[ { "title": "Whole-exome sequencing reveals common and rare variants in immunologic and neurological genes implicated in achalasia.", "journal": "American journal of human genetics", "date": "2021", "authors": "Li Q, Chen W, Wang C, Liu Z, Gu Y, Xu X, Xu J, Jiang T, Xu M, Wang Y, Chen C, Zhong Y, Zhang Y, Yao L, Jin G, Hu Z, Zhou P", "reference": { "type": "PubMed", "id": "34197731", "url": "https://pubmed.ncbi.nlm.nih.gov/34197731" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0FGR9-1", "protein_name": "Extended synaptotagmin-3", "gene_name": "ESYT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0FGR9", "url": "https://www.uniprot.org/uniprotkb/A0FGR9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34197731", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comprehensive analysis of the prognostic values and immune implication of ESYT3 in lung adenocarcinoma.", "journal": "Medicine", "date": "2023-09-01", "authors": "Li Xuedong, Chen Jianlin, Meng Jie", "reference": { "type": "PubMed", "id": "37657044", "url": "https://pubmed.ncbi.nlm.nih.gov/37657044" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0FGR9-1", "protein_name": "Extended synaptotagmin-3", "gene_name": "ESYT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0FGR9", "url": "https://www.uniprot.org/uniprotkb/A0FGR9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37657044", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intramembrane proteolysis of signal peptides: an essential step in the generation of HLA-E epitopes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2001-12-01", "authors": "Lemberg M K, Bland F A, Weihofen A, Braud V M, Martoglio B", "reference": { "type": "PubMed", "id": "11714810", "url": "https://pubmed.ncbi.nlm.nih.gov/11714810" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11714810", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of signal peptide peptidase, a presenilin-type aspartic protease.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Weihofen A, Binns K, Lemberg MK, Ashman K, Martoglio B", "reference": { "type": "PubMed", "id": "12077416", "url": "https://pubmed.ncbi.nlm.nih.gov/12077416" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT6-2", "protein_name": "Signal peptide peptidase-like 3", "gene_name": "SPPL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 10, "end_pos": 10, "sequence_org": "N", "sequence_mut": "Q", "comment": "Abolishes N-glycosylation; when associated with Q-20.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" }, { "database": "PubMed", "id": "12077416", "url": "https://pubmed.ncbi.nlm.nih.gov/12077416" } ], "uniprot_canonical_ac": "Q8TCT9-1" }, { "start_pos": 20, "end_pos": 20, "sequence_org": "N", "sequence_mut": "Q", "comment": "Abolishes N-glycosylation; when associated with Q-10.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" }, { "database": "PubMed", "id": "12077416", "url": "https://pubmed.ncbi.nlm.nih.gov/12077416" } ], "uniprot_canonical_ac": "Q8TCT9-1" }, { "start_pos": 265, "end_pos": 265, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on inhibitor binding; abolishes signal peptide peptidase activity. Abolishes proteolysis of PSEN1. Abolishes proteolysis of XBP1 isoform 1 and increases interaction with XBP1 isoform 1.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" }, { "database": "PubMed", "id": "12077416", "url": "https://pubmed.ncbi.nlm.nih.gov/12077416" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" }, { "database": "PubMed", "id": "14741365", "url": "https://pubmed.ncbi.nlm.nih.gov/14741365" } ], "uniprot_canonical_ac": "Q8TCT9-1" } ], "record_id": "pubmed.12077416", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel class of polytopic proteins with domains associated with putative protease activity.", "journal": "Biochemistry (Mosc.)", "date": "2002", "authors": "Grigorenko AP, Moliaka YK, Korovaitseva GI, Rogaev EI", "reference": { "type": "PubMed", "id": "12139484", "url": "https://pubmed.ncbi.nlm.nih.gov/12139484" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT6-2", "protein_name": "Signal peptide peptidase-like 3", "gene_name": "SPPL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUH8-1", "protein_name": "Signal peptide peptidase-like 2C", "gene_name": "SPPL2C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12139484", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intramembrane proteolysis promotes trafficking of hepatitis C virus core protein to lipid droplets.", "journal": "The EMBO journal", "date": "2002", "authors": "McLauchlan J, Lemberg MK, Hope G, Martoglio B", "reference": { "type": "PubMed", "id": "12145199", "url": "https://pubmed.ncbi.nlm.nih.gov/12145199" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12145199", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of the presenilin-like signal peptide peptidase (SPP) in mouse adult brain and during development.", "journal": "Gene Expr. Patterns", "date": "2003", "authors": "Urny Jens, Hermans-Borgmeyer Irm, Gercken G\u00fcnther, Schaller H Chica", "reference": { "type": "PubMed", "id": "12972007", "url": "https://pubmed.ncbi.nlm.nih.gov/12972007" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D8V0-1", "protein_name": "Signal peptide peptidase", "gene_name": "H13; Hm13", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12972007", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Impas 1 possesses endoproteolytic activity against multipass membrane protein substrate cleaving the presenilin 1 holoprotein.", "journal": "FEBS letters", "date": "2004", "authors": "Moliaka YK, Grigorenko A, Madera D, Rogaev EI", "reference": { "type": "PubMed", "id": "14741365", "url": "https://pubmed.ncbi.nlm.nih.gov/14741365" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 219, "end_pos": 219, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes proteolysis of PSEN1.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" }, { "database": "PubMed", "id": "14741365", "url": "https://pubmed.ncbi.nlm.nih.gov/14741365" } ], "uniprot_canonical_ac": "Q8TCT9-1" }, { "start_pos": 264, "end_pos": 264, "sequence_org": "G", "sequence_mut": "A", "comment": "No effect on proteolysis of PSEN1.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" }, { "database": "PubMed", "id": "14741365", "url": "https://pubmed.ncbi.nlm.nih.gov/14741365" } ], "uniprot_canonical_ac": "Q8TCT9-1" }, { "start_pos": 265, "end_pos": 265, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on inhibitor binding; abolishes signal peptide peptidase activity. Abolishes proteolysis of PSEN1. Abolishes proteolysis of XBP1 isoform 1 and increases interaction with XBP1 isoform 1.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" }, { "database": "PubMed", "id": "12077416", "url": "https://pubmed.ncbi.nlm.nih.gov/12077416" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" }, { "database": "PubMed", "id": "14741365", "url": "https://pubmed.ncbi.nlm.nih.gov/14741365" } ], "uniprot_canonical_ac": "Q8TCT9-1" }, { "start_pos": 317, "end_pos": 317, "sequence_org": "P", "sequence_mut": "L", "comment": "Abolishes proteolysis of PSEN1.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" }, { "database": "PubMed", "id": "14741365", "url": "https://pubmed.ncbi.nlm.nih.gov/14741365" } ], "uniprot_canonical_ac": "Q8TCT9-1" } ], "record_id": "pubmed.14741365", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Consensus analysis of signal peptide peptidase and homologous human aspartic proteases reveals opposite topology of catalytic domains compared with presenilins.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Friedmann E, Lemberg MK, Weihofen A, Dev KK, Dengler U, Rovelli G, Martoglio B", "reference": { "type": "PubMed", "id": "15385547", "url": "https://pubmed.ncbi.nlm.nih.gov/15385547" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT6-2", "protein_name": "Signal peptide peptidase-like 3", "gene_name": "SPPL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT8-1", "protein_name": "Signal peptide peptidase-like 2A", "gene_name": "SPPL2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TCT7-1", "protein_name": "Signal peptide peptidase-like 2B", "gene_name": "SPPL2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUH8-1", "protein_name": "Signal peptide peptidase-like 2C", "gene_name": "SPPL2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49768-1", "protein_name": "Presenilin-1", "gene_name": "PSEN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 100, "start_aa": "Asn", "end_pos": 100, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn100", "evidence": [ { "id": "Q8IUH8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8IUH8#ptm_processing" }, { "id": "15385547", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15385547" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q8IUH8-1" } ], "record_id": "pubmed.15385547", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila signal peptide peptidase is an essential protease for larval development.", "journal": "Genetics", "date": "2005-05", "authors": "Casso David J, Tanda Soichi, Biehs Brian, Martoglio Bruno, Kornberg Thomas B", "reference": { "type": "PubMed", "id": "15716490", "url": "https://pubmed.ncbi.nlm.nih.gov/15716490" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9VPQ7-1", "protein_name": "Signal peptide peptidase", "gene_name": "Spp", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15716490", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell-surface expression of a new splice variant of the mouse signal peptide peptidase.", "journal": "Biochim. Biophys. Acta", "date": "2006", "authors": "Urny Jens, Hermans-Borgmeyer Irm, Schaller H Chica", "reference": { "type": "PubMed", "id": "16730383", "url": "https://pubmed.ncbi.nlm.nih.gov/16730383" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D8V0-1", "protein_name": "Signal peptide peptidase", "gene_name": "H13; Hm13", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16730383", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heme oxygenase-1 protein localizes to the nucleus and activates transcription factors important in oxidative stress.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lin Q, Weis S, Yang G, Weng YH, Helston R, Rish K, Smith A, Bordner J, Polte T, Gaunitz F, Dennery PA", "reference": { "type": "PubMed", "id": "17430897", "url": "https://pubmed.ncbi.nlm.nih.gov/17430897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17430897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A C-terminal region of signal peptide peptidase defines a functional domain for intramembrane aspartic protease catalysis.", "journal": "The Journal of biological chemistry", "date": "2007-07-13", "authors": "Narayanan Saravanakumar, Sato Toru, Wolfe Michael S", "reference": { "type": "PubMed", "id": "17517891", "url": "https://pubmed.ncbi.nlm.nih.gov/17517891" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9VPQ7-1", "protein_name": "Signal peptide peptidase", "gene_name": "Spp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q86P97-1", "protein_name": "Signal peptide peptidase-like", "gene_name": "SppL", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 228, "end_pos": 228, "sequence_org": "D", "sequence_mut": "A", "comment": "Disrupts catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9VPQ7", "url": "https://www.uniprot.org/uniprotkb/Q9VPQ7" }, { "database": "PubMed", "id": "17517891", "url": "https://pubmed.ncbi.nlm.nih.gov/17517891" } ], "uniprot_canonical_ac": "Q9VPQ7-1" }, { "start_pos": 274, "end_pos": 274, "sequence_org": "D", "sequence_mut": "A", "comment": "Disrupts catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9VPQ7", "url": "https://www.uniprot.org/uniprotkb/Q9VPQ7" }, { "database": "PubMed", "id": "17517891", "url": "https://pubmed.ncbi.nlm.nih.gov/17517891" }, { "database": "PubMed", "id": "20189678", "url": "https://pubmed.ncbi.nlm.nih.gov/20189678" } ], "uniprot_canonical_ac": "Q9VPQ7-1" } ], "record_id": "pubmed.17517891", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The TRC8 E3 ligase ubiquitinates MHC class I molecules before dislocation from the ER.", "journal": "J. Cell Biol.", "date": "2009", "authors": "Stagg HR, Thomas M, van den Boomen D, Wiertz EJ, Drabkin HA, Gemmill RM, Lehner PJ", "reference": { "type": "PubMed", "id": "19720873", "url": "https://pubmed.ncbi.nlm.nih.gov/19720873" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WU17-1", "protein_name": "E3 ubiquitin-protein ligase RNF139", "gene_name": "RNF139", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D8V0-1", "protein_name": "Signal peptide peptidase", "gene_name": "H13; Hm13", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 547, "end_pos": 550, "sequence_org": "CAIC", "sequence_mut": "SAIS", "comment": "Abolishes ubiquitination activity. Increases proliferation. Does not phosphorylate CHEK2 on T-68. Does not phosphorylate ATM on S-1981. Rescues MHC class I to the cell surface. Suppresses SREBF2 processing in the presence or absence of sterols. Fails to down-regulate SREBF1 and SREBF2. Decreases INSIG1 ubiquitination.", "evidence": [ { "database": "UniProtKB", "id": "Q8WU17", "url": "https://www.uniprot.org/uniprotkb/Q8WU17" }, { "database": "PubMed", "id": "19720873", "url": "https://pubmed.ncbi.nlm.nih.gov/19720873" }, { "database": "PubMed", "id": "17016439", "url": "https://pubmed.ncbi.nlm.nih.gov/17016439" }, { "database": "PubMed", "id": "20068067", "url": "https://pubmed.ncbi.nlm.nih.gov/20068067" }, { "database": "PubMed", "id": "19706601", "url": "https://pubmed.ncbi.nlm.nih.gov/19706601" } ], "uniprot_canonical_ac": "Q8WU17-1" }, { "start_pos": 547, "end_pos": 586, "sequence_org": "CAICYHEFTTSARITPCNHYFHALCLRKWLYIQDTCPMCH", "sequence_mut": "", "comment": "Increases proliferation. Rescues MHC class I to the cell surface. Fails to down-regulate SREBF1 and SREBF2.", "evidence": [ { "database": "UniProtKB", "id": "Q8WU17", "url": "https://www.uniprot.org/uniprotkb/Q8WU17" }, { "database": "PubMed", "id": "19720873", "url": "https://pubmed.ncbi.nlm.nih.gov/19720873" }, { "database": "PubMed", "id": "17016439", "url": "https://pubmed.ncbi.nlm.nih.gov/17016439" }, { "database": "PubMed", "id": "20068067", "url": "https://pubmed.ncbi.nlm.nih.gov/20068067" }, { "database": "PubMed", "id": "19706601", "url": "https://pubmed.ncbi.nlm.nih.gov/19706601" } ], "uniprot_canonical_ac": "Q8WU17-1" } ], "record_id": "pubmed.19720873", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cleavage by signal peptide peptidase is required for the degradation of selected tail-anchored proteins.", "journal": "The Journal of cell biology", "date": "2014", "authors": "Boname JM, Bloor S, Wandel MP, Nathan JA, Antrobus R, Dingwell KS, Thurston TL, Smith DL, Smith JC, Randow F, Lehner PJ", "reference": { "type": "PubMed", "id": "24958774", "url": "https://pubmed.ncbi.nlm.nih.gov/24958774" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24958774", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Signal peptide peptidase functions in ERAD to cleave the unfolded protein response regulator XBP1u.", "journal": "The EMBO journal", "date": "2014", "authors": "Chen CY, Malchus NS, Hehn B, Stelzer W, Avci D, Langosch D, Lemberg MK", "reference": { "type": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WU17-1", "protein_name": "E3 ubiquitin-protein ligase RNF139", "gene_name": "RNF139", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUN8-1", "protein_name": "Derlin-1", "gene_name": "DERL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17861-1", "protein_name": "X-box-binding protein 1", "gene_name": "XBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 265, "end_pos": 265, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on inhibitor binding; abolishes signal peptide peptidase activity. Abolishes proteolysis of PSEN1. Abolishes proteolysis of XBP1 isoform 1 and increases interaction with XBP1 isoform 1.", "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" }, { "database": "PubMed", "id": "12077416", "url": "https://pubmed.ncbi.nlm.nih.gov/12077416" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" }, { "database": "PubMed", "id": "14741365", "url": "https://pubmed.ncbi.nlm.nih.gov/14741365" } ], "uniprot_canonical_ac": "Q8TCT9-1" }, { "start_pos": 180, "end_pos": 180, "sequence_org": "G", "sequence_mut": "V", "comment": "Reduces interaction with and proteolysis of XBP1 isoform 1.", "evidence": [ { "database": "UniProtKB", "id": "Q9BUN8", "url": "https://www.uniprot.org/uniprotkb/Q9BUN8" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" } ], "uniprot_canonical_ac": "Q9BUN8-1" }, { "start_pos": 197, "end_pos": 197, "sequence_org": "Q", "sequence_mut": "L", "comment": "Inhibits HM13/SPP-mediated degradation of XBP1; when associated with L-199; L-200 and L-203.", "evidence": [ { "database": "UniProtKB", "id": "P17861", "url": "https://www.uniprot.org/uniprotkb/P17861" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" } ], "uniprot_canonical_ac": "P17861-1" }, { "start_pos": 199, "end_pos": 199, "sequence_org": "Q", "sequence_mut": "L", "comment": "Inhibits HM13/SPP-mediated degradation of XBP1; when associated with L-197; L-200 and L-203.", "evidence": [ { "database": "UniProtKB", "id": "P17861", "url": "https://www.uniprot.org/uniprotkb/P17861" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" } ], "uniprot_canonical_ac": "P17861-1" }, { "start_pos": 200, "end_pos": 200, "sequence_org": "S", "sequence_mut": "L", "comment": "Inhibits HM13/SPP-mediated degradation of XBP1; when associated with L-197; L-199 and L-203.", "evidence": [ { "database": "UniProtKB", "id": "P17861", "url": "https://www.uniprot.org/uniprotkb/P17861" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" } ], "uniprot_canonical_ac": "P17861-1" }, { "start_pos": 203, "end_pos": 203, "sequence_org": "S", "sequence_mut": "L", "comment": "Inhibits HM13/SPP-mediated degradation of XBP1; when associated with L-197; L-199 and L-200.", "evidence": [ { "database": "UniProtKB", "id": "P17861", "url": "https://www.uniprot.org/uniprotkb/P17861" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" } ], "uniprot_canonical_ac": "P17861-1" }, { "start_pos": 212, "end_pos": 212, "sequence_org": "T", "sequence_mut": "N", "comment": "Does not induce glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "P17861", "url": "https://www.uniprot.org/uniprotkb/P17861" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" } ], "uniprot_canonical_ac": "P17861-1" }, { "start_pos": 215, "end_pos": 215, "sequence_org": "C", "sequence_mut": "N", "comment": "Induces glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "P17861", "url": "https://www.uniprot.org/uniprotkb/P17861" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" } ], "uniprot_canonical_ac": "P17861-1" }, { "start_pos": 232, "end_pos": 232, "sequence_org": "R", "sequence_mut": "N", "comment": "Induces glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "P17861", "url": "https://www.uniprot.org/uniprotkb/P17861" }, { "database": "PubMed", "id": "25239945", "url": "https://pubmed.ncbi.nlm.nih.gov/25239945" } ], "uniprot_canonical_ac": "P17861-1" } ], "record_id": "pubmed.25239945", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insights into the mechanism of isoenzyme-specific signal peptide peptidase-mediated translocation of heme oxygenase.", "journal": "PloS one", "date": "2017", "authors": "Schaefer B, Moriishi K, Behrends S", "reference": { "type": "PubMed", "id": "29155886", "url": "https://pubmed.ncbi.nlm.nih.gov/29155886" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09601-1", "protein_name": "Heme oxygenase 1", "gene_name": "HMOX1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16236-1", "protein_name": "Nuclear factor erythroid 2-related factor 2", "gene_name": "NFE2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60675-1", "protein_name": "Transcription factor MafK", "gene_name": "MAFK", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14867-1", "protein_name": "Transcription regulator protein BACH1", "gene_name": "BACH1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29155886", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular Pathways for Immune Recognition of Preproinsulin Signal Peptide in Type 1 Diabetes.", "journal": "Diabetes", "date": "2018", "authors": "Kronenberg-Versteeg D, Eichmann M, Russell MA, de Ru A, Hehn B, Yusuf N, van Veelen PA, Richardson SJ, Morgan NG, Lemberg MK, Peakman M", "reference": { "type": "PubMed", "id": "29343547", "url": "https://pubmed.ncbi.nlm.nih.gov/29343547" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29343547", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Signal peptide peptidase promotes tumor progression via facilitating FKBP8 degradation.", "journal": "Oncogene", "date": "2019", "authors": "Hsu FF, Chou YT, Chiang MT, Li FA, Yeh CT, Lee WH, Chau LY", "reference": { "type": "PubMed", "id": "30348988", "url": "https://pubmed.ncbi.nlm.nih.gov/30348988" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30348988", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Histocompatibility Minor 13 (HM13), targeted by miR-760, exerts oncogenic role in breast cancer by suppressing autophagy and activating PI3K-AKT-mTOR pathway.", "journal": "Cell death & disease", "date": "2022-09-25", "authors": "Yang Haiyan, Li Zhi, Wang Zhangwei, Zhang Xu, Dai Xinyuan, Zhou Guoren, Ding Qiang", "reference": { "type": "PubMed", "id": "36153332", "url": "https://pubmed.ncbi.nlm.nih.gov/36153332" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36153332", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of SPP/SPPL intramembrane proteases in membrane protein homeostasis.", "journal": "The FEBS journal", "date": "2023-08-25", "authors": "Mentrup Torben, Leinung Nadja, Patel Mehul, Fluhrer Regina, Schr\u00f6der Bernd", "reference": { "type": "PubMed", "id": "37625440", "url": "https://pubmed.ncbi.nlm.nih.gov/37625440" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37625440", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intramembrane protease SPP defines a cholesterol-regulated abundance control of the mevalonate pathway enzyme squalene synthase.", "journal": "The Journal of biological chemistry", "date": "2024-02", "authors": "Avci D\u00f6nem, Heidasch Ronny, Costa Martina, L\u00fcchtenborg Christian, Kale Dipali, Br\u00fcgger Britta, Lemberg Marius K", "reference": { "type": "PubMed", "id": "38218226", "url": "https://pubmed.ncbi.nlm.nih.gov/38218226" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TCT9-1", "protein_name": "Signal peptide peptidase", "gene_name": "HM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37268-1", "protein_name": "Squalene synthase", "gene_name": "FDFT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TCT9", "url": "https://www.uniprot.org/uniprotkb/Q8TCT9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38218226", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA cloning of a new putative ATPase subunit p45 of the human 26S proteasome, a homolog of yeast transcriptional factor Sug1p.", "journal": "FEBS Lett.", "date": "1995", "authors": "Akiyama K, Yokota K, Kagawa S, Shimbara N, DeMartino GN, Slaughter CA, Noda C, Tanaka K", "reference": { "type": "PubMed", "id": "7729537", "url": "https://pubmed.ncbi.nlm.nih.gov/7729537" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62195-1", "protein_name": "26S proteasome regulatory subunit 8", "gene_name": "PSMC5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62195", "url": "https://www.uniprot.org/uniprotkb/P62195" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7729537", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HEC binds to the seventh regulatory subunit of the 26 S proteasome and modulates the proteolysis of mitotic cyclins.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Chen Y, Sharp ZD, Lee WH", "reference": { "type": "PubMed", "id": "9295362", "url": "https://pubmed.ncbi.nlm.nih.gov/9295362" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P62195-1", "protein_name": "26S proteasome regulatory subunit 8", "gene_name": "PSMC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35998-1", "protein_name": "26S proteasome regulatory subunit 7", "gene_name": "PSMC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14683-1", "protein_name": "Structural maintenance of chromosomes protein 1A", "gene_name": "SMC1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14777-1", "protein_name": "Kinetochore protein NDC80 homolog", "gene_name": "NDC80", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P62195", "url": "https://www.uniprot.org/uniprotkb/P62195" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9295362", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel zinc finger protein is associated with U7 snRNP and interacts with the stem-loop binding protein in the histone pre-mRNP to stimulate 3'-end processing.", "journal": "Genes & development", "date": "2002", "authors": "Dominski Z, Erkmann JA, Yang X, Sanchez R, Marzluff WF", "reference": { "type": "PubMed", "id": "11782445", "url": "https://pubmed.ncbi.nlm.nih.gov/11782445" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTR7-1", "protein_name": "Zinc finger protein 473", "gene_name": "ZNF473", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 230, "end_pos": 270, "sequence_org": "DDFDVYSGTPTKVRHMDSQVEDEFDLEACLTEPLRDFSAMS", "sequence_mut": "", "comment": "Decrease in 3'-end processing efficiency.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "11782445", "url": "https://pubmed.ncbi.nlm.nih.gov/11782445" } ], "uniprot_canonical_ac": "Q14493-1" } ], "record_id": "pubmed.11782445", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of stem-loop binding protein (SLBP) on two threonines triggers degradation of SLBP, the sole cell cycle-regulated factor required for regulation of histone mRNA processing, at the end of S phase.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Zheng L, Dominski Z, Yang XC, Elms P, Raska CS, Borchers CH, Marzluff WF", "reference": { "type": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 59, "end_pos": 59, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not increase its stability at the end of the S phase and through G2 and mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 61, "end_pos": 61, "sequence_org": "T", "sequence_mut": "A", "comment": "Increases its stability at the end of the S phase and through G2 and mitosis. Active in histone pre-mRNA processing during the G2 phase.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 62, "end_pos": 62, "sequence_org": "T", "sequence_mut": "A", "comment": "Increases its stability at the end of the S phase and through G2 and mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 63, "end_pos": 63, "sequence_org": "P", "sequence_mut": "A", "comment": "Increases its stability at the end of the S phase and through G2 and mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 96, "end_pos": 99, "sequence_org": "KRKL", "sequence_mut": "AAAA", "comment": "Increases its stability at the end of the S phase and through G2 and mitosis. Inhibits phosphorylation of T-62. Localizes in the nucleus. Reduces interaction with the importin alpha/importin beta receptor. Abolishes interaction with the importin alpha/importin beta receptor; when associated with A-31; A-32; A-33 and A-34 or with A-241; A-242; A-243 and A-244.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" }, { "database": "PubMed", "id": "15829567", "url": "https://pubmed.ncbi.nlm.nih.gov/15829567" } ], "uniprot_canonical_ac": "Q14493-1" } ], "phosphorylation": [ { "start_pos": 61, "end_pos": 61, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "iPTMnet", "id": "Q14493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" } ], "site_lbl": "Thr61", "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 62, "end_pos": 62, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "iPTMnet", "id": "Q14493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr62", "uniprot_canonical_ac": "Q14493-1" } ], "record_id": "pubmed.12588979", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expressed genes, Alu repeats and polymorphisms in cosmids sequenced from chromosome 4p16.3.", "journal": "Nat. Genet.", "date": "1992", "authors": "McCombie WR, Martin-Gallardo A, Gocayne JD, FitzGerald M, Dubnick M, Kelley JM, Castilla L, Liu LI, Wallace S, Trapp S, et al.", "reference": { "type": "PubMed", "id": "1338771", "url": "https://pubmed.ncbi.nlm.nih.gov/1338771" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1338771", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear import of the stem-loop binding protein and localization during the cell cycle.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Erkmann JA, Wagner EJ, Dong J, Zhang Y, Kutay U, Marzluff WF", "reference": { "type": "PubMed", "id": "15829567", "url": "https://pubmed.ncbi.nlm.nih.gov/15829567" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 137, "end_pos": 137, "sequence_org": "R", "sequence_mut": "A", "comment": "Inhibits histone RNA-binding and localization to the cytoplasm.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "15829567", "url": "https://pubmed.ncbi.nlm.nih.gov/15829567" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 138, "end_pos": 138, "sequence_org": "R", "sequence_mut": "A", "comment": "Inhibits histone RNA-binding and localization to the cytoplasm.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "15829567", "url": "https://pubmed.ncbi.nlm.nih.gov/15829567" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 241, "end_pos": 244, "sequence_org": "KVRH", "sequence_mut": "AAAA", "comment": "Reduces interaction with the importin alpha/importin beta receptor. Abolishes interaction with the importin alpha/importin beta receptor; when associated with A-31; A-32; A-33 and A-34 or with A-96; A-97; A-98 and A-99.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "15829567", "url": "https://pubmed.ncbi.nlm.nih.gov/15829567" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 31, "end_pos": 34, "sequence_org": "RKRR", "sequence_mut": "AAAA", "comment": "Reduces interaction with the importin alpha/importin beta receptor. Abolishes interaction with the importin alpha/importin beta receptor; when associated with A-96; A-97; A-98 and A-99 or with A-241; A-242; A-243 and A-244.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "15829567", "url": "https://pubmed.ncbi.nlm.nih.gov/15829567" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 96, "end_pos": 99, "sequence_org": "KRKL", "sequence_mut": "AAAA", "comment": "Increases its stability at the end of the S phase and through G2 and mitosis. Inhibits phosphorylation of T-62. Localizes in the nucleus. Reduces interaction with the importin alpha/importin beta receptor. Abolishes interaction with the importin alpha/importin beta receptor; when associated with A-31; A-32; A-33 and A-34 or with A-241; A-242; A-243 and A-244.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" }, { "database": "PubMed", "id": "15829567", "url": "https://pubmed.ncbi.nlm.nih.gov/15829567" } ], "uniprot_canonical_ac": "Q14493-1" } ], "record_id": "pubmed.15829567", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulated degradation of replication-dependent histone mRNAs requires both ATR and Upf1.", "journal": "Nat. Struct. Mol. Biol.", "date": "2005", "authors": "Kaygun H, Marzluff WF", "reference": { "type": "PubMed", "id": "16086026", "url": "https://pubmed.ncbi.nlm.nih.gov/16086026" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92900-1", "protein_name": "Regulator of nonsense transcripts 1", "gene_name": "UPF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 509, "end_pos": 509, "sequence_org": "K", "sequence_mut": "A", "comment": "Inhibits histone mRNA degradation, ATPase activity and ATP binding. No effect on interaction with DHX34.", "evidence": [ { "database": "UniProtKB", "id": "Q92900", "url": "https://www.uniprot.org/uniprotkb/Q92900" }, { "database": "PubMed", "id": "17159905", "url": "https://pubmed.ncbi.nlm.nih.gov/17159905" }, { "database": "PubMed", "id": "16086026", "url": "https://pubmed.ncbi.nlm.nih.gov/16086026" }, { "database": "PubMed", "id": "16452507", "url": "https://pubmed.ncbi.nlm.nih.gov/16452507" }, { "database": "PubMed", "id": "25220460", "url": "https://pubmed.ncbi.nlm.nih.gov/25220460" }, { "database": "PubMed", "id": "18066079", "url": "https://pubmed.ncbi.nlm.nih.gov/18066079" } ], "uniprot_canonical_ac": "Q92900-1" }, { "start_pos": 843, "end_pos": 843, "sequence_org": "R", "sequence_mut": "A", "comment": "Inhibits histone mRNA degradation.", "evidence": [ { "database": "UniProtKB", "id": "Q92900", "url": "https://www.uniprot.org/uniprotkb/Q92900" }, { "database": "PubMed", "id": "16086026", "url": "https://pubmed.ncbi.nlm.nih.gov/16086026" }, { "database": "PubMed", "id": "11163187", "url": "https://pubmed.ncbi.nlm.nih.gov/11163187" } ], "uniprot_canonical_ac": "Q92900-1" }, { "start_pos": 843, "end_pos": 843, "sequence_org": "R", "sequence_mut": "C", "comment": "Abolishes NMD.", "evidence": [ { "database": "UniProtKB", "id": "Q92900", "url": "https://www.uniprot.org/uniprotkb/Q92900" }, { "database": "PubMed", "id": "16086026", "url": "https://pubmed.ncbi.nlm.nih.gov/16086026" }, { "database": "PubMed", "id": "11163187", "url": "https://pubmed.ncbi.nlm.nih.gov/11163187" } ], "uniprot_canonical_ac": "Q92900-1" } ], "record_id": "pubmed.16086026", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Combined top-down and bottom-up proteomics identifies a phosphorylation site in stem-loop-binding proteins that contributes to high-affinity RNA binding.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Borchers CH, Thapar R, Petrotchenko EV, Torres MP, Speir JP, Easterling M, Dominski Z, Marzluff WF", "reference": { "type": "PubMed", "id": "16492733", "url": "https://pubmed.ncbi.nlm.nih.gov/16492733" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16492733", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of 3'hExo, a 3' exonuclease specifically interacting with the 3' end of histone mRNA.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Yang XC, Purdy M, Marzluff WF, Dominski Z", "reference": { "type": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IV48-1", "protein_name": "3'-5' exoribonuclease 1", "gene_name": "ERI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 104, "end_pos": 104, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not inhibit RNA-binding to the stem-loop structure. Does not inhibit RNA-binding to the stem-loop structure, when associated with A-92.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 105, "end_pos": 105, "sequence_org": "R", "sequence_mut": "A", "comment": "Inhibits RNA-binding to the stem-loop structure.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 109, "end_pos": 109, "sequence_org": "Y", "sequence_mut": "A", "comment": "Reduces slightly RNA-binding to the stem-loop structure; when associated with A-110.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 110, "end_pos": 110, "sequence_org": "Y", "sequence_mut": "A", "comment": "Reduces slightly RNA-binding to the stem-loop structure; when associated with A-109.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 111, "end_pos": 111, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces RNA-binding to the stem-loop structure but not 3'-end histone mRNA exonuclease activity; when associated with A-112.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 112, "end_pos": 112, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces RNA-binding to the stem-loop structure but not 3'-end histone mRNA exonuclease activity; when associated with A-111.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 234, "end_pos": 234, "sequence_org": "D", "sequence_mut": "A", "comment": "Inhibits 3'-end histone mRNA exonuclease activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 235, "end_pos": 235, "sequence_org": "M", "sequence_mut": "A", "comment": "Inhibits RNA-binding to the stem-loop structure and 3'-end histone mRNA exonuclease activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 92, "end_pos": 92, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not inhibit RNA-binding to the stem-loop structure. Does not inhibit RNA-binding to the stem-loop structure, when associated with A-104.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 96, "end_pos": 96, "sequence_org": "R", "sequence_mut": "A", "comment": "Does not inhibit RNA-binding to the stem-loop structure.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" }, { "start_pos": 99, "end_pos": 99, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces slightly RNA-binding to the stem-loop structure.", "evidence": [ { "database": "UniProtKB", "id": "Q8IV48", "url": "https://www.uniprot.org/uniprotkb/Q8IV48" }, { "database": "PubMed", "id": "16912046", "url": "https://pubmed.ncbi.nlm.nih.gov/16912046" } ], "uniprot_canonical_ac": "Q8IV48-1" } ], "record_id": "pubmed.16912046", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLIP1, a factor required for activation of histone mRNA translation by the stem-loop binding protein.", "journal": "Mol. Cell. Biol.", "date": "2008", "authors": "Cakmakci NG, Lerner RS, Wagner EJ, Zheng L, Marzluff WF", "reference": { "type": "PubMed", "id": "18025107", "url": "https://pubmed.ncbi.nlm.nih.gov/18025107" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78344-1", "protein_name": "Eukaryotic translation initiation factor 4 gamma 2", "gene_name": "EIF4G2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A9UHW6-1", "protein_name": "MIF4G domain-containing protein", "gene_name": "MIF4GD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04637-1", "protein_name": "Eukaryotic translation initiation factor 4 gamma 1", "gene_name": "EIF4G1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18025107", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of threonine 61 by cyclin a/Cdk1 triggers degradation of stem-loop binding protein at the end of S phase.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Koseoglu MM, Graves LM, Marzluff WF", "reference": { "type": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 59, "end_pos": 63, "sequence_org": "SFTTP", "sequence_mut": "AAAA", "comment": "Does not increase its stability at the end of the S phase and through G2 and mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 61, "end_pos": 61, "sequence_org": "T", "sequence_mut": "A", "comment": "Increases its stability at the end of the S phase and through G2 and mitosis. Active in histone pre-mRNA processing during the G2 phase.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 62, "end_pos": 62, "sequence_org": "T", "sequence_mut": "A", "comment": "Increases its stability at the end of the S phase and through G2 and mitosis.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" } ], "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 96, "end_pos": 99, "sequence_org": "KRKL", "sequence_mut": "AAAA", "comment": "Increases its stability at the end of the S phase and through G2 and mitosis. Inhibits phosphorylation of T-62. Localizes in the nucleus. Reduces interaction with the importin alpha/importin beta receptor. Abolishes interaction with the importin alpha/importin beta receptor; when associated with A-31; A-32; A-33 and A-34 or with A-241; A-242; A-243 and A-244.", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" }, { "database": "PubMed", "id": "15829567", "url": "https://pubmed.ncbi.nlm.nih.gov/15829567" } ], "uniprot_canonical_ac": "Q14493-1" } ], "phosphorylation": [ { "start_pos": 61, "end_pos": 61, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14493" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" } ], "site_lbl": "Thr61", "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 61, "end_pos": 61, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "iPTMnet", "id": "Q14493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" } ], "site_lbl": "Thr61", "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 62, "end_pos": 62, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q14493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14493" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" } ], "site_lbl": "Thr62", "uniprot_canonical_ac": "Q14493-1" }, { "start_pos": 62, "end_pos": 62, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "iPTMnet", "id": "Q14493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14493" }, { "database": "PubMed", "id": "12588979", "url": "https://pubmed.ncbi.nlm.nih.gov/12588979" }, { "database": "PubMed", "id": "18490441", "url": "https://pubmed.ncbi.nlm.nih.gov/18490441" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr62", "uniprot_canonical_ac": "Q14493-1" } ], "record_id": "pubmed.18490441", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Knockdown of SLBP results in nuclear retention of histone mRNA.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Sullivan KD, Mullen TE, Marzluff WF, Wagner EJ", "reference": { "type": "PubMed", "id": "19155325", "url": "https://pubmed.ncbi.nlm.nih.gov/19155325" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19155325", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of the histone mRNA hairpin with stem-loop binding protein (SLBP) and regulation of the SLBP-RNA complex by phosphorylation and proline isomerization.", "journal": "Biochemistry", "date": "2012", "authors": "Zhang M, Lam TT, Tonelli M, Marzluff WF, Thapar R", "reference": { "type": "PubMed", "id": "22439849", "url": "https://pubmed.ncbi.nlm.nih.gov/22439849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "22439849", "url": "https://pubmed.ncbi.nlm.nih.gov/22439849" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "Q14493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14493" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23286197", "url": "https://pubmed.ncbi.nlm.nih.gov/23286197" } ], "site_lbl": "Thr171", "uniprot_canonical_ac": "Q14493-1" } ], "record_id": "pubmed.22439849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Assembly of the SLIP1-SLBP complex on histone mRNA requires heterodimerization and sequential binding of SLBP followed by SLIP1.", "journal": "Biochemistry", "date": "2013", "authors": "Bansal N, Zhang M, Bhaskar A, Itotia P, Lee E, Shlyakhtenko LS, Lam TT, Fritz A, Berezney R, Lyubchenko YL, Stafford WF, Thapar R", "reference": { "type": "PubMed", "id": "23286197", "url": "https://pubmed.ncbi.nlm.nih.gov/23286197" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" }, { "database": "PubMed", "id": "22439849", "url": "https://pubmed.ncbi.nlm.nih.gov/22439849" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "Q14493", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q14493" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23286197", "url": "https://pubmed.ncbi.nlm.nih.gov/23286197" } ], "site_lbl": "Thr171", "uniprot_canonical_ac": "Q14493-1" } ], "record_id": "pubmed.23286197", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FEM1 proteins are ancient regulators of SLBP degradation.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2017", "authors": "Dankert JF, Pagan JK, Starostina NG, Kipreos ET, Pagano M", "reference": { "type": "PubMed", "id": "28118078", "url": "https://pubmed.ncbi.nlm.nih.gov/28118078" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JP0-1", "protein_name": "Protein fem-1 homolog C", "gene_name": "FEM1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BSK4-1", "protein_name": "Protein fem-1 homolog A", "gene_name": "FEM1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK73-1", "protein_name": "Protein fem-1 homolog B", "gene_name": "FEM1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28118078", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nickel and cadmium-induced SLBP depletion: A potential pathway to metal mediated cellular transformation.", "journal": "PloS one", "date": "2017", "authors": "Jordan A, Zhang X, Li J, Laulicht-Glick F, Sun H, Costa M", "reference": { "type": "PubMed", "id": "28306745", "url": "https://pubmed.ncbi.nlm.nih.gov/28306745" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28306745", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Knocking down miR-384 promotes growth and metastasis of osteosarcoma MG63 cells by targeting SLBP.", "journal": "Artificial cells, nanomedicine, and biotechnology", "date": "2019", "authors": "Wang Y, Huang H, Li Y", "reference": { "type": "PubMed", "id": "31007083", "url": "https://pubmed.ncbi.nlm.nih.gov/31007083" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31007083", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Influenza A virus co-opts ERI1 exonuclease bound to histone mRNA to promote viral transcription.", "journal": "Nucleic acids research", "date": "2020", "authors": "Declercq M, Biquand E, Karim M, Pietrosemoli N, Jacob Y, Demeret C, Barbezange C, van der Werf S", "reference": { "type": "PubMed", "id": "32960265", "url": "https://pubmed.ncbi.nlm.nih.gov/32960265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IV48-1", "protein_name": "3'-5' exoribonuclease 1", "gene_name": "ERI1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32960265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DRAIC promotes growth of breast cancer by sponging miR-432-5p to upregulate SLBP.", "journal": "Cancer gene therapy", "date": "2022", "authors": "Li S, Jia H, Zhang Z, Wu D", "reference": { "type": "PubMed", "id": "34645975", "url": "https://pubmed.ncbi.nlm.nih.gov/34645975" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34645975", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein that binds the 3' end of histone mRNA: a novel RNA-binding protein required for histone pre-mRNA processing.", "journal": "Genes & development", "date": "1996", "authors": "Wang ZF, Whitfield ML, Ingledue TC 3rd, Dominski Z, Marzluff WF", "reference": { "type": "PubMed", "id": "8957003", "url": "https://pubmed.ncbi.nlm.nih.gov/8957003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97440-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "Slbp", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8957003", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The gene for histone RNA hairpin binding protein is located on human chromosome 4 and encodes a novel type of RNA binding protein.", "journal": "The EMBO journal", "date": "1997", "authors": "Martin F, Schaller A, Eglite S, Schumperli D, Muller B", "reference": { "type": "PubMed", "id": "9049306", "url": "https://pubmed.ncbi.nlm.nih.gov/9049306" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14493-1", "protein_name": "Histone RNA hairpin-binding protein", "gene_name": "SLBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14678-1", "protein_name": "Small nuclear ribonucleoprotein-associated proteins B and B'", "gene_name": "SNRPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62308-1", "protein_name": "Small nuclear ribonucleoprotein G", "gene_name": "SNRPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969L4-1", "protein_name": "U7 snRNA-associated Sm-like protein LSm10", "gene_name": "LSM10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83369-1", "protein_name": "U7 snRNA-associated Sm-like protein LSm11", "gene_name": "LSM11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52298-1", "protein_name": "Nuclear cap-binding protein subunit 2", "gene_name": "NCBP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTR7-1", "protein_name": "Zinc finger protein 473", "gene_name": "ZNF473", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62306-1", "protein_name": "Small nuclear ribonucleoprotein F", "gene_name": "SNRPF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62318-1", "protein_name": "Small nuclear ribonucleoprotein Sm D3", "gene_name": "SNRPD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62304-1", "protein_name": "Small nuclear ribonucleoprotein E", "gene_name": "SNRPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09161-1", "protein_name": "Nuclear cap-binding protein subunit 1", "gene_name": "NCBP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14493", "url": "https://www.uniprot.org/uniprotkb/Q14493" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9049306", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CCM-3/STRIPAK promotes seamless tube extension through endocytic recycling.", "journal": "Nat. Commun.", "date": "2015", "authors": "Lant B, Yu B, Goudreault M, Holmyard D, Knight JD, Xu P, Zhao L, Chin K, Wallace E, Zhen M, Gingras AC, Derry WB", "reference": { "type": "PubMed", "id": "25743393", "url": "https://pubmed.ncbi.nlm.nih.gov/25743393" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5VSL9-1", "protein_name": "Striatin-interacting protein 1", "gene_name": "STRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13033-1", "protein_name": "Striatin-3", "gene_name": "STRN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5S2-1", "protein_name": "Serine/threonine-protein kinase MRCK beta", "gene_name": "CDC42BPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5VSL9", "url": "https://www.uniprot.org/uniprotkb/Q5VSL9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25743393", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Architecture, substructures, and dynamic assembly of STRIPAK complexes in Hippo signaling.", "journal": "Cell discovery", "date": "2019", "authors": "Tang Yang, Chen Min, Zhou Li, Ma Jian, Li Yehua, Zhang Hui, Shi Zhubing, Xu Qi, Zhang Xiaoman, Gao Ziyang, Zhao Yun, Cheng Yunfeng, Jiao Shi, Zhou Zhaocai", "reference": { "type": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5VSL9-1", "protein_name": "Striatin-interacting protein 1", "gene_name": "STRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14BN4-1", "protein_name": "Sarcolemmal membrane-associated protein", "gene_name": "SLMAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13188-1", "protein_name": "Serine/threonine-protein kinase 3", "gene_name": "STK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRV8-1", "protein_name": "Suppressor of IKBKE 1", "gene_name": "SIKE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13033-1", "protein_name": "Striatin-3", "gene_name": "STRN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5VSL9", "url": "https://www.uniprot.org/uniprotkb/Q5VSL9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 182, "end_pos": 182, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of interaction with SIKE1.", "evidence": [ { "database": "UniProtKB", "id": "Q14BN4", "url": "https://www.uniprot.org/uniprotkb/Q14BN4" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q14BN4-1" }, { "start_pos": 186, "end_pos": 186, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of interaction with SIKE1.", "evidence": [ { "database": "UniProtKB", "id": "Q14BN4", "url": "https://www.uniprot.org/uniprotkb/Q14BN4" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q14BN4-1" }, { "start_pos": 189, "end_pos": 189, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of interaction with SIKE1.", "evidence": [ { "database": "UniProtKB", "id": "Q14BN4", "url": "https://www.uniprot.org/uniprotkb/Q14BN4" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q14BN4-1" }, { "start_pos": 193, "end_pos": 193, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of interaction with SIKE1.", "evidence": [ { "database": "UniProtKB", "id": "Q14BN4", "url": "https://www.uniprot.org/uniprotkb/Q14BN4" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q14BN4-1" }, { "start_pos": 56, "end_pos": 56, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of kinase activity. Loss of interaction with components of the STRIPAK complex.", "evidence": [ { "database": "UniProtKB", "id": "Q13188", "url": "https://www.uniprot.org/uniprotkb/Q13188" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" }, { "database": "PubMed", "id": "16930133", "url": "https://pubmed.ncbi.nlm.nih.gov/16930133" } ], "uniprot_canonical_ac": "Q13188-1" }, { "start_pos": 101, "end_pos": 101, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of (SIKE1:SLMAP)STRIPAK complex formation.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 109, "end_pos": 109, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of (SIKE1:SLMAP)STRIPAK complex formation; when associated with A-109.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 15, "end_pos": 15, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of interaction with SLMAP.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 19, "end_pos": 19, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of interaction with SLMAP.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 36, "end_pos": 36, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of interaction with SLMAP.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 43, "end_pos": 43, "sequence_org": "M", "sequence_mut": "E", "comment": "No effect on interaction with SLMAP.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 90, "end_pos": 90, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of (SIKE1:SLMAP)STRIPAK complex formation.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of (SIKE1:SLMAP)STRIPAK complex formation.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 96, "end_pos": 96, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of (SIKE1:SLMAP)STRIPAK complex formation; when associated with A-109.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 97, "end_pos": 97, "sequence_org": "H", "sequence_mut": "D", "comment": "Loss of (SIKE1:SLMAP)STRIPAK complex formation.", "evidence": [ { "database": "UniProtKB", "id": "Q9BRV8", "url": "https://www.uniprot.org/uniprotkb/Q9BRV8" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q9BRV8-1" }, { "start_pos": 176, "end_pos": 185, "sequence_org": "RQLLRQYLQE", "sequence_mut": "AQLLRQYLQA", "comment": "Loss of STRIPAK complex formation.", "evidence": [ { "database": "UniProtKB", "id": "Q13033", "url": "https://www.uniprot.org/uniprotkb/Q13033" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q13033-1" }, { "start_pos": 179, "end_pos": 186, "sequence_org": "LRQYLQEV", "sequence_mut": "DRQYLQED", "comment": "Loss of STRIPAK complex formation.", "evidence": [ { "database": "UniProtKB", "id": "Q13033", "url": "https://www.uniprot.org/uniprotkb/Q13033" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" } ], "uniprot_canonical_ac": "Q13033-1" } ], "phosphorylation": [ { "start_pos": 180, "end_pos": 180, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q13188", "url": "https://www.uniprot.org/uniprotkb/Q13188" }, { "database": "PRO", "id": "Q13188", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q13188" }, { "database": "iPTMnet", "id": "Q13188", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13188" }, { "database": "PubMed", "id": "11278283", "url": "https://pubmed.ncbi.nlm.nih.gov/11278283" }, { "database": "PubMed", "id": "12554736", "url": "https://pubmed.ncbi.nlm.nih.gov/12554736" }, { "database": "PubMed", "id": "20231902", "url": "https://pubmed.ncbi.nlm.nih.gov/20231902" }, { "database": "PubMed", "id": "24992339", "url": "https://pubmed.ncbi.nlm.nih.gov/24992339" }, { "database": "PubMed", "id": "29063833", "url": "https://pubmed.ncbi.nlm.nih.gov/29063833" }, { "database": "PubMed", "id": "30622739", "url": "https://pubmed.ncbi.nlm.nih.gov/30622739" }, { "database": "PubMed", "id": "32292165", "url": "https://pubmed.ncbi.nlm.nih.gov/32292165" } ], "site_lbl": "Thr180", "uniprot_canonical_ac": "Q13188-1" } ], "record_id": "pubmed.30622739", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cryo-EM structure of the Hippo signaling integrator human STRIPAK.", "journal": "Nature structural & molecular biology", "date": "2021-03", "authors": "Jeong Byung-Cheon, Bae Sung Jun, Ni Lisheng, Zhang Xuewu, Bai Xiao-Chen, Luo Xuelian", "reference": { "type": "PubMed", "id": "33633399", "url": "https://pubmed.ncbi.nlm.nih.gov/33633399" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5VSL9-1", "protein_name": "Striatin-interacting protein 1", "gene_name": "STRIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A3-1", "protein_name": "MOB-like protein phocein", "gene_name": "MOB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13033-1", "protein_name": "Striatin-3", "gene_name": "STRN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5VSL9", "url": "https://www.uniprot.org/uniprotkb/Q5VSL9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 131, "end_pos": 134, "sequence_org": "DGLE", "sequence_mut": "EGLK", "comment": "Decreased formation of STRIPAK core complex.", "evidence": [ { "database": "UniProtKB", "id": "Q5VSL9", "url": "https://www.uniprot.org/uniprotkb/Q5VSL9" }, { "database": "PubMed", "id": "33633399", "url": "https://pubmed.ncbi.nlm.nih.gov/33633399" } ], "uniprot_canonical_ac": "Q5VSL9-1" }, { "start_pos": 427, "end_pos": 427, "sequence_org": "K", "sequence_mut": "E", "comment": "Decreased interaction with other STRIPAK core complex components. Decreased inhibition of Hippo signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q5VSL9", "url": "https://www.uniprot.org/uniprotkb/Q5VSL9" }, { "database": "PubMed", "id": "33633399", "url": "https://pubmed.ncbi.nlm.nih.gov/33633399" } ], "uniprot_canonical_ac": "Q5VSL9-1" }, { "start_pos": 744, "end_pos": 744, "sequence_org": "R", "sequence_mut": "E", "comment": "Decreased interaction with other STRIPAK core complex components. Decreased inhibition of Hippo signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q5VSL9", "url": "https://www.uniprot.org/uniprotkb/Q5VSL9" }, { "database": "PubMed", "id": "33633399", "url": "https://pubmed.ncbi.nlm.nih.gov/33633399" } ], "uniprot_canonical_ac": "Q5VSL9-1" }, { "start_pos": 161, "end_pos": 165, "sequence_org": "RRIYR", "sequence_mut": "EEIYE", "comment": "Decreased formation of STRIPAK core complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y3A3", "url": "https://www.uniprot.org/uniprotkb/Q9Y3A3" }, { "database": "PubMed", "id": "33633399", "url": "https://pubmed.ncbi.nlm.nih.gov/33633399" } ], "uniprot_canonical_ac": "Q9Y3A3-1" }, { "start_pos": 530, "end_pos": 530, "sequence_org": "R", "sequence_mut": "E", "comment": "Decreased interaction with other components of STRIPAK core complex.", "evidence": [ { "database": "UniProtKB", "id": "Q13033", "url": "https://www.uniprot.org/uniprotkb/Q13033" }, { "database": "PubMed", "id": "33633399", "url": "https://pubmed.ncbi.nlm.nih.gov/33633399" } ], "uniprot_canonical_ac": "Q13033-1" } ], "record_id": "pubmed.33633399", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation by mitogen-activated protein kinase mediates the hypoxia-induced turnover of the TAL1/SCL transcription factor in endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Tang T, Arbiser JL, Brandt SJ", "reference": { "type": "PubMed", "id": "11904294", "url": "https://pubmed.ncbi.nlm.nih.gov/11904294" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22091-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1 homolog", "gene_name": "Tal1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "8423803", "url": "https://pubmed.ncbi.nlm.nih.gov/8423803" }, { "database": "PubMed", "id": "11904294", "url": "https://pubmed.ncbi.nlm.nih.gov/11904294" } ], "site_lbl": "Ser122", "uniprot_canonical_ac": "P17542-1" }, { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "Q02750-1", "kinase_gene_name": "MAP2K1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "11904294", "url": "https://pubmed.ncbi.nlm.nih.gov/11904294" } ], "site_lbl": "Ser122", "uniprot_canonical_ac": "P17542-1" }, { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK", "evidence": [ { "database": "UniProtKB", "id": "P22091", "url": "https://www.uniprot.org/uniprotkb/P22091" }, { "database": "iPTMnet", "id": "P22091", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P22091" }, { "database": "PubMed", "id": "10527940", "url": "https://pubmed.ncbi.nlm.nih.gov/10527940" }, { "database": "PubMed", "id": "11904294", "url": "https://pubmed.ncbi.nlm.nih.gov/11904294" }, { "database": "PubMed", "id": "31018977", "url": "https://pubmed.ncbi.nlm.nih.gov/31018977" } ], "site_lbl": "Ser122", "uniprot_canonical_ac": "P22091-1" } ], "mutagenesis": [ { "start_pos": 122, "end_pos": 122, "sequence_org": "S", "sequence_mut": "A", "comment": "Remains stable, even in the face of severe hypoxia.", "evidence": [ { "database": "UniProtKB", "id": "P22091", "url": "https://www.uniprot.org/uniprotkb/P22091" }, { "database": "PubMed", "id": "11904294", "url": "https://pubmed.ncbi.nlm.nih.gov/11904294" } ], "uniprot_canonical_ac": "P22091-1" } ], "record_id": "pubmed.11904294", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SCL gene product: a positive regulator of erythroid differentiation.", "journal": "The EMBO journal", "date": "1992-11", "authors": "Aplan P D, Nakahara K, Orkin S H, Kirsch I R", "reference": { "type": "PubMed", "id": "1396592", "url": "https://pubmed.ncbi.nlm.nih.gov/1396592" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1396592", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Akt phosphorylates Tal1 oncoprotein and inhibits its repressor activity.", "journal": "Cancer research", "date": "2005", "authors": "Palamarchuk A, Efanov A, Maximov V, Aqeilan RI, Croce CM, Pekarsky Y", "reference": { "type": "PubMed", "id": "15930267", "url": "https://pubmed.ncbi.nlm.nih.gov/15930267" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "15930267", "url": "https://pubmed.ncbi.nlm.nih.gov/15930267" } ], "site_lbl": "Thr90", "uniprot_canonical_ac": "P17542-1" }, { "start_pos": 90, "end_pos": 90, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "15930267", "url": "https://pubmed.ncbi.nlm.nih.gov/15930267" } ], "site_lbl": "Thr90", "uniprot_canonical_ac": "P17542-1" } ], "record_id": "pubmed.15930267", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coding sequences of the tal-1 gene are disrupted by chromosome translocation in human T cell leukemia.", "journal": "J. Exp. Med.", "date": "1990", "authors": "Chen Q, Yang C Y, Tsan J T, Xia Y, Ragab A H, Peiper S C, Carroll A, Baer R", "reference": { "type": "PubMed", "id": "2230650", "url": "https://pubmed.ncbi.nlm.nih.gov/2230650" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2230650", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamic interaction between TAL1 oncoprotein and LSD1 regulates TAL1 function in hematopoiesis and leukemogenesis.", "journal": "Oncogene", "date": "2012", "authors": "Li Y, Deng C, Hu X, Patel B, Fu X, Qiu Y, Brand M, Zhao K, Huang S", "reference": { "type": "PubMed", "id": "22310283", "url": "https://pubmed.ncbi.nlm.nih.gov/22310283" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "22310283", "url": "https://pubmed.ncbi.nlm.nih.gov/22310283" } ], "site_lbl": "Ser122", "uniprot_canonical_ac": "P17542-1" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "22310283", "url": "https://pubmed.ncbi.nlm.nih.gov/22310283" } ], "site_lbl": "Ser172", "uniprot_canonical_ac": "P17542-1" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" }, { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "9111058", "url": "https://pubmed.ncbi.nlm.nih.gov/9111058" }, { "database": "PubMed", "id": "22310283", "url": "https://pubmed.ncbi.nlm.nih.gov/22310283" } ], "site_lbl": "Ser172", "uniprot_canonical_ac": "P17542-1" } ], "record_id": "pubmed.22310283", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SCL gene is formed from a transcriptionally complex locus.", "journal": "Mol. Cell. Biol.", "date": "1990", "authors": "Aplan PD, Begley CG, Bertness V, Nussmeier M, Ezquerra A, Coligan J, Kirsch IR", "reference": { "type": "PubMed", "id": "2247063", "url": "https://pubmed.ncbi.nlm.nih.gov/2247063" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2247063", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The tal gene undergoes chromosome translocation in T cell leukemia and potentially encodes a helix-loop-helix protein.", "journal": "EMBO J.", "date": "1990", "authors": "Chen Q, Cheng JT, Tasi LH, Schneider N, Buchanan G, Carroll A, Crist W, Ozanne B, Siciliano MJ, Baer R", "reference": { "type": "PubMed", "id": "2303035", "url": "https://pubmed.ncbi.nlm.nih.gov/2303035" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2303035", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The gene SCL is expressed during early hematopoiesis and encodes a differentiation-related DNA-binding motif.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1989", "authors": "Begley C G, Aplan P D, Denning S M, Haynes B F, Waldmann T A, Kirsch I R", "reference": { "type": "PubMed", "id": "2602361", "url": "https://pubmed.ncbi.nlm.nih.gov/2602361" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2602361", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of a GATA2-TAL1-ERG regulatory circuit promotes erythroid transition in healthy and leukemic stem cells.", "journal": "Blood", "date": "2021", "authors": "Thoms JAI, Truong P, Subramanian S, Knezevic K, Harvey G, Huang Y, Seneviratne JA, Carter DR, Joshi S, Skhinas J, Chacon D, Shah A, de Jong I, Beck D, Gottgens B, Larsson J, Wong JWH, Zanini F, Pimanda JE", "reference": { "type": "PubMed", "id": "34075404", "url": "https://pubmed.ncbi.nlm.nih.gov/34075404" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34075404", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TAL1 activation in T-Cell acute lymphoblastic leukemia: A novel oncogenic 3' neoenhancer.", "journal": "Haematologica", "date": "2023-01-12", "authors": "Smith Charlotte, Goyal Ashish, Weichenhan Dieter, Allemand Eric, Mayakonda Anand, Toprak Umut, Riedel Anna, Balducci Estelle, Manojkumar Manisha, Pejkovska Anastasija, M\u00fccke Oliver, Sollier Etienne, Bakr Ali, Breuer Kersten, Lutsik Pavlo, Hermine Olivier, Spicuglia Salvatore, Asnafi Vahid, Plass Christoph, Touzart Aurore", "reference": { "type": "PubMed", "id": "36632736", "url": "https://pubmed.ncbi.nlm.nih.gov/36632736" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36632736", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Suppression of super-enhancer-driven TAL1 expression by KLF4 in T-cell acute lymphoblastic leukemia.", "journal": "Oncogene", "date": "2024-02", "authors": "Noura Mina, Matsuo Hidemasa, Yasuda Takahiko, Tsuzuki Shinobu, Kiyoi Hitoshi, Hayakawa Fumihiko", "reference": { "type": "PubMed", "id": "38102337", "url": "https://pubmed.ncbi.nlm.nih.gov/38102337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38102337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The MAP kinase phosphorylation site of TAL1 occurs within a transcriptional activation domain.", "journal": "Oncogene", "date": "1994", "authors": "Wadman IA, Hsu HL, Cobb MH, Baer R", "reference": { "type": "PubMed", "id": "7970731", "url": "https://pubmed.ncbi.nlm.nih.gov/7970731" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "7970731", "url": "https://pubmed.ncbi.nlm.nih.gov/7970731" } ], "site_lbl": "Ser122", "uniprot_canonical_ac": "P17542-1" } ], "record_id": "pubmed.7970731", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of the TAL1 oncoprotein by the extracellular-signal-regulated protein kinase ERK1.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Cheng JT, Cobb MH, Baer R", "reference": { "type": "PubMed", "id": "8423803", "url": "https://pubmed.ncbi.nlm.nih.gov/8423803" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "8423803", "url": "https://pubmed.ncbi.nlm.nih.gov/8423803" }, { "database": "PubMed", "id": "11904294", "url": "https://pubmed.ncbi.nlm.nih.gov/11904294" } ], "site_lbl": "Ser122", "uniprot_canonical_ac": "P17542-1" } ], "record_id": "pubmed.8423803", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Products of the TAL1 oncogene: basic helix-loop-helix proteins phosphorylated at serine residues.", "journal": "Oncogene", "date": "1993", "authors": "Cheng J T, Hsu H L, Hwang L Y, Baer R", "reference": { "type": "PubMed", "id": "8437851", "url": "https://pubmed.ncbi.nlm.nih.gov/8437851" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8437851", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Target-dependent effect of phosphorylation on the DNA binding activity of the TAL1/SCL oncoprotein.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Prasad KS, Brandt SJ", "reference": { "type": "PubMed", "id": "9111058", "url": "https://pubmed.ncbi.nlm.nih.gov/9111058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17542-1", "protein_name": "T-cell acute lymphocytic leukemia protein 1", "gene_name": "TAL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P17542", "url": "https://www.uniprot.org/uniprotkb/P17542" }, { "database": "iPTMnet", "id": "P17542", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17542" }, { "database": "PubMed", "id": "9111058", "url": "https://pubmed.ncbi.nlm.nih.gov/9111058" }, { "database": "PubMed", "id": "22310283", "url": "https://pubmed.ncbi.nlm.nih.gov/22310283" } ], "site_lbl": "Ser172", "uniprot_canonical_ac": "P17542-1" } ], "record_id": "pubmed.9111058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Werner helicase-interacting protein 1 binds polyubiquitin via its zinc finger domain.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Bish RA, Myers MP", "reference": { "type": "PubMed", "id": "17550899", "url": "https://pubmed.ncbi.nlm.nih.gov/17550899" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S55-1", "protein_name": "ATPase WRNIP1", "gene_name": "WRNIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17550899", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Wrnip1 is localized in replication factories in a ubiquitin-binding zinc finger-dependent manner.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Crosetto Nicola, Bienko Marzena, Hibbert Richard G, Perica Tina, Ambrogio Chiara, Kensche Tobias, Hofmann Kay, Sixma Titia K, Dikic Ivan", "reference": { "type": "PubMed", "id": "18842586", "url": "https://pubmed.ncbi.nlm.nih.gov/18842586" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S55-1", "protein_name": "ATPase WRNIP1", "gene_name": "WRNIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18842586", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel mode of ubiquitin recognition by the ubiquitin-binding zinc finger domain of WRNIP1.", "journal": "The FEBS journal", "date": "2016", "authors": "Suzuki N, Rohaim A, Kato R, Dikic I, Wakatsuki S, Kawasaki M", "reference": { "type": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S55-1", "protein_name": "ATPase WRNIP1", "gene_name": "WRNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VP1-1", "protein_name": "Tax1-binding protein 1", "gene_name": "TAX1BP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y253-1", "protein_name": "DNA polymerase eta", "gene_name": "POLH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 18, "end_pos": 18, "sequence_org": "V", "sequence_mut": "A", "comment": "Reduced affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 21, "end_pos": 21, "sequence_org": "P", "sequence_mut": "A", "comment": "Loss of affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 22, "end_pos": 22, "sequence_org": "V", "sequence_mut": "A", "comment": "Reduced affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 32, "end_pos": 32, "sequence_org": "I", "sequence_mut": "A", "comment": "Loss of affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 33, "end_pos": 33, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 36, "end_pos": 36, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 37, "end_pos": 37, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 40, "end_pos": 40, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 41, "end_pos": 41, "sequence_org": "L", "sequence_mut": "A", "comment": "Normal affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 42, "end_pos": 42, "sequence_org": "L", "sequence_mut": "A", "comment": "Normal affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 44, "end_pos": 44, "sequence_org": "P", "sequence_mut": "A", "comment": "Normal affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q96S55-1" }, { "start_pos": 771, "end_pos": 771, "sequence_org": "Q", "sequence_mut": "A", "comment": "Normal affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q86VP1", "url": "https://www.uniprot.org/uniprotkb/Q86VP1" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q86VP1-1" }, { "start_pos": 774, "end_pos": 774, "sequence_org": "E", "sequence_mut": "A", "comment": "Reduced affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q86VP1", "url": "https://www.uniprot.org/uniprotkb/Q86VP1" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q86VP1-1" }, { "start_pos": 775, "end_pos": 775, "sequence_org": "R", "sequence_mut": "A", "comment": "Normal affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q86VP1", "url": "https://www.uniprot.org/uniprotkb/Q86VP1" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q86VP1-1" }, { "start_pos": 777, "end_pos": 777, "sequence_org": "V", "sequence_mut": "S", "comment": "Reduced affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q86VP1", "url": "https://www.uniprot.org/uniprotkb/Q86VP1" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q86VP1-1" }, { "start_pos": 778, "end_pos": 778, "sequence_org": "Q", "sequence_mut": "A", "comment": "Reduced affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q86VP1", "url": "https://www.uniprot.org/uniprotkb/Q86VP1" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q86VP1-1" }, { "start_pos": 781, "end_pos": 781, "sequence_org": "F", "sequence_mut": "A", "comment": "Reduced affinity for ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q86VP1", "url": "https://www.uniprot.org/uniprotkb/Q86VP1" }, { "database": "PubMed", "id": "27062441", "url": "https://pubmed.ncbi.nlm.nih.gov/27062441" } ], "uniprot_canonical_ac": "Q86VP1-1" } ], "record_id": "pubmed.27062441", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discovering the nuclear localization signal of Werner Helicase Interacting Protein 1.", "journal": "Biochimica et biophysica acta. Molecular cell research", "date": "2023-10", "authors": "Jordan Benjamin R, Zhai Yujia, Li Zhi, Zhao Haoshuang, Mackmull Marie-Therese, Glavy Joseph S", "reference": { "type": "PubMed", "id": "37268023", "url": "https://pubmed.ncbi.nlm.nih.gov/37268023" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S55-1", "protein_name": "ATPase WRNIP1", "gene_name": "WRNIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37268023", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AXL/WRNIP1 Mediates Replication Stress Response and Promotes Therapy Resistance and Metachronous Metastasis in HER2+ Breast Cancer.", "journal": "Cancer research", "date": "2024-03-04", "authors": "Marquez-Palencia Mauricio, Reza Herrera Luis, Parida Pravat Kumar, Ghosh Suvranil, Kim Kangsan, Das Nikitha M, Gonzalez-Ericsson Paula I, Sanders Melinda E, Mobley Bret C, Diegeler Sebastian, Aguilera Todd A, Peng Yan, Lewis Cheryl M, Arteaga Carlos L, Hanker Ariella B, Whitehurst Angelique W, Lorens James B, Brekken Rolf A, Davis Anthony J, Malladi Srinivas", "reference": { "type": "PubMed", "id": "38190717", "url": "https://pubmed.ncbi.nlm.nih.gov/38190717" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S55-1", "protein_name": "ATPase WRNIP1", "gene_name": "WRNIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38190717", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "WRNIP1 prevents transcription-associated genomic instability.", "journal": "eLife", "date": "2024-03-15", "authors": "Valenzisi Pasquale, Marabitti Veronica, Pichierri Pietro, Franchitto Annapaola", "reference": { "type": "PubMed", "id": "38488661", "url": "https://pubmed.ncbi.nlm.nih.gov/38488661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S55-1", "protein_name": "ATPase WRNIP1", "gene_name": "WRNIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38488661", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Werner helicase interacting protein 1 contributes to G-quadruplex processing in human cells.", "journal": "Scientific reports", "date": "2024-07-08", "authors": "Hegedus Lili, Toth Agnes, Harami Gabor M, Palinkas Janos, Karatayeva Nargis, Sajben-Nagy Eniko, Bene Szabolcs, Afzali Jaktajdinani Sara, Kovacs Mihaly, Juhasz Szilvia, Burkovics Peter", "reference": { "type": "PubMed", "id": "38977862", "url": "https://pubmed.ncbi.nlm.nih.gov/38977862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96S55-1", "protein_name": "ATPase WRNIP1", "gene_name": "WRNIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96S55", "url": "https://www.uniprot.org/uniprotkb/Q96S55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38977862", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and functional characterization of KCC3, a new K-Cl cotransporter.", "journal": "The American journal of physiology", "date": "1999", "authors": "Race JE, Makhlouf FN, Logue PJ, Wilson FH, Dunham PB, Holtzman EJ", "reference": { "type": "PubMed", "id": "10600773", "url": "https://pubmed.ncbi.nlm.nih.gov/10600773" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55017-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "SLC12A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHW9-1", "protein_name": "Solute carrier family 12 member 6", "gene_name": "SLC12A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2X9-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13621-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "SLC12A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP95-1", "protein_name": "Solute carrier family 12 member 4", "gene_name": "SLC12A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y666-1", "protein_name": "Solute carrier family 12 member 7", "gene_name": "SLC12A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10600773", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Quantitation of Na(+)-K(+)-2Cl(-) cotransport splice variants in human tissues using kinetic polymerase chain reaction.", "journal": "Anal. Biochem.", "date": "2001", "authors": "Vibat C R, Holland M J, Kang J J, Putney L K, O'Donnell M E", "reference": { "type": "PubMed", "id": "11700976", "url": "https://pubmed.ncbi.nlm.nih.gov/11700976" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11700976", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular, functional, and genomic characterization of human KCC2, the neuronal K-Cl cotransporter.", "journal": "Brain research. Molecular brain research", "date": "2002", "authors": "Song L, Mercado A, Vazquez N, Xie Q, Desai R, George AL Jr, Gamba G, Mount DB", "reference": { "type": "PubMed", "id": "12106695", "url": "https://pubmed.ncbi.nlm.nih.gov/12106695" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55017-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "SLC12A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHW9-1", "protein_name": "Solute carrier family 12 member 6", "gene_name": "SLC12A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2X9-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13621-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "SLC12A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP95-1", "protein_name": "Solute carrier family 12 member 4", "gene_name": "SLC12A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y666-1", "protein_name": "Solute carrier family 12 member 7", "gene_name": "SLC12A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9WVL3-1", "protein_name": "Solute carrier family 12 member 7", "gene_name": "Slc12a7", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12106695", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A regulatory locus of phosphorylation in the N terminus of the Na-K-Cl cotransporter, NKCC1.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Darman RB, Forbush B", "reference": { "type": "PubMed", "id": "12145304", "url": "https://pubmed.ncbi.nlm.nih.gov/12145304" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "O95747-1", "kinase_gene_name": "OXSR1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "12145304", "url": "https://pubmed.ncbi.nlm.nih.gov/12145304" } ], "site_lbl": "Thr203", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "O95747-1", "kinase_gene_name": "OXSR1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "12145304", "url": "https://pubmed.ncbi.nlm.nih.gov/12145304" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.12145304", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of the Na-K-Cl cotransporter NKCC1 detected with a phospho-specific antibody.", "journal": "The Journal of biological chemistry", "date": "2002-10-04", "authors": "Flemmer Andreas W, Gimenez Ignacio, Dowd Brian F X, Darman Rachel B, Forbush Biff", "reference": { "type": "PubMed", "id": "12145305", "url": "https://pubmed.ncbi.nlm.nih.gov/12145305" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by OXSR1 and STK39", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "24702155", "url": "https://pubmed.ncbi.nlm.nih.gov/24702155" }, { "database": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, { "database": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "12145305", "url": "https://pubmed.ncbi.nlm.nih.gov/12145305" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 217, "end_pos": 217, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "12145305", "url": "https://pubmed.ncbi.nlm.nih.gov/12145305" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "24702155", "url": "https://pubmed.ncbi.nlm.nih.gov/24702155" }, { "database": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" } ], "site_lbl": "Thr217", "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.12145305", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The antihypertensive actions of benzothiadiazines.", "journal": "Circulation", "date": "1961", "authors": "WINER BM", "reference": { "type": "PubMed", "id": "13785791", "url": "https://pubmed.ncbi.nlm.nih.gov/13785791" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55017-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "SLC12A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHW9-1", "protein_name": "Solute carrier family 12 member 6", "gene_name": "SLC12A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2X9-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13621-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "SLC12A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP95-1", "protein_name": "Solute carrier family 12 member 4", "gene_name": "SLC12A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y666-1", "protein_name": "Solute carrier family 12 member 7", "gene_name": "SLC12A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.13785791", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "WNK3 modulates transport of Cl- in and out of cells: implications for control of cell volume and neuronal excitability.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Kahle KT, Rinehart J, de Los Heros P, Louvi A, Meade P, Vazquez N, Hebert SC, Gamba G, Gimenez I, Lifton RP", "reference": { "type": "PubMed", "id": "16275911", "url": "https://pubmed.ncbi.nlm.nih.gov/16275911" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80XP9-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "Wnk3", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "Q9BYP7-1", "kinase_gene_name": "WNK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16275911", "url": "https://pubmed.ncbi.nlm.nih.gov/16275911" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 217, "end_pos": 217, "kinase_uniprot_canonical_ac": "Q9BYP7-1", "kinase_gene_name": "WNK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16275911", "url": "https://pubmed.ncbi.nlm.nih.gov/16275911" } ], "site_lbl": "Thr217", "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.16275911", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of SPAK and OSR1, regulatory kinases of the Na-K-2Cl cotransporter.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Gagnon KB, England R, Delpire E", "reference": { "type": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UEW8-1", "protein_name": "STE20/SPS1-related proline-alanine-rich protein kinase", "gene_name": "STK39", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z1W9-1", "protein_name": "STE20/SPS1-related proline-alanine-rich protein kinase", "gene_name": "Stk39", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P55012-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "Slc12a2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6P9R2-1", "protein_name": "Serine/threonine-protein kinase OSR1", "gene_name": "Oxsr1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr203", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 207, "end_pos": 207, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr207", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 231, "end_pos": 231, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UEW8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UEW8" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" } ], "site_lbl": "Thr231", "uniprot_canonical_ac": "Q9UEW8-1" }, { "start_pos": 235, "end_pos": 235, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UEW8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UEW8" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" } ], "site_lbl": "Thr235", "uniprot_canonical_ac": "Q9UEW8-1" }, { "start_pos": 243, "end_pos": 243, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by WNK4", "evidence": [ { "database": "UniProtKB", "id": "Q9Z1W9", "url": "https://www.uniprot.org/uniprotkb/Q9Z1W9" }, { "database": "iPTMnet", "id": "Q9Z1W9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z1W9" }, { "database": "PubMed", "id": "16530727", "url": "https://pubmed.ncbi.nlm.nih.gov/16530727" }, { "database": "PubMed", "id": "21486947", "url": "https://pubmed.ncbi.nlm.nih.gov/21486947" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" } ], "site_lbl": "Thr243", "uniprot_canonical_ac": "Q9Z1W9-1" }, { "start_pos": 247, "end_pos": 247, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z1W9", "url": "https://www.uniprot.org/uniprotkb/Q9Z1W9" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "iPTMnet", "id": "Q9Z1W9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z1W9" } ], "site_lbl": "Thr247", "uniprot_canonical_ac": "Q9Z1W9-1" } ], "mutagenesis": [ { "start_pos": 243, "end_pos": 243, "sequence_org": "T", "sequence_mut": "A", "comment": "Impaired phosphorylation by WNK4 and activation. Abolished ability to activate SLC12A2/NKCC1. Knockin mice are unable to activate SLC12A3/NCC.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z1W9", "url": "https://www.uniprot.org/uniprotkb/Q9Z1W9" }, { "database": "PubMed", "id": "21486947", "url": "https://pubmed.ncbi.nlm.nih.gov/21486947" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" } ], "uniprot_canonical_ac": "Q9Z1W9-1" }, { "start_pos": 247, "end_pos": 247, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolished ability to activate SLC12A2/NKCC1.", "evidence": [ { "database": "UniProtKB", "id": "Q9Z1W9", "url": "https://www.uniprot.org/uniprotkb/Q9Z1W9" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" } ], "uniprot_canonical_ac": "Q9Z1W9-1" } ], "record_id": "pubmed.16382158", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRAIL-induced cleavage and inactivation of SPAK sensitizes cells to apoptosis.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Polek TC, Talpaz M, Spivak-Kroizman TR", "reference": { "type": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UEW8-1", "protein_name": "STE20/SPS1-related proline-alanine-rich protein kinase", "gene_name": "STK39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr203", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 207, "end_pos": 207, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr207", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 231, "end_pos": 231, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UEW8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UEW8" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" } ], "site_lbl": "Thr231", "uniprot_canonical_ac": "Q9UEW8-1" }, { "start_pos": 235, "end_pos": 235, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9UEW8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UEW8" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" } ], "site_lbl": "Thr235", "uniprot_canonical_ac": "Q9UEW8-1" } ], "record_id": "pubmed.16950202", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of the WNK-activated SPAK kinase in regulating blood pressure.", "journal": "EMBO molecular medicine", "date": "2010", "authors": "Rafiqi FH, Zuber AM, Glover M, Richardson C, Fleming S, Jovanovic S, Jovanovic A, O'Shaughnessy KM, Alessi DR", "reference": { "type": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55017-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "SLC12A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13621-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "SLC12A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z1W9-1", "protein_name": "STE20/SPS1-related proline-alanine-rich protein kinase", "gene_name": "Stk39", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P59158-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "Slc12a3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P55014-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "Slc12a1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr203", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 207, "end_pos": 207, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr207", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55017", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55017" }, { "database": "PubMed", "id": "18270262", "url": "https://pubmed.ncbi.nlm.nih.gov/18270262" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr46", "uniprot_canonical_ac": "P55017-1" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55017", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55017" }, { "database": "PubMed", "id": "18270262", "url": "https://pubmed.ncbi.nlm.nih.gov/18270262" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr55", "uniprot_canonical_ac": "P55017-1" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55017", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55017" }, { "database": "PubMed", "id": "18270262", "url": "https://pubmed.ncbi.nlm.nih.gov/18270262" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr60", "uniprot_canonical_ac": "P55017-1" }, { "start_pos": 91, "end_pos": 91, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55017", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55017" }, { "database": "PubMed", "id": "18270262", "url": "https://pubmed.ncbi.nlm.nih.gov/18270262" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Ser91", "uniprot_canonical_ac": "P55017-1" }, { "start_pos": 100, "end_pos": 100, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13621", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13621" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21321328", "url": "https://pubmed.ncbi.nlm.nih.gov/21321328" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr100", "uniprot_canonical_ac": "Q13621-1" }, { "start_pos": 105, "end_pos": 105, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13621", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13621" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21321328", "url": "https://pubmed.ncbi.nlm.nih.gov/21321328" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr105", "uniprot_canonical_ac": "Q13621-1" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13621", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13621" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21321328", "url": "https://pubmed.ncbi.nlm.nih.gov/21321328" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr95", "uniprot_canonical_ac": "Q13621-1" }, { "start_pos": 383, "end_pos": 383, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9Z1W9", "url": "https://www.uniprot.org/uniprotkb/Q9Z1W9" }, { "database": "PubMed", "id": "21733846", "url": "https://pubmed.ncbi.nlm.nih.gov/21733846" }, { "database": "iPTMnet", "id": "Q9Z1W9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Z1W9" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" } ], "site_lbl": "Ser383", "uniprot_canonical_ac": "Q9Z1W9-1" }, { "start_pos": 53, "end_pos": 53, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P59158", "url": "https://www.uniprot.org/uniprotkb/P59158" }, { "database": "PubMed", "id": "16263722", "url": "https://pubmed.ncbi.nlm.nih.gov/16263722" }, { "database": "PubMed", "id": "21183079", "url": "https://pubmed.ncbi.nlm.nih.gov/21183079" }, { "database": "iPTMnet", "id": "P59158", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P59158" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "24761002", "url": "https://pubmed.ncbi.nlm.nih.gov/24761002" }, { "database": "PubMed", "id": "28940314", "url": "https://pubmed.ncbi.nlm.nih.gov/28940314" }, { "database": "PubMed", "id": "29483225", "url": "https://pubmed.ncbi.nlm.nih.gov/29483225" } ], "site_lbl": "Thr53", "uniprot_canonical_ac": "P59158-1" }, { "start_pos": 58, "end_pos": 58, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P59158", "url": "https://www.uniprot.org/uniprotkb/P59158" }, { "database": "PubMed", "id": "21183079", "url": "https://pubmed.ncbi.nlm.nih.gov/21183079" }, { "database": "PubMed", "id": "16263722", "url": "https://pubmed.ncbi.nlm.nih.gov/16263722" }, { "database": "iPTMnet", "id": "P59158", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P59158" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "35557966", "url": "https://pubmed.ncbi.nlm.nih.gov/35557966" } ], "site_lbl": "Thr58", "uniprot_canonical_ac": "P59158-1" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P59158", "url": "https://www.uniprot.org/uniprotkb/P59158" }, { "database": "iPTMnet", "id": "P59158", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P59158" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" } ], "site_lbl": "Ser89", "uniprot_canonical_ac": "P59158-1" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P55014", "url": "https://www.uniprot.org/uniprotkb/P55014" }, { "database": "PubMed", "id": "21183079", "url": "https://pubmed.ncbi.nlm.nih.gov/21183079" }, { "database": "PubMed", "id": "21321328", "url": "https://pubmed.ncbi.nlm.nih.gov/21321328" }, { "database": "PubMed", "id": "25967121", "url": "https://pubmed.ncbi.nlm.nih.gov/25967121" }, { "database": "iPTMnet", "id": "P55014", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55014" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "27213818", "url": "https://pubmed.ncbi.nlm.nih.gov/27213818" }, { "database": "PubMed", "id": "27681558", "url": "https://pubmed.ncbi.nlm.nih.gov/27681558" }, { "database": "PubMed", "id": "31444371", "url": "https://pubmed.ncbi.nlm.nih.gov/31444371" }, { "database": "PubMed", "id": "34114742", "url": "https://pubmed.ncbi.nlm.nih.gov/34114742" } ], "site_lbl": "Thr96", "uniprot_canonical_ac": "P55014-1" } ], "record_id": "pubmed.20091762", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 15 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stimulation of human and mouse erythrocyte Na(+)-K(+)-2Cl(-) cotransport by osmotic shrinkage does not involve AMP-activated protein kinase, but is associated with STE20/SPS1-related proline/alanine-rich kinase activation.", "journal": "The Journal of physiology", "date": "2010", "authors": "Sid B, Miranda L, Vertommen D, Viollet B, Rider MH", "reference": { "type": "PubMed", "id": "20442269", "url": "https://pubmed.ncbi.nlm.nih.gov/20442269" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 242, "end_pos": 242, "kinase_uniprot_canonical_ac": "P54646-1", "kinase_gene_name": "PRKAA2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "20442269", "url": "https://pubmed.ncbi.nlm.nih.gov/20442269" } ], "site_lbl": "Ser242", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "P54646-1", "kinase_gene_name": "PRKAA2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "20442269", "url": "https://pubmed.ncbi.nlm.nih.gov/20442269" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.20442269", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MO25 is a master regulator of SPAK/OSR1 and MST3/MST4/YSK1 protein kinases.", "journal": "The EMBO journal", "date": "2011", "authors": "Filippi BM, de los Heros P, Mehellou Y, Navratilova I, Gourlay R, Deak M, Plater L, Toth R, Zeqiraj E, Alessi DR", "reference": { "type": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55017-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "SLC12A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13621-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "SLC12A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr203", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 207, "end_pos": 207, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr207", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "16382158", "url": "https://pubmed.ncbi.nlm.nih.gov/16382158" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "16950202", "url": "https://pubmed.ncbi.nlm.nih.gov/16950202" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55017", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55017" }, { "database": "PubMed", "id": "18270262", "url": "https://pubmed.ncbi.nlm.nih.gov/18270262" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr46", "uniprot_canonical_ac": "P55017-1" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55017", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55017" }, { "database": "PubMed", "id": "18270262", "url": "https://pubmed.ncbi.nlm.nih.gov/18270262" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr55", "uniprot_canonical_ac": "P55017-1" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55017", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55017" }, { "database": "PubMed", "id": "18270262", "url": "https://pubmed.ncbi.nlm.nih.gov/18270262" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr60", "uniprot_canonical_ac": "P55017-1" }, { "start_pos": 91, "end_pos": 91, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55017", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55017" }, { "database": "PubMed", "id": "18270262", "url": "https://pubmed.ncbi.nlm.nih.gov/18270262" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Ser91", "uniprot_canonical_ac": "P55017-1" }, { "start_pos": 100, "end_pos": 100, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13621", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13621" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21321328", "url": "https://pubmed.ncbi.nlm.nih.gov/21321328" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr100", "uniprot_canonical_ac": "Q13621-1" }, { "start_pos": 105, "end_pos": 105, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13621", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13621" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21321328", "url": "https://pubmed.ncbi.nlm.nih.gov/21321328" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr105", "uniprot_canonical_ac": "Q13621-1" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "Q9UEW8-1", "kinase_gene_name": "STK39", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13621", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13621" }, { "database": "PubMed", "id": "20091762", "url": "https://pubmed.ncbi.nlm.nih.gov/20091762" }, { "database": "PubMed", "id": "21321328", "url": "https://pubmed.ncbi.nlm.nih.gov/21321328" }, { "database": "PubMed", "id": "21423148", "url": "https://pubmed.ncbi.nlm.nih.gov/21423148" } ], "site_lbl": "Thr95", "uniprot_canonical_ac": "Q13621-1" } ], "record_id": "pubmed.21423148", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Similar Effects of all WNK3 Variants upon SLC12 Cotransporters.", "journal": "Am. J. Physiol.", "date": "2011", "authors": "Cruz-Rangel S, Melo Z, Vazquez N, Meade P, Bobadilla NA, Pasantes-Morales H, Gamba G, Mercado A", "reference": { "type": "PubMed", "id": "21613606", "url": "https://pubmed.ncbi.nlm.nih.gov/21613606" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55017-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "SLC12A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHW9-1", "protein_name": "Solute carrier family 12 member 6", "gene_name": "SLC12A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2X9-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13621-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "SLC12A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYP7-1", "protein_name": "Serine/threonine-protein kinase WNK3", "gene_name": "WNK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP95-1", "protein_name": "Solute carrier family 12 member 4", "gene_name": "SLC12A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y666-1", "protein_name": "Solute carrier family 12 member 7", "gene_name": "SLC12A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 294, "end_pos": 294, "sequence_org": "D", "sequence_mut": "A", "comment": "Catalytically inactive form. Inhibits sodium-coupled chloride cotransporters and activates potassium-coupled chloride cotransporters.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYP7", "url": "https://www.uniprot.org/uniprotkb/Q9BYP7" }, { "database": "PubMed", "id": "16275913", "url": "https://pubmed.ncbi.nlm.nih.gov/16275913" }, { "database": "PubMed", "id": "21613606", "url": "https://pubmed.ncbi.nlm.nih.gov/21613606" } ], "uniprot_canonical_ac": "Q9BYP7-1" } ], "record_id": "pubmed.21613606", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of AMPK reduces the co-transporter activity of NKCC1.", "journal": "Molecular membrane biology", "date": "2014", "authors": "Fraser SA, Davies M, Katerelos M, Gleich K, Choy SW, Steel R, Galic S, Mount PF, Kemp BE, Power DA", "reference": { "type": "PubMed", "id": "24702155", "url": "https://pubmed.ncbi.nlm.nih.gov/24702155" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by OXSR1 and STK39", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "24702155", "url": "https://pubmed.ncbi.nlm.nih.gov/24702155" }, { "database": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, { "database": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "12145305", "url": "https://pubmed.ncbi.nlm.nih.gov/12145305" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 217, "end_pos": 217, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "12145305", "url": "https://pubmed.ncbi.nlm.nih.gov/12145305" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "24702155", "url": "https://pubmed.ncbi.nlm.nih.gov/24702155" }, { "database": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" } ], "site_lbl": "Thr217", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "Q13131-1", "kinase_gene_name": "PRKAA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "24702155", "url": "https://pubmed.ncbi.nlm.nih.gov/24702155" } ], "site_lbl": "Ser77", "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.24702155", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional kinomics establishes a critical node of volume-sensitive cation-Cl(-) cotransporter regulation in the mammalian brain.", "journal": "Scientific reports", "date": "2016", "authors": "Zhang J, Gao G, Begum G, Wang J, Khanna AR, Shmukler BE, Daubner GM, de Los Heros P, Davies P, Varghese J, Bhuiyan MI, Duan J, Zhang J, Duran D, Alper SL, Sun D, Elledge SJ, Alessi DR, Kahle KT", "reference": { "type": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHW9-1", "protein_name": "Solute carrier family 12 member 6", "gene_name": "SLC12A6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by OXSR1 and STK39", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, { "database": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" } ], "site_lbl": "Thr203", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 207, "end_pos": 207, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by OXSR1 and STK39", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" } ], "site_lbl": "Thr207", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by OXSR1 and STK39", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "24702155", "url": "https://pubmed.ncbi.nlm.nih.gov/24702155" }, { "database": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, { "database": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "12145305", "url": "https://pubmed.ncbi.nlm.nih.gov/12145305" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 1048, "end_pos": 1048, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by OXSR1 and STK39", "evidence": [ { "database": "UniProtKB", "id": "Q9UHW9", "url": "https://www.uniprot.org/uniprotkb/Q9UHW9" }, { "database": "iPTMnet", "id": "Q9UHW9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UHW9" }, { "database": "PubMed", "id": "24043619", "url": "https://pubmed.ncbi.nlm.nih.gov/24043619" }, { "database": "PubMed", "id": "24393035", "url": "https://pubmed.ncbi.nlm.nih.gov/24393035" }, { "database": "PubMed", "id": "26217182", "url": "https://pubmed.ncbi.nlm.nih.gov/26217182" }, { "database": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, { "database": "PubMed", "id": "19665974", "url": "https://pubmed.ncbi.nlm.nih.gov/19665974" } ], "site_lbl": "Thr1048", "uniprot_canonical_ac": "Q9UHW9-1" }, { "start_pos": 991, "end_pos": 991, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by OXSR1 and STK39", "evidence": [ { "database": "UniProtKB", "id": "Q9UHW9", "url": "https://www.uniprot.org/uniprotkb/Q9UHW9" }, { "database": "iPTMnet", "id": "Q9UHW9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9UHW9" }, { "database": "PubMed", "id": "24043619", "url": "https://pubmed.ncbi.nlm.nih.gov/24043619" }, { "database": "PubMed", "id": "24393035", "url": "https://pubmed.ncbi.nlm.nih.gov/24393035" }, { "database": "PubMed", "id": "26217182", "url": "https://pubmed.ncbi.nlm.nih.gov/26217182" }, { "database": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, { "database": "PubMed", "id": "27485015", "url": "https://pubmed.ncbi.nlm.nih.gov/27485015" }, { "database": "PubMed", "id": "34031912", "url": "https://pubmed.ncbi.nlm.nih.gov/34031912" }, { "database": "PubMed", "id": "19665974", "url": "https://pubmed.ncbi.nlm.nih.gov/19665974" } ], "site_lbl": "Thr991", "uniprot_canonical_ac": "Q9UHW9-1" } ], "record_id": "pubmed.27782176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kilquist syndrome: A novel syndromic hearing loss disorder caused by homozygous deletion of SLC12A2.", "journal": "Hum. Mutat.", "date": "2019", "authors": "Macnamara Ellen F, Koehler Alanna E, D'Souza Precilla, Estwick Tyra, Lee Paul, Vezina Gilbert, , Fauni Harper, Braddock Stephen R, Torti Erin, Holt James Matthew, Sharma Prashant, Malicdan May Christine V, Tifft Cynthia J", "reference": { "type": "PubMed", "id": "30740830", "url": "https://pubmed.ncbi.nlm.nih.gov/30740830" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30740830", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the human cation-chloride cotransporter NKCC1 determined by single-particle electron cryo-microscopy.", "journal": "Nature communications", "date": "2020", "authors": "Yang X, Wang Q, Cao E", "reference": { "type": "PubMed", "id": "32081947", "url": "https://pubmed.ncbi.nlm.nih.gov/32081947" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 294, "end_pos": 294, "sequence_org": "R", "sequence_mut": "A", "comment": "Severely impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "32081947", "url": "https://pubmed.ncbi.nlm.nih.gov/32081947" } ], "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.32081947", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Variants encoding a restricted carboxy-terminal domain of SLC12A2 cause hereditary hearing loss in humans.", "journal": "PLoS genetics", "date": "2020", "authors": "Mutai H, Wasano K, Momozawa Y, Kamatani Y, Miya F, Masuda S, Morimoto N, Nara K, Takahashi S, Tsunoda T, Homma K, Kubo M, Matsunaga T", "reference": { "type": "PubMed", "id": "32294086", "url": "https://pubmed.ncbi.nlm.nih.gov/32294086" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55012-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "Slc12a2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32294086", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Staurosporine and NEM mainly impair WNK-SPAK/OSR1 mediated phosphorylation of KCC2 and NKCC1.", "journal": "PloS one", "date": "2020", "authors": "Zhang Jinwei, Cordshagen Antje, Medina Igor, Nothwang Hans Gerd, Wisniewski Jacek R, Winklhofer Michael, Hartmann Anna-Maria", "reference": { "type": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by OXSR1 and STK39", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, { "database": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" } ], "site_lbl": "Thr203", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by OXSR1 and STK39", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "24702155", "url": "https://pubmed.ncbi.nlm.nih.gov/24702155" }, { "database": "PubMed", "id": "27782176", "url": "https://pubmed.ncbi.nlm.nih.gov/27782176" }, { "database": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" }, { "database": "PubMed", "id": "16669787", "url": "https://pubmed.ncbi.nlm.nih.gov/16669787" }, { "database": "PubMed", "id": "12145305", "url": "https://pubmed.ncbi.nlm.nih.gov/12145305" } ], "site_lbl": "Thr212", "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 217, "end_pos": 217, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "12145305", "url": "https://pubmed.ncbi.nlm.nih.gov/12145305" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P55011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55011" }, { "database": "PubMed", "id": "24702155", "url": "https://pubmed.ncbi.nlm.nih.gov/24702155" }, { "database": "PubMed", "id": "32413057", "url": "https://pubmed.ncbi.nlm.nih.gov/32413057" } ], "site_lbl": "Thr217", "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.32413057", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLC12A2 variants cause a neurodevelopmental disorder or cochleovestibular defect.", "journal": "Brain : a journal of neurology", "date": "2020", "authors": "McNeill A, Iovino E, Mansard L, Vache C, Baux D, Bedoukian E, Cox H, Dean J, Goudie D, Kumar A, Newbury-Ecob R, Fallerini C, Renieri A, Lopergolo D, Mari F, Blanchet C, Willems M, Roux AF, Pippucci T, Delpire E", "reference": { "type": "PubMed", "id": "32658972", "url": "https://pubmed.ncbi.nlm.nih.gov/32658972" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55012-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "Slc12a2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 320, "end_pos": 320, "sequence_org": "A", "sequence_mut": "V", "comment": "Reduced potassium ion transmembrane transport.", "evidence": [ { "database": "UniProtKB", "id": "P55012", "url": "https://www.uniprot.org/uniprotkb/P55012" }, { "database": "PubMed", "id": "32658972", "url": "https://pubmed.ncbi.nlm.nih.gov/32658972" } ], "uniprot_canonical_ac": "P55012-1" }, { "start_pos": 369, "end_pos": 369, "sequence_org": "N", "sequence_mut": "I", "comment": "Reduced potassium ion transmembrane transport.", "evidence": [ { "database": "UniProtKB", "id": "P55012", "url": "https://www.uniprot.org/uniprotkb/P55012" }, { "database": "PubMed", "id": "32658972", "url": "https://pubmed.ncbi.nlm.nih.gov/32658972" } ], "uniprot_canonical_ac": "P55012-1" }, { "start_pos": 372, "end_pos": 372, "sequence_org": "A", "sequence_mut": "L", "comment": "Reduced potassium ion transmembrane transport.", "evidence": [ { "database": "UniProtKB", "id": "P55012", "url": "https://www.uniprot.org/uniprotkb/P55012" }, { "database": "PubMed", "id": "32658972", "url": "https://pubmed.ncbi.nlm.nih.gov/32658972" } ], "uniprot_canonical_ac": "P55012-1" }, { "start_pos": 403, "end_pos": 403, "sequence_org": "R", "sequence_mut": "Q", "comment": "Reduced potassium ion transmembrane transport.", "evidence": [ { "database": "UniProtKB", "id": "P55012", "url": "https://www.uniprot.org/uniprotkb/P55012" }, { "database": "PubMed", "id": "32658972", "url": "https://pubmed.ncbi.nlm.nih.gov/32658972" } ], "uniprot_canonical_ac": "P55012-1" }, { "start_pos": 885, "end_pos": 1205, "sequence_org": "WLQADMRDVDMYINLFHDAFDIQFGVVVIRLKEGLDISHLQGQEELLSSQEKSPGTKDVVVNVDYSKKSDQDTCKSSGEKSITQKDEEEDGKTPTQPLLKKESKGPIVPLNVADQKLLEASTQFQKKQGKNTIDVWWLFDDGGLTLLIPYLLTTKKKWKDCKIRVFIGGKINRIDHDRRAMATLLSKFRIDFSDIMVLGDINTKPKKENIIAFDDMIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYRQIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPVLLVRGNHQSVLTFYS", "sequence_mut": "", "comment": "Reduced potassium ion transmembrane transport.", "evidence": [ { "database": "UniProtKB", "id": "P55012", "url": "https://www.uniprot.org/uniprotkb/P55012" }, { "database": "PubMed", "id": "32658972", "url": "https://pubmed.ncbi.nlm.nih.gov/32658972" } ], "uniprot_canonical_ac": "P55012-1" }, { "start_pos": 973, "end_pos": 973, "sequence_org": "E", "sequence_mut": "K", "comment": "Reduced potassium ion transmembrane transport.", "evidence": [ { "database": "UniProtKB", "id": "P55012", "url": "https://www.uniprot.org/uniprotkb/P55012" }, { "database": "PubMed", "id": "32658972", "url": "https://pubmed.ncbi.nlm.nih.gov/32658972" } ], "uniprot_canonical_ac": "P55012-1" } ], "record_id": "pubmed.32658972", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SLC12A2 mutations cause NKCC1 deficiency with encephalopathy and impaired secretory epithelia.", "journal": "Neurol. Genet.", "date": "2020", "authors": "St\u00f6dberg Tommy, Magnusson M\u00e5ns, Lesko Nicole, Wredenberg Anna, Martin Munoz Daniel, Stranneheim Henrik, Wedell Anna", "reference": { "type": "PubMed", "id": "32754646", "url": "https://pubmed.ncbi.nlm.nih.gov/32754646" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32754646", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structural basis of function and regulation of neuronal cotransporters NKCC1 and KCC2.", "journal": "Communications biology", "date": "2021", "authors": "Zhang S, Zhou J, Zhang Y, Liu T, Friedel P, Zhuo W, Somasekharan S, Roy K, Zhang L, Liu Y, Meng X, Deng H, Zeng W, Li G, Forbush B, Yang M", "reference": { "type": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91V14-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "Slc12a5", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 307, "end_pos": 307, "sequence_org": "R", "sequence_mut": "E", "comment": "Abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 358, "end_pos": 358, "sequence_org": "R", "sequence_mut": "K", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 389, "end_pos": 389, "sequence_org": "E", "sequence_mut": "Q", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 389, "end_pos": 389, "sequence_org": "E", "sequence_mut": "R", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 486, "end_pos": 486, "sequence_org": "T", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 487, "end_pos": 487, "sequence_org": "F", "sequence_mut": "C", "comment": "Does not affect cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 488, "end_pos": 488, "sequence_org": "F", "sequence_mut": "C", "comment": "Slighly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 489, "end_pos": 489, "sequence_org": "S", "sequence_mut": "C", "comment": "Slighly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 490, "end_pos": 490, "sequence_org": "V", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 491, "end_pos": 491, "sequence_org": "F", "sequence_mut": "C", "comment": "Reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 492, "end_pos": 492, "sequence_org": "A", "sequence_mut": "C", "comment": "Reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 493, "end_pos": 493, "sequence_org": "I", "sequence_mut": "C", "comment": "Reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 494, "end_pos": 494, "sequence_org": "F", "sequence_mut": "C", "comment": "Reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 495, "end_pos": 495, "sequence_org": "F", "sequence_mut": "C", "comment": "Reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 497, "end_pos": 497, "sequence_org": "A", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 498, "end_pos": 498, "sequence_org": "A", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 499, "end_pos": 499, "sequence_org": "T", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 500, "end_pos": 500, "sequence_org": "G", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 501, "end_pos": 501, "sequence_org": "I", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 502, "end_pos": 502, "sequence_org": "L", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 503, "end_pos": 503, "sequence_org": "A", "sequence_mut": "C", "comment": "Reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 504, "end_pos": 504, "sequence_org": "G", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 505, "end_pos": 505, "sequence_org": "A", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 506, "end_pos": 506, "sequence_org": "N", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 507, "end_pos": 507, "sequence_org": "I", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 510, "end_pos": 510, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 510, "end_pos": 510, "sequence_org": "D", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 510, "end_pos": 510, "sequence_org": "D", "sequence_mut": "K", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 510, "end_pos": 510, "sequence_org": "D", "sequence_mut": "N", "comment": "Does not affect cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 510, "end_pos": 510, "sequence_org": "D", "sequence_mut": "Q", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 613, "end_pos": 613, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 613, "end_pos": 613, "sequence_org": "S", "sequence_mut": "C", "comment": "Abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 613, "end_pos": 613, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 613, "end_pos": 613, "sequence_org": "S", "sequence_mut": "T", "comment": "Abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 614, "end_pos": 614, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 614, "end_pos": 614, "sequence_org": "S", "sequence_mut": "C", "comment": "Abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 614, "end_pos": 614, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 614, "end_pos": 614, "sequence_org": "S", "sequence_mut": "T", "comment": "Abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 624, "end_pos": 624, "sequence_org": "K", "sequence_mut": "A", "comment": "Nearly abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 624, "end_pos": 624, "sequence_org": "K", "sequence_mut": "C", "comment": "Nearly abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 624, "end_pos": 624, "sequence_org": "K", "sequence_mut": "D", "comment": "Nearly abolished cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 632, "end_pos": 632, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 632, "end_pos": 632, "sequence_org": "D", "sequence_mut": "E", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 670, "end_pos": 670, "sequence_org": "E", "sequence_mut": "A", "comment": "Slightly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 670, "end_pos": 670, "sequence_org": "E", "sequence_mut": "C", "comment": "Slightly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 671, "end_pos": 671, "sequence_org": "L", "sequence_mut": "A", "comment": "Reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 671, "end_pos": 671, "sequence_org": "L", "sequence_mut": "C", "comment": "Reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" } ], "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.33597714", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide.", "journal": "Nature communications", "date": "2022-05-18", "authors": "Zhao Yongxiang, Roy Kasturi, Vidossich Pietro, Cancedda Laura, De Vivo Marco, Forbush Biff, Cao Erhu", "reference": { "type": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1031, "end_pos": 1031, "sequence_org": "D", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 1174, "end_pos": 1174, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 1201, "end_pos": 1201, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 217, "end_pos": 217, "sequence_org": "T", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 217, "end_pos": 217, "sequence_org": "T", "sequence_mut": "E", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 217, "end_pos": 217, "sequence_org": "T", "sequence_mut": "S", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 219, "end_pos": 219, "sequence_org": "D", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 235, "end_pos": 235, "sequence_org": "G", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 236, "end_pos": 249, "sequence_org": "EKLLRPSLAELHDE", "sequence_mut": "PKVNRPALLEIHEQ", "comment": "Decrease in Cl(-) influx and impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 236, "end_pos": 249, "sequence_org": "EKLLRPSLAELHDE", "sequence_mut": "PKVNRPSLLEIHEQ", "comment": "Decrease in Cl(-) influx when mutated to the equivalent sequence in NKCC2.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 237, "end_pos": 237, "sequence_org": "K", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 238, "end_pos": 238, "sequence_org": "L", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 240, "end_pos": 240, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "P", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 242, "end_pos": 242, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 242, "end_pos": 242, "sequence_org": "S", "sequence_mut": "E", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 243, "end_pos": 243, "sequence_org": "L", "sequence_mut": "A", "comment": "Abolishes transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 244, "end_pos": 244, "sequence_org": "A", "sequence_mut": "E", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 246, "end_pos": 246, "sequence_org": "L", "sequence_mut": "S", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 247, "end_pos": 247, "sequence_org": "H", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 248, "end_pos": 248, "sequence_org": "D", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 250, "end_pos": 250, "sequence_org": "L", "sequence_mut": "S", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 252, "end_pos": 252, "sequence_org": "K", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 289, "end_pos": 289, "sequence_org": "K", "sequence_mut": "N", "comment": "Impairs transporter activity. Impairs transporter activity and reduced sensitivity to NKCC inhibitor bumetanide; when associated with E-492 and C-671.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 301, "end_pos": 301, "sequence_org": "G", "sequence_mut": "C", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 492, "end_pos": 492, "sequence_org": "A", "sequence_mut": "E", "comment": "Active at elevated intracellular chloride concentrations that are inhibitory to wild-type. Impairs transporter activity. Impairs transporter activity and reduced sensitivity to NKCC inhibitor bumetanide; when associated with N-289 and C-671.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 499, "end_pos": 499, "sequence_org": "T", "sequence_mut": "C", "comment": "Strongly reduced cation-chloride cotransporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "33597714", "url": "https://pubmed.ncbi.nlm.nih.gov/33597714" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 671, "end_pos": 671, "sequence_org": "L", "sequence_mut": "C", "comment": "Active at elevated intracellular chloride concentrations that are inhibitory to wild-type. Impairs transporter activity. Impairs transporter activity and reduced sensitivity to NKCC inhibitor bumetanide; when associated with N-289 and E-492.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 682, "end_pos": 682, "sequence_org": "F", "sequence_mut": "C", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "35585053", "url": "https://pubmed.ncbi.nlm.nih.gov/35585053" } ], "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.35585053", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NKCC1 to KCC2 mRNA Ratio in Schizophrenia and Its Psychopathology: a Case-Control Study.", "journal": "Journal of molecular neuroscience : MN", "date": "2022", "authors": "Mohaghghegh H, Ananloo ES, Hadjighasem M, Karimipour M, Hashemizadeh S, Abhari SAA", "reference": { "type": "PubMed", "id": "35624355", "url": "https://pubmed.ncbi.nlm.nih.gov/35624355" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35624355", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of NKCC1 function increases epithelial tight junction permeability by upregulating claudin-2 expression.", "journal": "American journal of physiology. Cell physiology", "date": "2022-10-01", "authors": "Koumangoye Rainelli, Penny Parker, Delpire Eric", "reference": { "type": "PubMed", "id": "35968893", "url": "https://pubmed.ncbi.nlm.nih.gov/35968893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35968893", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cryo-EM structure of the human NKCC1 transporter reveals mechanisms of ion coupling and specificity.", "journal": "The EMBO journal", "date": "2022-12-01", "authors": "Neumann Caroline, Rosenbaek Lena Lindtoft, Flygaard Rasmus Kock, Habeck Michael, Karlsen Jesper Lykkegaard, Wang Yong, Lindorff-Larsen Kresten, Gad Hans Henrik, Hartmann Rune, Lyons Joseph Anthony, Fenton Robert A, Nissen Poul", "reference": { "type": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 383, "end_pos": 383, "sequence_org": "Y", "sequence_mut": "F", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 383, "end_pos": 383, "sequence_org": "Y", "sequence_mut": "S", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 429, "end_pos": 429, "sequence_org": "E", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 431, "end_pos": 431, "sequence_org": "E", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 431, "end_pos": 431, "sequence_org": "E", "sequence_mut": "Q", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 487, "end_pos": 487, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 533, "end_pos": 533, "sequence_org": "Y", "sequence_mut": "E", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 533, "end_pos": 533, "sequence_org": "Y", "sequence_mut": "F", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 686, "end_pos": 686, "sequence_org": "Y", "sequence_mut": "E", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" }, { "start_pos": 686, "end_pos": 686, "sequence_org": "Y", "sequence_mut": "S", "comment": "Impairs transporter activity.", "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" }, { "database": "PubMed", "id": "36239040", "url": "https://pubmed.ncbi.nlm.nih.gov/36239040" } ], "uniprot_canonical_ac": "P55011-1" } ], "record_id": "pubmed.36239040", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition mechanism of NKCC1 involves the carboxyl terminus and long-range conformational coupling.", "journal": "Science advances", "date": "2022-10-28", "authors": "Moseng Mitchell A, Su Chih-Chia, Rios Kerri, Cui Meng, Lyu Meinan, Glaza Przemyslaw, Klenotic Philip A, Delpire Eric, Yu Edward W", "reference": { "type": "PubMed", "id": "36306358", "url": "https://pubmed.ncbi.nlm.nih.gov/36306358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55012-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "Slc12a2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 794, "end_pos": 794, "sequence_org": "R", "sequence_mut": "A", "comment": "Decrease in K(+) influx and reduced sensitivity to inhibitor bumetanide.", "evidence": [ { "database": "UniProtKB", "id": "P55012", "url": "https://www.uniprot.org/uniprotkb/P55012" }, { "database": "PubMed", "id": "36306358", "url": "https://pubmed.ncbi.nlm.nih.gov/36306358" } ], "uniprot_canonical_ac": "P55012-1" } ], "record_id": "pubmed.36306358", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Expression of cation chloride cotransporter (NKCC1/KCC2) in brain tissue of children with focal cortical dysplasia type \u2161].", "journal": "Zhonghua bing li xue za zhi = Chinese journal of pathology", "date": "2022-11-08", "authors": "Li Y, Li Y L, Liu Y L, Fu J, Zhang W W, Piao Y S", "reference": { "type": "PubMed", "id": "36323541", "url": "https://pubmed.ncbi.nlm.nih.gov/36323541" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2X9-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36323541", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comprehensive analyses of solute carrier family members identify SLC12A2 as a novel therapy target for colorectal cancer.", "journal": "Scientific reports", "date": "2024-02-23", "authors": "Chen Dan-Yang, Zhang Yang-Yang, Nie Hai-Hang, Wang Hai-Zhou, Qiu Pei-Shan, Wang Fan, Peng Ya-Nan, Xu Fei, Zhao Qiu, Zhang Meng", "reference": { "type": "PubMed", "id": "38396064", "url": "https://pubmed.ncbi.nlm.nih.gov/38396064" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38396064", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Primary structure, functional expression, and chromosomal localization of the bumetanide-sensitive Na-K-Cl cotransporter in human colon.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Payne JA, Xu JC, Haas M, Lytle CY, Ward D, Forbush B 3rd", "reference": { "type": "PubMed", "id": "7629105", "url": "https://pubmed.ncbi.nlm.nih.gov/7629105" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55017-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "SLC12A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHW9-1", "protein_name": "Solute carrier family 12 member 6", "gene_name": "SLC12A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2X9-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13621-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "SLC12A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP95-1", "protein_name": "Solute carrier family 12 member 4", "gene_name": "SLC12A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y666-1", "protein_name": "Solute carrier family 12 member 7", "gene_name": "SLC12A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7629105", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bartter's syndrome, hypokalaemic alkalosis with hypercalciuria, is caused by mutations in the Na-K-2Cl cotransporter NKCC2.", "journal": "Nature genetics", "date": "1996", "authors": "Simon DB, Karet FE, Hamdan JM, DiPietro A, Sanjad SA, Lifton RP", "reference": { "type": "PubMed", "id": "8640224", "url": "https://pubmed.ncbi.nlm.nih.gov/8640224" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55017-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "SLC12A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHW9-1", "protein_name": "Solute carrier family 12 member 6", "gene_name": "SLC12A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2X9-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13621-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "SLC12A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP95-1", "protein_name": "Solute carrier family 12 member 4", "gene_name": "SLC12A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y666-1", "protein_name": "Solute carrier family 12 member 7", "gene_name": "SLC12A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8640224", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, expression pattern, and chromosomal localization of the human Na-Cl thiazide-sensitive cotransporter (SLC12A3).", "journal": "Genomics", "date": "1996", "authors": "Mastroianni N, De Fusco M, Zollo M, Arrigo G, Zuffardi O, Bettinelli A, Ballabio A, Casari G", "reference": { "type": "PubMed", "id": "8812482", "url": "https://pubmed.ncbi.nlm.nih.gov/8812482" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P55011-1", "protein_name": "Solute carrier family 12 member 2", "gene_name": "SLC12A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55017-1", "protein_name": "Solute carrier family 12 member 3", "gene_name": "SLC12A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHW9-1", "protein_name": "Solute carrier family 12 member 6", "gene_name": "SLC12A6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2X9-1", "protein_name": "Solute carrier family 12 member 5", "gene_name": "SLC12A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13621-1", "protein_name": "Solute carrier family 12 member 1", "gene_name": "SLC12A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP95-1", "protein_name": "Solute carrier family 12 member 4", "gene_name": "SLC12A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y666-1", "protein_name": "Solute carrier family 12 member 7", "gene_name": "SLC12A7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P55011", "url": "https://www.uniprot.org/uniprotkb/P55011" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8812482", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]