1737, 1739, 1740, 1741, 1742, 1743, 1747, 1749, 1750, 1751, 1752, 1756, 1757, 1759, 1760, 1761, 1763, 1764, 1765, 1766, 1767, 1769, 1770, 1771, 1774, 1775, 1776, 1777, 1778, 1779, 1780, 1781, 1783, 1784, 1785, 1786, 1787, 1789, 1791, 1792, 1793, 1795, 1796, 1798, 1800, 1802, 1803, 1807, 1810, 1811, 1813, 1815, 1817, 1818, 1819, 1820, 1821, 1822, 1826, 1827, 1828, 1830, 1831, 1832, 1833, 1834, 1835, 1836, 1838, 1843, 1844, 1845, 1848, 1849, 1850, 1853, 1854, 1856, 1860, 1861, 1862, 1863, 1868, 1869, 1870, 1871, 1872, 1874, 1876, 1878, 1879, 1881, 1883, 1884, 1885, 1886, 1888, 1890, 1892, 1894, 1895, 1898, 1899, 1900, 1901, 1902, 1903, 1904, 1905, 1906, 1907, 1912, 1913, 1916, 1917, 1918, 1919, 1921, 1924, 1925, 1926, 1927, 1928, 1929, 1931, 1932, 1933, 1934, 1935, 1937, 1938, 1940, 1943, 1945, 1947, 1950, 1953, 1956, 1958, 1960, 1961, 1963, 1964, 1965, 1968, 1970, 1971, 1973, 1976, 1979, 1980, 1981, 1982, 1985, 1986, 1987, 1988, 1989, 1990, 1992, 1996, 1998, 1999, 2000, 2001, 2006, 2008, 2010, 2011, 2012, 2015, 2019, 2023, 2024, 2025, 2026, 2027, 2028, 2031, 2032, 2034, 2035, 2036, 2037, 2039, 2040, 2041, 2042, 2043, 2045, 2047, 2048, 2049, 2050, 2052, 2054, 2056, 2057, 2058, 2063, 2064, 2065, 2068, 2070, 2071, 2072, 2075, 2076, 2077, 2078, 2079, 2081, 2084, 2085, 2086, 2087, 2090, 2091, 2093, 2094, 2096, 2097, 2098, 2100, 2101, 2102, 2103, 2104, 2105, 2107, 2110, 2112, 2113, 2114, 2115, 2116, 2118, 2120, 2121, 2122, 2123, 2124, 2125, 2126, 2127, 2128, 2135, 2136, 2137, 2138, 2139, 2140, 2141, 2143, 2145, 2146, 2148, 2156, 2157, 2158, 2159, 2161, 2163, 2164, 2166, 2170, 2171, 2172, 2173, 2174, 2175, 2176, 2177, 2178, 2179, 2180, 2181, 2182, 2183, 2184, 2188, 2189, 2190, 2191, 2195, 2197, 2198, 2204, 2206, 2207, 2209, 2210, 2212, 2214, 2217, 2219, 2220, 2221, 2224, 2229, 2230, 2232, 2233, 2234, 2235, 2236, 2237, 2239, 2240, 2241, 2243, 2244, 2245, 2246, 2248, 2249, 2250, 2252, 2253, 2254, 2255, 2256, 2257, 2258, 2260, 2261, 2262, 2264, 2265, 2269, 2270, 2272, 2275, 2283, 2284, 2285 ], "sites_with_glycoeffect": [ 1180, 138, 256, 261, 264, 711, 1000, 1000, 1001, 1002, 1004, 1007, 1027, 1027, 1031, 103, 103, 1042, 1042, 104, 1052, 1052, 1052, 1055, 1057, 1065, 106, 106, 1081, 1083, 1083, 1085, 108, 1090, 1090, 1090, 1090, 1091, 1091, 1096, 1123, 1124, 1126, 1138, 1138, 1149, 1150, 1151, 1153, 1167, 1171, 1180, 1180, 1180, 1182, 1184, 1184, 118, 1193, 1195, 1195, 1196, 1197, 1197, 11, 1206, 1211, 1217, 1225, 1226, 1233, 1235, 1235, 1235, 1235, 1235, 1242, 1242, 1242, 1242, 1242, 1248, 1248, 1255, 1255, 1272, 1272, 1279, 1281, 1281, 1285, 128, 128, 1290, 129, 129, 129, 129, 1302, 1312, 1316, 1319, 1320, 1320, 1324, 1324, 1338, 1338, 1339, 1343, 1348, 1348, 1348, 1348, 1350, 1350, 1350, 1352, 1352, 1352, 1356, 1356, 1356, 1356, 1362, 1369, 1374, 1376, 1377, 1389, 138, 138, 1390, 1393, 1393, 1394, 1394, 1414, 1414, 1422, 1428, 1435, 1435, 1440, 1455, 1455, 1465, 1465, 1477, 1477, 1488, 1488, 148, 1496, 1504, 1505, 1508, 1509, 1513, 1514, 1514, 1527, 1535, 1544, 1544, 1547, 1550, 1558, 1570, 1572, 1577, 1577, 1577, 1577, 1577, 1582, 1586, 1599, 1600, 1602, 1609, 1623, 1623, 1638, 1664, 1690, 1698, 1701, 1701, 1703, 1705, 1705, 1719, 1743, 1751, 1752, 178, 1791, 1791, 1798, 1807, 1822, 1822, 1826, 1828, 1850, 1861, 1863, 1868, 186, 1881, 1888, 1888, 1892, 1916, 1917, 1919, 1921, 1928, 1929, 1934, 1937, 1961, 1963, 1965, 1976, 1979, 1985, 1985, 1987, 1987, 1988, 1988, 1990, 1992, 1992, 1992, 1999, 202, 2031, 2042, 2063, 2068, 2068, 2068, 2072, 2076, 2076, 2079, 2079, 2096, 2104, 2104, 2105, 2113, 2121, 2123, 2124, 2126, 2126, 212, 212, 212, 2138, 2148, 2148, 214, 214, 2156, 215, 215, 215, 216, 2175, 2175, 2179, 2189, 2191, 2206, 220, 220, 220, 2214, 222, 2249, 2252, 2254, 2254, 2256, 2260, 2262, 2262, 2262, 2262, 2262, 2264, 2264, 2269, 2269, 2270, 2272, 2285, 229, 22, 238, 241, 241, 241, 241, 254, 254, 254, 255, 255, 255, 256, 256, 256, 258, 258, 258, 258, 258, 260, 260, 260, 260, 260, 261, 261, 262, 262, 262, 262, 262, 264, 264, 264, 265, 265, 265, 265, 265, 280, 286, 290, 290, 290, 292, 292, 294, 301, 303, 304, 315, 316, 317, 334, 334, 334, 350, 350, 357, 377, 381, 381, 395, 401, 409, 426, 433, 447, 454, 462, 462, 471, 486, 491, 499, 499, 500, 500, 514, 523, 534, 536, 536, 536, 539, 540, 551, 552, 552, 558, 560, 571, 571, 572, 584, 584, 58, 58, 58, 592, 593, 593, 607, 607, 610, 614, 614, 614, 617, 617, 619, 619, 620, 629, 634, 634, 637, 637, 641, 645, 653, 662, 664, 666, 668, 674, 684, 696, 696, 696, 696, 698, 705, 705, 705, 705, 709, 709, 709, 709, 711, 711, 711, 715, 733, 733, 735, 740, 740, 743, 744, 745, 762, 762, 763, 763, 763, 763, 764, 764, 764, 769, 772, 787, 796, 803, 809, 815, 815, 816, 822, 822, 823, 823, 824, 824, 825, 850, 850, 860, 867, 867, 868, 873, 873, 876, 876, 881, 90, 912, 912, 915, 919, 930, 934, 936, 937, 948, 949, 949, 956, 959, 959, 974, 985, 986, 995, 996, 997, 999 ], "glycation_sites": [], "phosphorylation_sites": [ 58, 79, 233, 286, 301, 363, 367, 382, 604, 696, 698, 702, 730, 764, 772, 1087, 1182, 1184, 1235, 1604, 1751, 1754, 1755, 1888, 1929, 1944 ], "sequon_annotation_sites": [ { "start_pos": 116, "end_pos": 118 }, { "start_pos": 1216, "end_pos": 1218 }, { "start_pos": 1299, "end_pos": 1301 }, { "start_pos": 1527, "end_pos": 1529 }, { "start_pos": 1597, "end_pos": 1599 }, { "start_pos": 1705, "end_pos": 1707 }, { "start_pos": 2066, "end_pos": 2068 }, { "start_pos": 218, "end_pos": 220 }, { "start_pos": 2247, "end_pos": 2249 }, { "start_pos": 629, "end_pos": 631 }, { "start_pos": 742, "end_pos": 744 }, { "start_pos": 956, "end_pos": 958 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 45 }, { "field": "total_sites", "count": 38 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 38 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 37 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 38 }, { "field": "exact_o_linked_sites", "count": 38 }, { "field": "exact_o_linked_glycan_sites", "count": 37 }, { "field": "exact_o_linked_glycans", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 42 }, { "field": "total_sites", "count": 37 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 37 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 37 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 37 }, { "field": "exact_o_linked_sites", "count": 37 }, { "field": "exact_o_linked_glycan_sites", "count": 37 }, { "field": "exact_o_linked_glycans", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 26 }, { "field": "total_sites", "count": 26 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 2015 }, { "field": "total_sites", "count": 1364 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1822 }, { "field": "total_sites", "count": 1301 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 193 }, { "field": "total_sites", "count": 113 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 218 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ], "tool_support": { "graph_view": "yes" } } ]