[ { "title": "Role of cell cycle-regulated expression in the localized incorporation of cell wall proteins in yeast.", "journal": "Mol. Biol. Cell", "date": "2006", "authors": "Smits Gertien J, Schenkman Laura R, Brul Stanley, Pringle John R, Klis Frans M", "reference": { "type": "PubMed", "id": "16672383", "url": "https://pubmed.ncbi.nlm.nih.gov/16672383" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43497-1", "protein_name": "Cell wall protein CWP2", "gene_name": "CWP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28319-1", "protein_name": "Cell wall protein CWP1", "gene_name": "CWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P27654-1", "protein_name": "Temperature shock-inducible protein 1", "gene_name": "TIP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43497", "url": "https://www.uniprot.org/uniprotkb/P43497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16672383", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of three mannoproteins in the cell wall of Saccharomyces cerevisiae.", "journal": "Journal of bacteriology", "date": "1995-06", "authors": "van der Vaart J M, Caro L H, Chapman J W, Klis F M, Verrips C T", "reference": { "type": "PubMed", "id": "7768807", "url": "https://pubmed.ncbi.nlm.nih.gov/7768807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43497-1", "protein_name": "Cell wall protein CWP2", "gene_name": "CWP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28319-1", "protein_name": "Cell wall protein CWP1", "gene_name": "CWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P27654-1", "protein_name": "Temperature shock-inducible protein 1", "gene_name": "TIP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43497", "url": "https://www.uniprot.org/uniprotkb/P43497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7768807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA sequence analysis of a 17 kb fragment of yeast chromosome XI physically localizes the MRB1 gene and reveals eight new open reading frames, including a homologue of the KIN1/KIN2 and SNF1 protein kinases.", "journal": "Yeast", "date": "1993", "authors": "Pallier C, Valens M, Puzos V, Fukuhara H, Ch\u00e9ret G, Sor F, Bolotin-Fukuhara M", "reference": { "type": "PubMed", "id": "8256524", "url": "https://pubmed.ncbi.nlm.nih.gov/8256524" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43497-1", "protein_name": "Cell wall protein CWP2", "gene_name": "CWP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28319-1", "protein_name": "Cell wall protein CWP1", "gene_name": "CWP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28320-1", "protein_name": "Splicing factor YJU2", "gene_name": "YJU2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28321-1", "protein_name": "Monoglyceride lipase", "gene_name": "YJU3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34244-1", "protein_name": "Probable serine/threonine-protein kinase HSL1", "gene_name": "HSL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34247-1", "protein_name": "U3 small nucleolar RNA-associated protein 11", "gene_name": "UTP11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23493-1", "protein_name": "Mitochondrial biogenesis regulation protein 1", "gene_name": "MBR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34245-1", "protein_name": "Uncharacterized protein YKL097C", "gene_name": "YKL445", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34246-1", "protein_name": "Maintenance of telomere capping protein 2", "gene_name": "MTC2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34248-1", "protein_name": "Intramembrane protease YPF1", "gene_name": "YPF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43497", "url": "https://www.uniprot.org/uniprotkb/P43497" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8256524", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The THI5 gene family of Saccharomyces cerevisiae: distribution of homologues among the hemiascomycetes and functional redundancy in the aerobic biosynthesis of thiamin from pyridoxine.", "journal": "Microbiology", "date": "2003", "authors": "Wightman Raymond, Meacock Peter A", "reference": { "type": "PubMed", "id": "12777485", "url": "https://pubmed.ncbi.nlm.nih.gov/12777485" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43534-1", "protein_name": "4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5", "gene_name": "THI5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07748-1", "protein_name": "4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI13", "gene_name": "THI13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P42883-1", "protein_name": "4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI12", "gene_name": "THI12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47183-1", "protein_name": "4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI11", "gene_name": "THI11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12777485", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The direct precursor of the pyrimidine moiety of thiamin is not urocanic acid but histidine in Saccharomyces cerevisiae.", "journal": "J. Nutr. Sci. Vitaminol.", "date": "2008", "authors": "Ishida Shiho, Tazuya-Murayama Keiko, Kijima Yukie, Yamada Kazuko", "reference": { "type": "PubMed", "id": "18388401", "url": "https://pubmed.ncbi.nlm.nih.gov/18388401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43534-1", "protein_name": "4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5", "gene_name": "THI5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18388401", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The last piece in the vitamin B1 biosynthesis puzzle: structural and functional insight into yeast 4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate (HMP-P) synthase.", "journal": "The Journal of biological chemistry", "date": "2012-12-07", "authors": "Coquille Sandrine, Roux C\u00e9line, Fitzpatrick Teresa B, Thore St\u00e9phane", "reference": { "type": "PubMed", "id": "23048037", "url": "https://pubmed.ncbi.nlm.nih.gov/23048037" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43534-1", "protein_name": "4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5", "gene_name": "THI5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 11, "end_pos": 11, "sequence_org": "N", "sequence_mut": "A", "comment": "Unable to sustain growth in thiamine-free medium.", "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" }, { "database": "PubMed", "id": "23048037", "url": "https://pubmed.ncbi.nlm.nih.gov/23048037" } ], "uniprot_canonical_ac": "P43534-1" }, { "start_pos": 12, "end_pos": 12, "sequence_org": "W", "sequence_mut": "A", "comment": "Unable to sustain growth in thiamine-free medium.", "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" }, { "database": "PubMed", "id": "23048037", "url": "https://pubmed.ncbi.nlm.nih.gov/23048037" } ], "uniprot_canonical_ac": "P43534-1" }, { "start_pos": 195, "end_pos": 195, "sequence_org": "C", "sequence_mut": "A", "comment": "Attenuates the coordination of ion and is unable to sustain growth in thiamine-free medium.", "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" }, { "database": "PubMed", "id": "23048037", "url": "https://pubmed.ncbi.nlm.nih.gov/23048037" } ], "uniprot_canonical_ac": "P43534-1" }, { "start_pos": 196, "end_pos": 196, "sequence_org": "C", "sequence_mut": "A", "comment": "Attenuates the coordination of ion and is unable to sustain growth in thiamine-free medium.", "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" }, { "database": "PubMed", "id": "23048037", "url": "https://pubmed.ncbi.nlm.nih.gov/23048037" } ], "uniprot_canonical_ac": "P43534-1" }, { "start_pos": 197, "end_pos": 197, "sequence_org": "C", "sequence_mut": "A", "comment": "Attenuates the coordination of ion and is unable to sustain growth in thiamine-free medium.", "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" }, { "database": "PubMed", "id": "23048037", "url": "https://pubmed.ncbi.nlm.nih.gov/23048037" } ], "uniprot_canonical_ac": "P43534-1" }, { "start_pos": 199, "end_pos": 199, "sequence_org": "C", "sequence_mut": "A", "comment": "Attenuates the coordination of ion and is unable to sustain growth in thiamine-free medium.", "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" }, { "database": "PubMed", "id": "23048037", "url": "https://pubmed.ncbi.nlm.nih.gov/23048037" } ], "uniprot_canonical_ac": "P43534-1" }, { "start_pos": 62, "end_pos": 62, "sequence_org": "K", "sequence_mut": "A", "comment": "Unable to sustain growth in thiamine-free medium.", "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" }, { "database": "PubMed", "id": "23048037", "url": "https://pubmed.ncbi.nlm.nih.gov/23048037" } ], "uniprot_canonical_ac": "P43534-1" }, { "start_pos": 66, "end_pos": 66, "sequence_org": "H", "sequence_mut": "A", "comment": "Unable to sustain growth in thiamine-free medium.", "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" }, { "database": "PubMed", "id": "23048037", "url": "https://pubmed.ncbi.nlm.nih.gov/23048037" } ], "uniprot_canonical_ac": "P43534-1" } ], "record_id": "pubmed.23048037", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pyrimidine moiety of thiamin is biosynthesized from pyridoxine and histidine in Saccharomyces cerevisiae.", "journal": "Biochem. Mol. Biol. Int.", "date": "1995", "authors": "Tazuya K, Azumi C, Yamada K, Kumaoka H", "reference": { "type": "PubMed", "id": "8528151", "url": "https://pubmed.ncbi.nlm.nih.gov/8528151" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43534-1", "protein_name": "4-amino-5-hydroxymethyl-2-methylpyrimidine phosphate synthase THI5", "gene_name": "THI5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43534", "url": "https://www.uniprot.org/uniprotkb/P43534" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8528151", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Emp47p and its close homolog Emp46p have a tyrosine-containing endoplasmic reticulum exit signal and function in glycoprotein secretion in Saccharomyces cerevisiae.", "journal": "Molecular biology of the cell", "date": "2002-07", "authors": "Sato Ken, Nakano Akihiko", "reference": { "type": "PubMed", "id": "12134087", "url": "https://pubmed.ncbi.nlm.nih.gov/12134087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43555-1", "protein_name": "Protein EMP47", "gene_name": "EMP47", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12396-1", "protein_name": "Protein EMP46", "gene_name": "EMP46", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43555", "url": "https://www.uniprot.org/uniprotkb/P43555" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 429, "end_pos": 429, "sequence_org": "Y", "sequence_mut": "A", "comment": "Impairs interaction with COP1, SEC21 and SEC23 and loss of endoplasmic reticulum exit.", "evidence": [ { "database": "UniProtKB", "id": "Q12396", "url": "https://www.uniprot.org/uniprotkb/Q12396" }, { "database": "PubMed", "id": "12134087", "url": "https://pubmed.ncbi.nlm.nih.gov/12134087" } ], "uniprot_canonical_ac": "Q12396-1" }, { "start_pos": 432, "end_pos": 432, "sequence_org": "F", "sequence_mut": "A", "comment": "Impairs interaction with COP1, SEC21 and SEC23 and loss of endoplasmic reticulum exit.", "evidence": [ { "database": "UniProtKB", "id": "Q12396", "url": "https://www.uniprot.org/uniprotkb/Q12396" }, { "database": "PubMed", "id": "12134087", "url": "https://pubmed.ncbi.nlm.nih.gov/12134087" } ], "uniprot_canonical_ac": "Q12396-1" }, { "start_pos": 440, "end_pos": 442, "sequence_org": "KVK", "sequence_mut": "RVR", "comment": "Impairs interaction with COP1 and SEC21 and mislocalizes to the vacuole.", "evidence": [ { "database": "UniProtKB", "id": "Q12396", "url": "https://www.uniprot.org/uniprotkb/Q12396" }, { "database": "PubMed", "id": "12134087", "url": "https://pubmed.ncbi.nlm.nih.gov/12134087" } ], "uniprot_canonical_ac": "Q12396-1" }, { "start_pos": 440, "end_pos": 442, "sequence_org": "KVK", "sequence_mut": "SVS", "comment": "Impairs interaction with COP1 and SEC21 and mislocalizes to the vacuole.", "evidence": [ { "database": "UniProtKB", "id": "Q12396", "url": "https://www.uniprot.org/uniprotkb/Q12396" }, { "database": "PubMed", "id": "12134087", "url": "https://pubmed.ncbi.nlm.nih.gov/12134087" } ], "uniprot_canonical_ac": "Q12396-1" }, { "start_pos": 440, "end_pos": 444, "sequence_org": "KVKLL", "sequence_mut": "", "comment": "Loss of endoplasmic reticulum exit.", "evidence": [ { "database": "UniProtKB", "id": "Q12396", "url": "https://www.uniprot.org/uniprotkb/Q12396" }, { "database": "PubMed", "id": "12134087", "url": "https://pubmed.ncbi.nlm.nih.gov/12134087" } ], "uniprot_canonical_ac": "Q12396-1" }, { "start_pos": 443, "end_pos": 444, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Loss of endoplasmic reticulum exit.", "evidence": [ { "database": "UniProtKB", "id": "Q12396", "url": "https://www.uniprot.org/uniprotkb/Q12396" }, { "database": "PubMed", "id": "12134087", "url": "https://pubmed.ncbi.nlm.nih.gov/12134087" } ], "uniprot_canonical_ac": "Q12396-1" } ], "record_id": "pubmed.12134087", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oligomerization of a cargo receptor directs protein sorting into COPII-coated transport vesicles.", "journal": "Mol. Biol. Cell", "date": "2003", "authors": "Sato Ken, Nakano Akihiko", "reference": { "type": "PubMed", "id": "12857885", "url": "https://pubmed.ncbi.nlm.nih.gov/12857885" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43555-1", "protein_name": "Protein EMP47", "gene_name": "EMP47", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12396-1", "protein_name": "Protein EMP46", "gene_name": "EMP46", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43555", "url": "https://www.uniprot.org/uniprotkb/P43555" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12857885", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reconstitution of coat protein complex II (COPII) vesicle formation from cargo-reconstituted proteoliposomes reveals the potential role of GTP hydrolysis by Sar1p in protein sorting.", "journal": "The Journal of biological chemistry", "date": "2004-01-09", "authors": "Sato Ken, Nakano Akihiko", "reference": { "type": "PubMed", "id": "14627716", "url": "https://pubmed.ncbi.nlm.nih.gov/14627716" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43555-1", "protein_name": "Protein EMP47", "gene_name": "EMP47", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04491-1", "protein_name": "Protein transport protein SEC13", "gene_name": "SEC13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12396-1", "protein_name": "Protein EMP46", "gene_name": "EMP46", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P20606-1", "protein_name": "Small COPII coat GTPase SAR1", "gene_name": "SAR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38968-1", "protein_name": "Protein transport protein SEC31", "gene_name": "SEC31", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40482-1", "protein_name": "Protein transport protein SEC24", "gene_name": "SEC24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15303-1", "protein_name": "Protein transport protein SEC23", "gene_name": "SEC23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43555", "url": "https://www.uniprot.org/uniprotkb/P43555" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14627716", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structures of the carbohydrate recognition domain of Ca2+-independent cargo receptors Emp46p and Emp47p.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Satoh Tadashi, Sato Ken, Kanoh Akira, Yamashita Katsuko, Yamada Yusuke, Igarashi Noriyuki, Kato Ryuichi, Nakano Akihiko, Wakatsuki Soichi", "reference": { "type": "PubMed", "id": "16439369", "url": "https://pubmed.ncbi.nlm.nih.gov/16439369" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43555-1", "protein_name": "Protein EMP47", "gene_name": "EMP47", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12396-1", "protein_name": "Protein EMP46", "gene_name": "EMP46", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43555", "url": "https://www.uniprot.org/uniprotkb/P43555" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 177, "end_pos": 177, "sequence_org": "Y", "sequence_mut": "F", "comment": "Impairs potassium-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q12396", "url": "https://www.uniprot.org/uniprotkb/Q12396" }, { "database": "PubMed", "id": "16439369", "url": "https://pubmed.ncbi.nlm.nih.gov/16439369" } ], "uniprot_canonical_ac": "Q12396-1" } ], "record_id": "pubmed.16439369", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Golgi-localization of yeast Emp47p depends on its di-lysine motif but is not affected by the ret1-1 mutation in alpha-COP.", "journal": "J. Cell Biol.", "date": "1995", "authors": "Schr\u00f6der S, Schimm\u00f6ller F, Singer-Kr\u00fcger B, Riezman H", "reference": { "type": "PubMed", "id": "7490292", "url": "https://pubmed.ncbi.nlm.nih.gov/7490292" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43555-1", "protein_name": "Protein EMP47", "gene_name": "EMP47", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43555", "url": "https://www.uniprot.org/uniprotkb/P43555" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7490292", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Partial purification and characterization of early and late endosomes from yeast. Identification of four novel proteins.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Singer-Kr\u00fcger B, Frank R, Crausaz F, Riezman H", "reference": { "type": "PubMed", "id": "8314797", "url": "https://pubmed.ncbi.nlm.nih.gov/8314797" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43555-1", "protein_name": "Protein EMP47", "gene_name": "EMP47", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32802-1", "protein_name": "Transmembrane 9 superfamily member 1", "gene_name": "EMP70", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32803-1", "protein_name": "Endosomal protein P24B", "gene_name": "EMP24", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03180-1", "protein_name": "Cell wall mannoprotein PIR3", "gene_name": "PIR3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43555", "url": "https://www.uniprot.org/uniprotkb/P43555" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8314797", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic analysis of PIS1 gene expression.", "journal": "Eukaryotic cell", "date": "2005-03", "authors": "Gardocki Mary E, Bakewell Margaret, Kamath Deepa, Robinson Kelly, Borovicka Kathy, Lopes John M", "reference": { "type": "PubMed", "id": "15755922", "url": "https://pubmed.ncbi.nlm.nih.gov/15755922" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43558-1", "protein_name": "Ubiquitin thioesterase OTU1", "gene_name": "OTU1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33757-1", "protein_name": "Sporulation protein 23", "gene_name": "SPO23", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43558", "url": "https://www.uniprot.org/uniprotkb/P43558" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15755922", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional division of substrate processing cofactors of the ubiquitin-selective Cdc48 chaperone.", "journal": "Molecular cell", "date": "2006-01-20", "authors": "Rumpf Sebastian, Jentsch Stefan", "reference": { "type": "PubMed", "id": "16427015", "url": "https://pubmed.ncbi.nlm.nih.gov/16427015" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43558-1", "protein_name": "Ubiquitin thioesterase OTU1", "gene_name": "OTU1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33755-1", "protein_name": "Nuclear protein localization protein 4", "gene_name": "NPL4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34223-1", "protein_name": "UBX domain-containing protein 1", "gene_name": "SHP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25694-1", "protein_name": "AAA family ATPase involved in ubiquitin-mediated protein degradation CDC48", "gene_name": "CDC48", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53044-1", "protein_name": "Ubiquitin fusion degradation protein 1", "gene_name": "UFD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36037-1", "protein_name": "Protein DOA1", "gene_name": "DOA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P54860-1", "protein_name": "E4 ubiquitin-protein ligase UFD2", "gene_name": "UFD2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43558", "url": "https://www.uniprot.org/uniprotkb/P43558" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 120, "end_pos": 120, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of function.", "evidence": [ { "database": "UniProtKB", "id": "P43558", "url": "https://www.uniprot.org/uniprotkb/P43558" }, { "database": "PubMed", "id": "16427015", "url": "https://pubmed.ncbi.nlm.nih.gov/16427015" } ], "uniprot_canonical_ac": "P43558-1" }, { "start_pos": 289, "end_pos": 715, "sequence_org": "QEKSRWASEDEINELSTQVEKSTISSKTIEFDESKLSPYEILQSPGRKEGQIVVVKSPQGTIEAHQFSNSSWKKVGDVVGAGATGNDKKIEFEGKTYDYVFDVDIEDGKPPLKLPINVSDNPYTAADNFLARYELPMSYRDQVVQFILKNTNGISLDQPNDNASSSAVSPSKTSVMKVLPVKQYLIMENYNPDTIFNGIVKINSNEKTFDDEILAQIGGALHDIDESWELLLSFANTIRSNWEIKTPAYDIVRLIVKKLPYSSDIKDYIEEGLGNKNITLTMLTVRILVNCFNNENWGVKLLESNQVYKSIFETIDTEFSQASAKQSQNLAIAVSTLIFNYSALVTKGNSDLELLPIVADAINTKYGPLEEYQECEEAAYRLTVAYGNLATVEPTLRQFANSVTWLANIKRSYGNVPRFKDIFDDLS", "sequence_mut": "", "comment": "No binding to ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "P36037", "url": "https://www.uniprot.org/uniprotkb/P36037" }, { "database": "PubMed", "id": "16427015", "url": "https://pubmed.ncbi.nlm.nih.gov/16427015" } ], "uniprot_canonical_ac": "P36037-1" }, { "start_pos": 2, "end_pos": 287, "sequence_org": "GYQLSATLKGHDQDVRDVVAVDDSKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNLVRIF", "sequence_mut": "", "comment": "No binding to ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "P36037", "url": "https://www.uniprot.org/uniprotkb/P36037" }, { "database": "PubMed", "id": "16427015", "url": "https://pubmed.ncbi.nlm.nih.gov/16427015" } ], "uniprot_canonical_ac": "P36037-1" }, { "start_pos": 2, "end_pos": 359, "sequence_org": "GYQLSATLKGHDQDVRDVVAVDDSKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNLVRIFSQEKSRWASEDEINELSTQVEKSTISSKTIEFDESKLSPYEILQSPGRKEGQIVVVKSPQGTIEAHQFSNSS", "sequence_mut": "", "comment": "No binding to ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "P36037", "url": "https://www.uniprot.org/uniprotkb/P36037" }, { "database": "PubMed", "id": "16427015", "url": "https://pubmed.ncbi.nlm.nih.gov/16427015" } ], "uniprot_canonical_ac": "P36037-1" }, { "start_pos": 2, "end_pos": 425, "sequence_org": "GYQLSATLKGHDQDVRDVVAVDDSKVASVSRDGTVRLWSKDDQWLGTVVYTGQGFLNSVCYDSEKELLLFGGKDTMINGVPLFATSGEDPLYTLIGHQGNVCSLSFQDGVVISGSWDKTAKVWKEGSLVYNLQAHNASVWDAKVVSFSENKFLTASADKTIKLWQNDKVIKTFSGIHNDVVRHLAVVDDGHFISCSNDGLIKLVDMHTGDVLRTYEGHESFVYCIKLLPNGDIVSCGEDRTVRIWSKENGSLKQVITLPAISIWSVDCMSNGDIIVGSSDNLVRIFSQEKSRWASEDEINELSTQVEKSTISSKTIEFDESKLSPYEILQSPGRKEGQIVVVKSPQGTIEAHQFSNSSWKKVGDVVGAGATGNDKKIEFEGKTYDYVFDVDIEDGKPPLKLPINVSDNPYTAADNFLARYELPM", "sequence_mut": "", "comment": "No binding to ubiquitin but does not affect the interaction with CDC48.", "evidence": [ { "database": "UniProtKB", "id": "P36037", "url": "https://www.uniprot.org/uniprotkb/P36037" }, { "database": "PubMed", "id": "16427015", "url": "https://pubmed.ncbi.nlm.nih.gov/16427015" } ], "uniprot_canonical_ac": "P36037-1" }, { "start_pos": 426, "end_pos": 715, "sequence_org": "SYRDQVVQFILKNTNGISLDQPNDNASSSAVSPSKTSVMKVLPVKQYLIMENYNPDTIFNGIVKINSNEKTFDDEILAQIGGALHDIDESWELLLSFANTIRSNWEIKTPAYDIVRLIVKKLPYSSDIKDYIEEGLGNKNITLTMLTVRILVNCFNNENWGVKLLESNQVYKSIFETIDTEFSQASAKQSQNLAIAVSTLIFNYSALVTKGNSDLELLPIVADAINTKYGPLEEYQECEEAAYRLTVAYGNLATVEPTLRQFANSVTWLANIKRSYGNVPRFKDIFDDLS", "sequence_mut": "", "comment": "No binding to ubiquitin and no interaction with CDC48.", "evidence": [ { "database": "UniProtKB", "id": "P36037", "url": "https://www.uniprot.org/uniprotkb/P36037" }, { "database": "PubMed", "id": "16427015", "url": "https://pubmed.ncbi.nlm.nih.gov/16427015" }, { "database": "PubMed", "id": "16428438", "url": "https://pubmed.ncbi.nlm.nih.gov/16428438" } ], "uniprot_canonical_ac": "P36037-1" }, { "start_pos": 495, "end_pos": 715, "sequence_org": "KTFDDEILAQIGGALHDIDESWELLLSFANTIRSNWEIKTPAYDIVRLIVKKLPYSSDIKDYIEEGLGNKNITLTMLTVRILVNCFNNENWGVKLLESNQVYKSIFETIDTEFSQASAKQSQNLAIAVSTLIFNYSALVTKGNSDLELLPIVADAINTKYGPLEEYQECEEAAYRLTVAYGNLATVEPTLRQFANSVTWLANIKRSYGNVPRFKDIFDDLS", "sequence_mut": "", "comment": "Loss of interaction with CDC48 without affecting binding to ubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "P36037", "url": "https://www.uniprot.org/uniprotkb/P36037" }, { "database": "PubMed", "id": "16427015", "url": "https://pubmed.ncbi.nlm.nih.gov/16427015" } ], "uniprot_canonical_ac": "P36037-1" } ], "record_id": "pubmed.16427015", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The iron transporter Fth1p forms a complex with the Fet5 iron oxidase and resides on the vacuolar membrane.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Urbanowski J L, Piper R C", "reference": { "type": "PubMed", "id": "10608875", "url": "https://pubmed.ncbi.nlm.nih.gov/10608875" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43561-1", "protein_name": "Iron transport multicopper oxidase FET5", "gene_name": "FET5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38310-1", "protein_name": "Iron transporter FTH1", "gene_name": "FTH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43561", "url": "https://www.uniprot.org/uniprotkb/P43561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10608875", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The yeast FET5 gene encodes a FET3-related multicopper oxidase implicated in iron transport.", "journal": "Mol. Gen. Genet.", "date": "1997", "authors": "Spizzo T, Byersdorfer C, Duesterhoeft S, Eide D", "reference": { "type": "PubMed", "id": "9413439", "url": "https://pubmed.ncbi.nlm.nih.gov/9413439" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43561-1", "protein_name": "Iron transport multicopper oxidase FET5", "gene_name": "FET5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43561", "url": "https://www.uniprot.org/uniprotkb/P43561" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9413439", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast Cbk1 and Mob2 activate daughter-specific genetic programs to induce asymmetric cell fates.", "journal": "Cell", "date": "2001-12-14", "authors": "Colman-Lerner A, Chin T E, Brent R", "reference": { "type": "PubMed", "id": "11747810", "url": "https://pubmed.ncbi.nlm.nih.gov/11747810" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43563-1", "protein_name": "CBK1 kinase activator protein MOB2", "gene_name": "MOB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47033-1", "protein_name": "Cell wall protein PRY3", "gene_name": "PRY3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40077-1", "protein_name": "Protein DSE1", "gene_name": "DSE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38844-1", "protein_name": "Protein DSE2", "gene_name": "DSE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08729-1", "protein_name": "Protein DSE3", "gene_name": "DSE3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43563", "url": "https://www.uniprot.org/uniprotkb/P43563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11747810", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Saccharomyces cerevisiae Mob2p-Cbk1p kinase complex promotes polarized growth and acts with the mitotic exit network to facilitate daughter cell-specific localization of Ace2p transcription factor.", "journal": "The Journal of cell biology", "date": "2002-09-02", "authors": "Weiss Eric L, Kurischko Cornelia, Zhang Chao, Shokat Kevan, Drubin David G, Luca Francis C", "reference": { "type": "PubMed", "id": "12196508", "url": "https://pubmed.ncbi.nlm.nih.gov/12196508" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43563-1", "protein_name": "CBK1 kinase activator protein MOB2", "gene_name": "MOB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53894-1", "protein_name": "Serine/threonine-protein kinase CBK1", "gene_name": "CBK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43563", "url": "https://www.uniprot.org/uniprotkb/P43563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12196508", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and functional analysis of Saccharomyces cerevisiae Mob1.", "journal": "J. Mol. Biol.", "date": "2006", "authors": "Mrkobrada Serge, Boucher Lorrie, Ceccarelli Derek F J, Tyers Mike, Sicheri Frank", "reference": { "type": "PubMed", "id": "16934835", "url": "https://pubmed.ncbi.nlm.nih.gov/16934835" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43563-1", "protein_name": "CBK1 kinase activator protein MOB2", "gene_name": "MOB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40484-1", "protein_name": "DBF2 kinase activator protein MOB1", "gene_name": "MOB1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43563", "url": "https://www.uniprot.org/uniprotkb/P43563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 105, "end_pos": 105, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P40484", "url": "https://www.uniprot.org/uniprotkb/P40484" }, { "database": "PubMed", "id": "16934835", "url": "https://pubmed.ncbi.nlm.nih.gov/16934835" } ], "uniprot_canonical_ac": "P40484-1" }, { "start_pos": 105, "end_pos": 105, "sequence_org": "T", "sequence_mut": "D", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P40484", "url": "https://www.uniprot.org/uniprotkb/P40484" }, { "database": "PubMed", "id": "16934835", "url": "https://pubmed.ncbi.nlm.nih.gov/16934835" } ], "uniprot_canonical_ac": "P40484-1" }, { "start_pos": 107, "end_pos": 107, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P40484", "url": "https://www.uniprot.org/uniprotkb/P40484" }, { "database": "PubMed", "id": "16934835", "url": "https://pubmed.ncbi.nlm.nih.gov/16934835" } ], "uniprot_canonical_ac": "P40484-1" }, { "start_pos": 107, "end_pos": 107, "sequence_org": "S", "sequence_mut": "D", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "P40484", "url": "https://www.uniprot.org/uniprotkb/P40484" }, { "database": "PubMed", "id": "16934835", "url": "https://pubmed.ncbi.nlm.nih.gov/16934835" } ], "uniprot_canonical_ac": "P40484-1" } ], "record_id": "pubmed.16934835", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MOB1, an essential yeast gene required for completion of mitosis and maintenance of ploidy.", "journal": "Mol. Biol. Cell", "date": "1998", "authors": "Luca F C, Winey M", "reference": { "type": "PubMed", "id": "9436989", "url": "https://pubmed.ncbi.nlm.nih.gov/9436989" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43563-1", "protein_name": "CBK1 kinase activator protein MOB2", "gene_name": "MOB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40484-1", "protein_name": "DBF2 kinase activator protein MOB1", "gene_name": "MOB1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43563", "url": "https://www.uniprot.org/uniprotkb/P43563" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9436989", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a hypothetical membrane protein interactor of ribosomal phosphoprotein P0.", "journal": "J. Biosci.", "date": "2004", "authors": "Aruna K, Chakraborty Tirtha, Nambeesan Savithri, Mannan Abdul Baru, Sehgal Alfica, Bhalchandara Seema R, Sharma Shobhona", "reference": { "type": "PubMed", "id": "15286401", "url": "https://pubmed.ncbi.nlm.nih.gov/15286401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43564-1", "protein_name": "Probable lipase MIL1", "gene_name": "MIL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P05317-1", "protein_name": "Large ribosomal subunit protein uL10", "gene_name": "RPP0", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43564", "url": "https://www.uniprot.org/uniprotkb/P43564" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15286401", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The alternate AP-1 adaptor subunit Apm2 interacts with the Mil1 regulatory protein and confers differential cargo sorting.", "journal": "Molecular biology of the cell", "date": "2016-02-01", "authors": "Whitfield Shawn T, Burston Helen E, Bean Bj\u00f6rn D M, Raghuram Nandini, Maldonado-B\u00e1ez Lymarie, Davey Michael, Wendland Beverly, Conibear Elizabeth", "reference": { "type": "PubMed", "id": "26658609", "url": "https://pubmed.ncbi.nlm.nih.gov/26658609" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43564-1", "protein_name": "Probable lipase MIL1", "gene_name": "MIL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35181-1", "protein_name": "AP-1 complex subunit sigma-1", "gene_name": "APS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38700-1", "protein_name": "Adaptin medium chain homolog APM2", "gene_name": "APM2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12028-1", "protein_name": "AP-1 complex subunit gamma-1", "gene_name": "APL4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43564", "url": "https://www.uniprot.org/uniprotkb/P43564" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 143, "end_pos": 147, "sequence_org": "WQEMP", "sequence_mut": "AAEAA", "comment": "Impairs the interaction with APM2 and its recruitment to membranes, and leads to sertraline sensitivity.", "evidence": [ { "database": "UniProtKB", "id": "P43564", "url": "https://www.uniprot.org/uniprotkb/P43564" }, { "database": "PubMed", "id": "26658609", "url": "https://pubmed.ncbi.nlm.nih.gov/26658609" } ], "uniprot_canonical_ac": "P43564-1" }, { "start_pos": 759, "end_pos": 759, "sequence_org": "S", "sequence_mut": "A", "comment": "Increases sensitivity to sertraline.", "evidence": [ { "database": "UniProtKB", "id": "P43564", "url": "https://www.uniprot.org/uniprotkb/P43564" }, { "database": "PubMed", "id": "26658609", "url": "https://pubmed.ncbi.nlm.nih.gov/26658609" } ], "uniprot_canonical_ac": "P43564-1" }, { "start_pos": 817, "end_pos": 817, "sequence_org": "D", "sequence_mut": "A", "comment": "Increases sensitivity to sertraline.", "evidence": [ { "database": "UniProtKB", "id": "P43564", "url": "https://www.uniprot.org/uniprotkb/P43564" }, { "database": "PubMed", "id": "26658609", "url": "https://pubmed.ncbi.nlm.nih.gov/26658609" } ], "uniprot_canonical_ac": "P43564-1" }, { "start_pos": 858, "end_pos": 858, "sequence_org": "H", "sequence_mut": "A", "comment": "Increases sensitivity to sertraline.", "evidence": [ { "database": "UniProtKB", "id": "P43564", "url": "https://www.uniprot.org/uniprotkb/P43564" }, { "database": "PubMed", "id": "26658609", "url": "https://pubmed.ncbi.nlm.nih.gov/26658609" } ], "uniprot_canonical_ac": "P43564-1" }, { "start_pos": 273, "end_pos": 273, "sequence_org": "F", "sequence_mut": "A", "comment": "Leads to sensitivity to sertraline, when associated with S-275.", "evidence": [ { "database": "UniProtKB", "id": "P38700", "url": "https://www.uniprot.org/uniprotkb/P38700" }, { "database": "PubMed", "id": "26658609", "url": "https://pubmed.ncbi.nlm.nih.gov/26658609" } ], "uniprot_canonical_ac": "P38700-1" }, { "start_pos": 275, "end_pos": 275, "sequence_org": "D", "sequence_mut": "S", "comment": "Leads to sensitivity to sertraline, when associated with A-273.", "evidence": [ { "database": "UniProtKB", "id": "P38700", "url": "https://www.uniprot.org/uniprotkb/P38700" }, { "database": "PubMed", "id": "26658609", "url": "https://pubmed.ncbi.nlm.nih.gov/26658609" } ], "uniprot_canonical_ac": "P38700-1" } ], "record_id": "pubmed.26658609", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alanine:glyoxylate aminotransferase of Saccharomyces cerevisiae-encoding gene AGX1 and metabolic significance.", "journal": "Yeast", "date": "2004", "authors": "Schl\u00f6sser Thomas, G\u00e4tgens Cornelia, Weber Ulrike, Stahmann K-Peter", "reference": { "type": "PubMed", "id": "14745783", "url": "https://pubmed.ncbi.nlm.nih.gov/14745783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43567-1", "protein_name": "Alanine--glyoxylate aminotransferase 1", "gene_name": "AGX1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43567", "url": "https://www.uniprot.org/uniprotkb/P43567" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14745783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure and confirmation of the alanine:glyoxylate aminotransferase activity of the YFL030w yeast protein.", "journal": "Biochimie", "date": "2005-12", "authors": "Meyer Philippe, Liger Dominique, Leulliot Nicolas, Quevillon-Cheruel Sophie, Zhou Cong-Zhao, Borel Franck, Ferrer Jean-Luc, Poupon Anne, Janin Jo\u00ebl, van Tilbeurgh Herman", "reference": { "type": "PubMed", "id": "16226833", "url": "https://pubmed.ncbi.nlm.nih.gov/16226833" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43567-1", "protein_name": "Alanine--glyoxylate aminotransferase 1", "gene_name": "AGX1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43567", "url": "https://www.uniprot.org/uniprotkb/P43567" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16226833", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characteristics of alanine: glyoxylate aminotransferase from Saccharomyces cerevisiae, a regulatory enzyme in the glyoxylate pathway of glycine and serine biosynthesis from tricarboxylic acid-cycle intermediates.", "journal": "The Biochemical journal", "date": "1985-10-01", "authors": "Takada Y, Noguchi T", "reference": { "type": "PubMed", "id": "3933486", "url": "https://pubmed.ncbi.nlm.nih.gov/3933486" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43567-1", "protein_name": "Alanine--glyoxylate aminotransferase 1", "gene_name": "AGX1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43567", "url": "https://www.uniprot.org/uniprotkb/P43567" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.3933486", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct retrieval and retention mechanisms are required for the quality control of endoplasmic reticulum protein folding.", "journal": "The Journal of cell biology", "date": "2001-10-29", "authors": "Vashist S, Kim W, Belden W J, Spear E D, Barlowe C, Ng D T", "reference": { "type": "PubMed", "id": "11673477", "url": "https://pubmed.ncbi.nlm.nih.gov/11673477" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43571-1", "protein_name": "GPI inositol-deacylase", "gene_name": "BST1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43571", "url": "https://www.uniprot.org/uniprotkb/P43571" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11673477", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inositol deacylation by Bst1p is required for the quality control of glycosylphosphatidylinositol-anchored proteins.", "journal": "Molecular biology of the cell", "date": "2006-02", "authors": "Fujita Morihisa, Yoko-O Takehiko, Jigami Yoshifumi", "reference": { "type": "PubMed", "id": "16319176", "url": "https://pubmed.ncbi.nlm.nih.gov/16319176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43571-1", "protein_name": "GPI inositol-deacylase", "gene_name": "BST1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43571", "url": "https://www.uniprot.org/uniprotkb/P43571" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16319176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genes that control the fidelity of endoplasmic reticulum to Golgi transport identified as suppressors of vesicle budding mutations.", "journal": "Molecular biology of the cell", "date": "1996-07", "authors": "Elrod-Erickson M J, Kaiser C A", "reference": { "type": "PubMed", "id": "8862519", "url": "https://pubmed.ncbi.nlm.nih.gov/8862519" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43571-1", "protein_name": "GPI inositol-deacylase", "gene_name": "BST1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43571", "url": "https://www.uniprot.org/uniprotkb/P43571" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8862519", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple links between the NuA4 histone acetyltransferase complex and epigenetic control of transcription.", "journal": "Molecular cell", "date": "2000-06", "authors": "Galarneau L, Nourani A, Boudreault A A, Zhang Y, H\u00e9liot L, Allard S, Savard J, Lane W S, Stillman D J, C\u00f4t\u00e9 J", "reference": { "type": "PubMed", "id": "10911987", "url": "https://pubmed.ncbi.nlm.nih.gov/10911987" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43572-1", "protein_name": "Enhancer of polycomb-like protein 1", "gene_name": "EPL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38811-1", "protein_name": "SAGA complex/NuA4 acetyltransferase complex subunit TRA1", "gene_name": "TRA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P80428-1", "protein_name": "Actin-related protein 4", "gene_name": "ARP4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08649-1", "protein_name": "Histone acetyltransferase ESA1", "gene_name": "ESA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43572", "url": "https://www.uniprot.org/uniprotkb/P43572" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 155, "end_pos": 155, "sequence_org": "C", "sequence_mut": "Y", "comment": "No histone acetyltransferase activity at 37 degrees Celsius.", "evidence": [ { "database": "UniProtKB", "id": "P80428", "url": "https://www.uniprot.org/uniprotkb/P80428" }, { "database": "PubMed", "id": "10911987", "url": "https://pubmed.ncbi.nlm.nih.gov/10911987" } ], "uniprot_canonical_ac": "P80428-1" }, { "start_pos": 455, "end_pos": 455, "sequence_org": "G", "sequence_mut": "S", "comment": "No histone acetyltransferase activity at 37 degrees Celsius. Defect in promoter association and change in chromatin structure.", "evidence": [ { "database": "UniProtKB", "id": "P80428", "url": "https://www.uniprot.org/uniprotkb/P80428" }, { "database": "PubMed", "id": "10911987", "url": "https://pubmed.ncbi.nlm.nih.gov/10911987" }, { "database": "PubMed", "id": "11937627", "url": "https://pubmed.ncbi.nlm.nih.gov/11937627" } ], "uniprot_canonical_ac": "P80428-1" } ], "record_id": "pubmed.10911987", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast enhancer of polycomb defines global Esa1-dependent acetylation of chromatin.", "journal": "Genes & development", "date": "2003-06-01", "authors": "Boudreault Alexandre A, Cronier Dominique, Selleck William, Lacoste Nicolas, Utley Rhea T, Allard St\u00e9phane, Savard Julie, Lane William S, Tan Song, C\u00f4t\u00e9 Jacques", "reference": { "type": "PubMed", "id": "12782659", "url": "https://pubmed.ncbi.nlm.nih.gov/12782659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43572-1", "protein_name": "Enhancer of polycomb-like protein 1", "gene_name": "EPL1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43572", "url": "https://www.uniprot.org/uniprotkb/P43572" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12782659", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Barrier proteins remodel and modify chromatin to restrict silenced domains.", "journal": "Molecular and cellular biology", "date": "2004-03", "authors": "Oki Masaya, Valenzuela Lourdes, Chiba Tomoko, Ito Takashi, Kamakaka Rohinton T", "reference": { "type": "PubMed", "id": "14966276", "url": "https://pubmed.ncbi.nlm.nih.gov/14966276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43572-1", "protein_name": "Enhancer of polycomb-like protein 1", "gene_name": "EPL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39970-1", "protein_name": "ATF/CREB activator 1", "gene_name": "ACA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04930-1", "protein_name": "Transcription factor CRF1", "gene_name": "CRF1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43572", "url": "https://www.uniprot.org/uniprotkb/P43572" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14966276", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A protein complex containing the conserved Swi2/Snf2-related ATPase Swr1p deposits histone variant H2A.Z into euchromatin.", "journal": "PLoS biology", "date": "2004-05", "authors": "Kobor Michael S, Venkatasubrahmanyam Shivkumar, Meneghini Marc D, Gin Jennifer W, Jennings Jennifer L, Link Andrew J, Madhani Hiten D, Rine Jasper", "reference": { "type": "PubMed", "id": "15045029", "url": "https://pubmed.ncbi.nlm.nih.gov/15045029" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43572-1", "protein_name": "Enhancer of polycomb-like protein 1", "gene_name": "EPL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53201-1", "protein_name": "SWR1-complex protein 4", "gene_name": "SWC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06337-1", "protein_name": "Chromatin modification-related protein EAF1", "gene_name": "EAF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31376-1", "protein_name": "SWR1-complex protein 3", "gene_name": "SWC3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38326-1", "protein_name": "SWR1-complex protein 5", "gene_name": "SWC5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P80428-1", "protein_name": "Actin-related protein 4", "gene_name": "ARP4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03388-1", "protein_name": "Vacuolar protein sorting-associated protein 72", "gene_name": "VPS72", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12509-1", "protein_name": "Actin-like protein ARP6", "gene_name": "ARP6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38806-1", "protein_name": "Chromatin modification-related protein YNG2", "gene_name": "YNG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53930-1", "protein_name": "Protein AF-9 homolog", "gene_name": "YAF9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03433-1", "protein_name": "Vacuolar protein sorting-associated protein 71", "gene_name": "VPS71", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05471-1", "protein_name": "Chromatin remodeling protein SWR1", "gene_name": "SWR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12692-1", "protein_name": "Histone H2A.Z", "gene_name": "HTZ1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06707-1", "protein_name": "SWR1-complex protein 7", "gene_name": "SWC7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03940-1", "protein_name": "RuvB-like protein 1", "gene_name": "RVB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12432-1", "protein_name": "Chromatin modification-related protein EAF3", "gene_name": "EAF3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12464-1", "protein_name": "RuvB-like protein 2", "gene_name": "RVB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08649-1", "protein_name": "Histone acetyltransferase ESA1", "gene_name": "ESA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43572", "url": "https://www.uniprot.org/uniprotkb/P43572" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15045029", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of chromosome stability by the histone H2A variant Htz1, the Swr1 chromatin remodeling complex, and the histone acetyltransferase NuA4.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Krogan Nevan J, Baetz Kristin, Keogh Michael-Christopher, Datta Nira, Sawa Chika, Kwok Trevor C Y, Thompson Natalie J, Davey Michael G, Pootoolal Jeff, Hughes Timothy R, Emili Andrew, Buratowski Stephen, Hieter Philip, Greenblatt Jack F", "reference": { "type": "PubMed", "id": "15353583", "url": "https://pubmed.ncbi.nlm.nih.gov/15353583" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43572-1", "protein_name": "Enhancer of polycomb-like protein 1", "gene_name": "EPL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47128-1", "protein_name": "Chromatin modification-related protein EAF6", "gene_name": "EAF6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53201-1", "protein_name": "SWR1-complex protein 4", "gene_name": "SWC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06337-1", "protein_name": "Chromatin modification-related protein EAF1", "gene_name": "EAF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53911-1", "protein_name": "Chromatin modification-related protein EAF7", "gene_name": "EAF7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38806-1", "protein_name": "Chromatin modification-related protein YNG2", "gene_name": "YNG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39995-1", "protein_name": "Chromatin modification-related protein EAF5", "gene_name": "EAF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53930-1", "protein_name": "Protein AF-9 homolog", "gene_name": "YAF9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05471-1", "protein_name": "Chromatin remodeling protein SWR1", "gene_name": "SWR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12692-1", "protein_name": "Histone H2A.Z", "gene_name": "HTZ1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12432-1", "protein_name": "Chromatin modification-related protein EAF3", "gene_name": "EAF3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08649-1", "protein_name": "Histone acetyltransferase ESA1", "gene_name": "ESA1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43572", "url": "https://www.uniprot.org/uniprotkb/P43572" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15353583", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Yaf9 component of the SWR1 and NuA4 complexes is required for proper gene expression, histone H4 acetylation, and Htz1 replacement near telomeres.", "journal": "Mol. Cell. Biol.", "date": "2004", "authors": "Zhang Haiying, Richardson Daniel O, Roberts Douglas N, Utley Rhea, Erdjument-Bromage Hediye, Tempst Paul, C\u00f4t\u00e9 Jacques, Cairns Bradley R", "reference": { "type": "PubMed", "id": "15485911", "url": "https://pubmed.ncbi.nlm.nih.gov/15485911" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43572-1", "protein_name": "Enhancer of polycomb-like protein 1", "gene_name": "EPL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47128-1", "protein_name": "Chromatin modification-related protein EAF6", "gene_name": "EAF6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53201-1", "protein_name": "SWR1-complex protein 4", "gene_name": "SWC4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06337-1", "protein_name": "Chromatin modification-related protein EAF1", "gene_name": "EAF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38806-1", "protein_name": "Chromatin modification-related protein YNG2", "gene_name": "YNG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39995-1", "protein_name": "Chromatin modification-related protein EAF5", "gene_name": "EAF5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53930-1", "protein_name": "Protein AF-9 homolog", "gene_name": "YAF9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12432-1", "protein_name": "Chromatin modification-related protein EAF3", "gene_name": "EAF3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43572", "url": "https://www.uniprot.org/uniprotkb/P43572" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15485911", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The enhancer of polycomb gene of Drosophila encodes a chromatin protein conserved in yeast and mammals.", "journal": "Development", "date": "1998", "authors": "Stankunas K, Berger J, Ruse C, Sinclair DA, Randazzo F, Brock HW", "reference": { "type": "PubMed", "id": "9735366", "url": "https://pubmed.ncbi.nlm.nih.gov/9735366" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43572-1", "protein_name": "Enhancer of polycomb-like protein 1", "gene_name": "EPL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q8C9X6-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "Epc1", "tax_name": "Mouse" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43572", "url": "https://www.uniprot.org/uniprotkb/P43572" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9735366", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Ubp6 family of deubiquitinating enzymes contains a ubiquitin-like domain: SUb.", "journal": "Protein Sci.", "date": "1999", "authors": "Wyndham A M, Baker R T, Chelvanayagam G", "reference": { "type": "PubMed", "id": "10386876", "url": "https://pubmed.ncbi.nlm.nih.gov/10386876" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43593-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 6", "gene_name": "UBP6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43593", "url": "https://www.uniprot.org/uniprotkb/P43593" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10386876", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemically synthesized ubiquitin extension proteins detect distinct catalytic capacities of deubiquitinating enzymes.", "journal": "Analytical biochemistry", "date": "1999-10-01", "authors": "Layfield R, Franklin K, Landon M, Walker G, Wang P, Ramage R, Brown A, Love S, Urquhart K, Muir T, Baker R, Mayer R J", "reference": { "type": "PubMed", "id": "10527495", "url": "https://pubmed.ncbi.nlm.nih.gov/10527495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43593-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 6", "gene_name": "UBP6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35127-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase YUH1", "gene_name": "YUH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43593", "url": "https://www.uniprot.org/uniprotkb/P43593" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.10527495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteasomal proteomics: identification of nucleotide-sensitive proteasome-interacting proteins by mass spectrometric analysis of affinity-purified proteasomes.", "journal": "Mol. Biol. Cell", "date": "2000", "authors": "Verma R, Chen S, Feldman R, Schieltz D, Yates J, Dohmen J, Deshaies R J", "reference": { "type": "PubMed", "id": "11029046", "url": "https://pubmed.ncbi.nlm.nih.gov/11029046" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43593-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 6", "gene_name": "UBP6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "O13563-1", "protein_name": "26S proteasome regulatory subunit RPN13", "gene_name": "RPN13", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43593", "url": "https://www.uniprot.org/uniprotkb/P43593" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11029046", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple associated proteins regulate proteasome structure and function.", "journal": "Molecular cell", "date": "2002-09", "authors": "Leggett David S, Hanna John, Borodovsky Anna, Crosas Bernat, Schmidt Marion, Baker Rohan T, Walz Thomas, Ploegh Hidde, Finley Daniel", "reference": { "type": "PubMed", "id": "12408819", "url": "https://pubmed.ncbi.nlm.nih.gov/12408819" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43593-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 6", "gene_name": "UBP6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38737-1", "protein_name": "Proteasome component ECM29", "gene_name": "ECM29", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43593", "url": "https://www.uniprot.org/uniprotkb/P43593" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12408819", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complementary roles for Rpn11 and Ubp6 in deubiquitination and proteolysis by the proteasome.", "journal": "The Journal of biological chemistry", "date": "2004-01-16", "authors": "Guterman Adi, Glickman Michael H", "reference": { "type": "PubMed", "id": "14581483", "url": "https://pubmed.ncbi.nlm.nih.gov/14581483" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43593-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 6", "gene_name": "UBP6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43593", "url": "https://www.uniprot.org/uniprotkb/P43593" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14581483", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deubiquitinating enzyme Ubp6 functions noncatalytically to delay proteasomal degradation.", "journal": "Cell", "date": "2006-10-06", "authors": "Hanna John, Hathaway Nathaniel A, Tone Yoshiko, Crosas Bernat, Elsasser Suzanne, Kirkpatrick Donald S, Leggett David S, Gygi Steven P, King Randall W, Finley Daniel", "reference": { "type": "PubMed", "id": "17018280", "url": "https://pubmed.ncbi.nlm.nih.gov/17018280" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43593-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 6", "gene_name": "UBP6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43593", "url": "https://www.uniprot.org/uniprotkb/P43593" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17018280", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitin chains are remodeled at the proteasome by opposing ubiquitin ligase and deubiquitinating activities.", "journal": "Cell", "date": "2006-12-29", "authors": "Crosas Bernat, Hanna John, Kirkpatrick Donald S, Zhang Dan Phoebe, Tone Yoshiko, Hathaway Nathaniel A, Buecker Christa, Leggett David S, Schmidt Marion, King Randall W, Gygi Steven P, Finley Daniel", "reference": { "type": "PubMed", "id": "17190603", "url": "https://pubmed.ncbi.nlm.nih.gov/17190603" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43593-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 6", "gene_name": "UBP6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53119-1", "protein_name": "E3 ubiquitin-protein ligase HUL5", "gene_name": "HUL5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38886-1", "protein_name": "26S proteasome regulatory subunit RPN10", "gene_name": "RPN10", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43593", "url": "https://www.uniprot.org/uniprotkb/P43593" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 878, "end_pos": 878, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes E3 ubiquitin-protein ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "P53119", "url": "https://www.uniprot.org/uniprotkb/P53119" }, { "database": "PubMed", "id": "20008553", "url": "https://pubmed.ncbi.nlm.nih.gov/20008553" }, { "database": "PubMed", "id": "21983566", "url": "https://pubmed.ncbi.nlm.nih.gov/21983566" }, { "database": "PubMed", "id": "17190603", "url": "https://pubmed.ncbi.nlm.nih.gov/17190603" } ], "uniprot_canonical_ac": "P53119-1" } ], "record_id": "pubmed.17190603", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and characterization of UBP6, a new ubiquitin-specific protease in Saccharomyces cerevisiae.", "journal": "Archives of biochemistry and biophysics", "date": "1997-11-01", "authors": "Park K C, Woo S K, Yoo Y J, Wyndham A M, Baker R T, Chung C H", "reference": { "type": "PubMed", "id": "9344467", "url": "https://pubmed.ncbi.nlm.nih.gov/9344467" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43593-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 6", "gene_name": "UBP6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43593", "url": "https://www.uniprot.org/uniprotkb/P43593" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9344467", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A screen for genes required for meiosis and spore formation based on whole-genome expression.", "journal": "Current biology : CB", "date": "2001-07-10", "authors": "Rabitsch K P, T\u00f3th A, G\u00e1lov\u00e1 M, Schleiffer A, Schaffner G, Aigner E, Rupp C, Penkner A M, Moreno-Borchart A C, Primig M, Esposito R E, Klein F, Knop M, Nasmyth K", "reference": { "type": "PubMed", "id": "11470404", "url": "https://pubmed.ncbi.nlm.nih.gov/11470404" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08955-1", "protein_name": "Chromosome segregation in meiosis protein 4", "gene_name": "CSM4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02651-1", "protein_name": "Spore membrane assembly protein 1", "gene_name": "SMA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04659-1", "protein_name": "Chromosome segregation in meiosis protein 3", "gene_name": "CSM3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40465-1", "protein_name": "Chromosome segregation in meiosis protein 2", "gene_name": "CSM2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40031-1", "protein_name": "Sporulation-specific protein 73", "gene_name": "SPO73", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40511-1", "protein_name": "Sporulation-specific protein 22", "gene_name": "SPO22", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q04658-1", "protein_name": "Spore membrane assembly protein 2", "gene_name": "SMA2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05955-1", "protein_name": "Accumulates dyads protein 4", "gene_name": "ADY4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06134-1", "protein_name": "Sporulation-specific protein 77", "gene_name": "SPO77", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07798-1", "protein_name": "Sporulation-specific protein 75", "gene_name": "SPO75", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25613-1", "protein_name": "Accumulation of dyads protein 2", "gene_name": "ADY2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25651-1", "protein_name": "Monopolin complex subunit CSM1", "gene_name": "CSM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40065-1", "protein_name": "Monopolin complex subunit MAM1", "gene_name": "MAM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11470404", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of the Saccharomyces cerevisiae YFR021w/YGR223c/YPL100w ORF family suggests relations to mitochondrial/peroxisomal functions and amino acid signalling pathways.", "journal": "Yeast (Chichester, England)", "date": "2001-09-15", "authors": "Georgakopoulos T, Koutroubas G, Vakonakis I, Tzermia M, Prokova V, Voutsina A, Alexandraki D", "reference": { "type": "PubMed", "id": "11536337", "url": "https://pubmed.ncbi.nlm.nih.gov/11536337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P50079-1", "protein_name": "SVP1-like protein 2", "gene_name": "HSV2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02887-1", "protein_name": "Autophagy-related protein 21", "gene_name": "ATG21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11536337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autophagy and the cytoplasm to vacuole targeting pathway both require Aut10p.", "journal": "FEBS letters", "date": "2001", "authors": "Barth H, Meiling-Wesse K, Epple UD, Thumm M", "reference": { "type": "PubMed", "id": "11707261", "url": "https://pubmed.ncbi.nlm.nih.gov/11707261" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11707261", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cvt18/Gsa12 is required for cytoplasm-to-vacuole transport, pexophagy, and autophagy in Saccharomyces cerevisiae and Pichia pastoris.", "journal": "Molecular biology of the cell", "date": "2001-12", "authors": "Guan J, Stromhaug P E, George M D, Habibzadegah-Tari P, Bevan A, Dunn W A, Klionsky D J", "reference": { "type": "PubMed", "id": "11739783", "url": "https://pubmed.ncbi.nlm.nih.gov/11739783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11739783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A unified nomenclature for yeast autophagy-related genes.", "journal": "Dev. Cell", "date": "2003", "authors": "Klionsky Daniel J, Cregg James M, Dunn William A, Emr Scott D, Sakai Yasuyoshi, Sandoval Ignacio V, Sibirny Andrei, Subramani Suresh, Thumm Michael, Veenhuis Marten, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "14536056", "url": "https://pubmed.ncbi.nlm.nih.gov/14536056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P46989-1", "protein_name": "Autophagy-related protein 27", "gene_name": "ATG27", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47057-1", "protein_name": "Sorting nexin-4", "gene_name": "SNX4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53855-1", "protein_name": "Autophagy-related protein 2", "gene_name": "ATG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53867-1", "protein_name": "Cysteine protease ATG4", "gene_name": "ATG4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06410-1", "protein_name": "Autophagy-related protein 17", "gene_name": "ATG17", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06628-1", "protein_name": "Autophagy-related protein 13", "gene_name": "ATG13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07528-1", "protein_name": "Autophagy-related protein 20", "gene_name": "ATG20", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07879-1", "protein_name": "Ubiquitin-like-conjugating enzyme ATG10", "gene_name": "ATG10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02887-1", "protein_name": "Autophagy-related protein 21", "gene_name": "ATG21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06321-1", "protein_name": "Sterol 3-beta-glucosyltransferase", "gene_name": "ATG26", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06671-1", "protein_name": "Autophagy-related protein 23", "gene_name": "ATG23", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38316-1", "protein_name": "Ubiquitin-like protein ATG12", "gene_name": "ATG12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53104-1", "protein_name": "Serine/threonine-protein kinase ATG1", "gene_name": "ATG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12527-1", "protein_name": "Autophagy-related protein 11", "gene_name": "ATG11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25568-1", "protein_name": "Autophagy-related protein 22", "gene_name": "ATG22", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35193-1", "protein_name": "Autophagy-related protein 19", "gene_name": "ATG19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38862-1", "protein_name": "Ubiquitin-like modifier-activating enzyme ATG7", "gene_name": "ATG7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40344-1", "protein_name": "Autophagy-related protein 3", "gene_name": "ATG3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14536056", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Atg1-Atg13 complex regulates Atg9 and Atg23 retrieval transport from the pre-autophagosomal structure.", "journal": "Developmental cell", "date": "2004-01", "authors": "Reggiori Fulvio, Tucker Katherine A, Stromhaug Per E, Klionsky Daniel J", "reference": { "type": "PubMed", "id": "14723849", "url": "https://pubmed.ncbi.nlm.nih.gov/14723849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53855-1", "protein_name": "Autophagy-related protein 2", "gene_name": "ATG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06628-1", "protein_name": "Autophagy-related protein 13", "gene_name": "ATG13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06671-1", "protein_name": "Autophagy-related protein 23", "gene_name": "ATG23", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53104-1", "protein_name": "Serine/threonine-protein kinase ATG1", "gene_name": "ATG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.14723849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Svp1p defines a family of phosphatidylinositol 3,5-bisphosphate effectors.", "journal": "The EMBO journal", "date": "2004-05-05", "authors": "Dove Stephen K, Piper Robert C, McEwen Robert K, Yu Jong W, King Megan C, Hughes David C, Thuring Jan, Holmes Andrew B, Cooke Frank T, Michell Robert H, Parker Peter J, Lemmon Mark A", "reference": { "type": "PubMed", "id": "15103325", "url": "https://pubmed.ncbi.nlm.nih.gov/15103325" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P50079-1", "protein_name": "SVP1-like protein 2", "gene_name": "HSV2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02887-1", "protein_name": "Autophagy-related protein 21", "gene_name": "ATG21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 285, "end_pos": 286, "sequence_org": "RR", "sequence_mut": "TT", "comment": "Leads to a 40-fold decrease of affinity to PIP2.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "15103325", "url": "https://pubmed.ncbi.nlm.nih.gov/15103325" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 73, "end_pos": 76, "sequence_org": "RRLR", "sequence_mut": "SSLS", "comment": "Leads to a slight reduction of PIP2 binding.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "15103325", "url": "https://pubmed.ncbi.nlm.nih.gov/15103325" } ], "uniprot_canonical_ac": "P43601-1" } ], "record_id": "pubmed.15103325", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atg21 is a phosphoinositide binding protein required for efficient lipidation and localization of Atg8 during uptake of aminopeptidase I by selective autophagy.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Stromhaug PE, Reggiori F, Guan J, Wang CW, Klionsky DJ", "reference": { "type": "PubMed", "id": "15155809", "url": "https://pubmed.ncbi.nlm.nih.gov/15155809" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02887-1", "protein_name": "Autophagy-related protein 21", "gene_name": "ATG21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 343, "end_pos": 344, "sequence_org": "RR", "sequence_mut": "KK", "comment": "Loss of aminopeptidase I precursor maturation and no more association with vacuole and punctate structures.", "evidence": [ { "database": "UniProtKB", "id": "Q02887", "url": "https://www.uniprot.org/uniprotkb/Q02887" }, { "database": "PubMed", "id": "15155809", "url": "https://pubmed.ncbi.nlm.nih.gov/15155809" } ], "uniprot_canonical_ac": "Q02887-1" } ], "record_id": "pubmed.15155809", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atg21 is required for effective recruitment of Atg8 to the preautophagosomal structure during the Cvt pathway.", "journal": "The Journal of biological chemistry", "date": "2004-09-03", "authors": "Meiling-Wesse Khuyen, Barth Henning, Voss Christiane, Eskelinen Eeva-Liisa, Epple Ulrike D, Thumm Michael", "reference": { "type": "PubMed", "id": "15194695", "url": "https://pubmed.ncbi.nlm.nih.gov/15194695" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02887-1", "protein_name": "Autophagy-related protein 21", "gene_name": "ATG21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35193-1", "protein_name": "Autophagy-related protein 19", "gene_name": "ATG19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15194695", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The relevance of the phosphatidylinositolphosphat-binding motif FRRGT of Atg18 and Atg21 for the Cvt pathway and autophagy.", "journal": "FEBS letters", "date": "2006-08-21", "authors": "Krick Roswitha, Tolstrup J\u00f6rn, Appelles Anika, Henke Sandra, Thumm Michael", "reference": { "type": "PubMed", "id": "16876790", "url": "https://pubmed.ncbi.nlm.nih.gov/16876790" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02887-1", "protein_name": "Autophagy-related protein 21", "gene_name": "ATG21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.16876790", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atg18 regulates organelle morphology and Fab1 kinase activity independent of its membrane recruitment by phosphatidylinositol 3,5-bisphosphate.", "journal": "Molecular biology of the cell", "date": "2007-11", "authors": "Efe Jem A, Botelho Roberto J, Emr Scott D", "reference": { "type": "PubMed", "id": "17699591", "url": "https://pubmed.ncbi.nlm.nih.gov/17699591" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25591-1", "protein_name": "vacuole-related protein 17", "gene_name": "VAC17", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17699591", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of autophagy-related proteins in yeast using a versatile plasmid-based resource of fluorescent protein fusions.", "journal": "Autophagy", "date": "2008", "authors": "Ma Jun, Bharucha Nik\u00eb, Dobry Craig J, Frisch Ryan L, Lawson Sarah, Kumar Anuj", "reference": { "type": "PubMed", "id": "18497569", "url": "https://pubmed.ncbi.nlm.nih.gov/18497569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12380-1", "protein_name": "Autophagy protein 5", "gene_name": "ATG5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06671-1", "protein_name": "Autophagy-related protein 23", "gene_name": "ATG23", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53104-1", "protein_name": "Serine/threonine-protein kinase ATG1", "gene_name": "ATG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12527-1", "protein_name": "Autophagy-related protein 11", "gene_name": "ATG11", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P35193-1", "protein_name": "Autophagy-related protein 19", "gene_name": "ATG19", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38862-1", "protein_name": "Ubiquitin-like modifier-activating enzyme ATG7", "gene_name": "ATG7", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18497569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Atg18-Atg2 complex is recruited to autophagic membranes via phosphatidylinositol 3-phosphate and exerts an essential function.", "journal": "The Journal of biological chemistry", "date": "2008-08-29", "authors": "Obara Keisuke, Sekito Takayuki, Niimi Kaori, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "18586673", "url": "https://pubmed.ncbi.nlm.nih.gov/18586673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53855-1", "protein_name": "Autophagy-related protein 2", "gene_name": "ATG2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18586673", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dissecting the localization and function of Atg18, Atg21 and Ygr223c.", "journal": "Autophagy", "date": "2008-10", "authors": "Krick Roswitha, Henke Sandra, Tolstrup Joern, Thumm Michael", "reference": { "type": "PubMed", "id": "18769150", "url": "https://pubmed.ncbi.nlm.nih.gov/18769150" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P50079-1", "protein_name": "SVP1-like protein 2", "gene_name": "HSV2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02887-1", "protein_name": "Autophagy-related protein 21", "gene_name": "ATG21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18769150", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Self-interaction is critical for Atg9 transport and function at the phagophore assembly site during autophagy.", "journal": "Molecular biology of the cell", "date": "2008-12", "authors": "He Congcong, Baba Misuzu, Cao Yang, Klionsky Daniel J", "reference": { "type": "PubMed", "id": "18829864", "url": "https://pubmed.ncbi.nlm.nih.gov/18829864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53855-1", "protein_name": "Autophagy-related protein 2", "gene_name": "ATG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06628-1", "protein_name": "Autophagy-related protein 13", "gene_name": "ATG13", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38270-1", "protein_name": "Autophagy-related protein 14", "gene_name": "ATG14", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.18829864", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "VAC14 nucleates a protein complex essential for the acute interconversion of PI3P and PI(3,5)P(2) in yeast and mouse.", "journal": "The EMBO journal", "date": "2008", "authors": "Jin N, Chow CY, Liu L, Zolov SN, Bronson R, Davisson M, Petersen JL, Zhang Y, Park S, Duex JE, Goldowitz D, Meisler MH, Weisman LS", "reference": { "type": "PubMed", "id": "19037259", "url": "https://pubmed.ncbi.nlm.nih.gov/19037259" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34756-1", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase FAB1", "gene_name": "FAB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P42837-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "FIG4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9Z1T6-2", "protein_name": "1-phosphatidylinositol 3-phosphate 5-kinase", "gene_name": "Pikfyve", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P53950-1", "protein_name": "Vacuolar segregation protein 7", "gene_name": "VAC7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06708-1", "protein_name": "Vacuole morphology and inheritance protein 14", "gene_name": "VAC14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q91WF7-1", "protein_name": "Polyphosphoinositide phosphatase", "gene_name": "Fig4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q80WQ2-1", "protein_name": "Protein VAC14 homolog", "gene_name": "Vac14", "tax_name": "Mouse" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 864, "end_pos": 864, "sequence_org": "G", "sequence_mut": "E", "comment": "Loss of interaction with VAC14. Failure to localize to the vacuole membrane.", "evidence": [ { "database": "UniProtKB", "id": "P34756", "url": "https://www.uniprot.org/uniprotkb/P34756" }, { "database": "PubMed", "id": "19037259", "url": "https://pubmed.ncbi.nlm.nih.gov/19037259" } ], "uniprot_canonical_ac": "P34756-1" }, { "start_pos": 101, "end_pos": 101, "sequence_org": "Q", "sequence_mut": "R", "comment": "Loss of interaction with ATG18 and VAC7.", "evidence": [ { "database": "UniProtKB", "id": "Q06708", "url": "https://www.uniprot.org/uniprotkb/Q06708" }, { "database": "PubMed", "id": "19037259", "url": "https://pubmed.ncbi.nlm.nih.gov/19037259" } ], "uniprot_canonical_ac": "Q06708-1" }, { "start_pos": 149, "end_pos": 149, "sequence_org": "L", "sequence_mut": "R", "comment": "Loss of interaction with ATG18, FAB1 and VAC7. No loss of interaction with FIG4.", "evidence": [ { "database": "UniProtKB", "id": "Q06708", "url": "https://www.uniprot.org/uniprotkb/Q06708" }, { "database": "PubMed", "id": "19037259", "url": "https://pubmed.ncbi.nlm.nih.gov/19037259" } ], "uniprot_canonical_ac": "Q06708-1" }, { "start_pos": 56, "end_pos": 56, "sequence_org": "H", "sequence_mut": "Y", "comment": "Loss of interaction with ATG18 and VAC7.", "evidence": [ { "database": "UniProtKB", "id": "Q06708", "url": "https://www.uniprot.org/uniprotkb/Q06708" }, { "database": "PubMed", "id": "19037259", "url": "https://pubmed.ncbi.nlm.nih.gov/19037259" } ], "uniprot_canonical_ac": "Q06708-1" }, { "start_pos": 61, "end_pos": 61, "sequence_org": "R", "sequence_mut": "K", "comment": "Loss of interaction with ATG18 and VAC7.", "evidence": [ { "database": "UniProtKB", "id": "Q06708", "url": "https://www.uniprot.org/uniprotkb/Q06708" }, { "database": "PubMed", "id": "19037259", "url": "https://pubmed.ncbi.nlm.nih.gov/19037259" } ], "uniprot_canonical_ac": "Q06708-1" } ], "record_id": "pubmed.19037259", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Roles of the lipid-binding motifs of Atg18 and Atg21 in the cytoplasm to vacuole targeting pathway and autophagy.", "journal": "The Journal of biological chemistry", "date": "2010-04-09", "authors": "Nair Usha, Cao Yang, Xie Zhiping, Klionsky Daniel J", "reference": { "type": "PubMed", "id": "20154084", "url": "https://pubmed.ncbi.nlm.nih.gov/20154084" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03818-1", "protein_name": "Autophagy protein 16", "gene_name": "ATG16", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02887-1", "protein_name": "Autophagy-related protein 21", "gene_name": "ATG21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38182-1", "protein_name": "Autophagy-related protein 8", "gene_name": "ATG8", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.20154084", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphoinositide [PI(3,5)P2] lipid-dependent regulation of the general transcriptional regulator Tup1.", "journal": "Genes Dev.", "date": "2011", "authors": "Han Bong-Kwan, Emr Scott D", "reference": { "type": "PubMed", "id": "21536737", "url": "https://pubmed.ncbi.nlm.nih.gov/21536737" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.21536737", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GFP-Atg8 protease protection as a tool to monitor autophagosome biogenesis.", "journal": "Autophagy", "date": "2011-12", "authors": "Nair Usha, Thumm Michael, Klionsky Daniel J, Krick Roswitha", "reference": { "type": "PubMed", "id": "22108003", "url": "https://pubmed.ncbi.nlm.nih.gov/22108003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02887-1", "protein_name": "Autophagy-related protein 21", "gene_name": "ATG21", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22108003", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA replication stress differentially regulates G1/S genes via Rad53-dependent inactivation of Nrm1.", "journal": "The EMBO journal", "date": "2012-04-04", "authors": "Travesa Anna, Kuo Dwight, de Bruin Robertus A M, Kalashnikova Tatyana I, Guaderrama Marisela, Thai Kevin, Aslanian Aaron, Smolka Marcus B, Yates John R, Ideker Trey, Wittenberg Curt", "reference": { "type": "PubMed", "id": "22333915", "url": "https://pubmed.ncbi.nlm.nih.gov/22333915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53718-1", "protein_name": "Transcription factor NRM1", "gene_name": "NRM1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "IntAct", "id": "P43601", "url": "https://www.ebi.ac.uk/intact/interactors/id:P43601*" }, { "database": "iPTMnet", "id": "P43601", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43601" }, { "database": "PubMed", "id": "22333915", "url": "https://pubmed.ncbi.nlm.nih.gov/22333915" } ], "site_lbl": "Tyr47", "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 240, "end_pos": 240, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005292", "url": "https://www.yeastgenome.org/locus/S000005292" }, { "database": "iPTMnet", "id": "P53718", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53718" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "22333915", "url": "https://pubmed.ncbi.nlm.nih.gov/22333915" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser240", "uniprot_canonical_ac": "P53718-1" }, { "start_pos": 42, "end_pos": 42, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005292", "url": "https://www.yeastgenome.org/locus/S000005292" }, { "database": "iPTMnet", "id": "P53718", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53718" }, { "database": "PubMed", "id": "22333915", "url": "https://pubmed.ncbi.nlm.nih.gov/22333915" } ], "site_lbl": "Thr42", "uniprot_canonical_ac": "P53718-1" }, { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000005292", "url": "https://www.yeastgenome.org/locus/S000005292" }, { "database": "iPTMnet", "id": "P53718", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53718" }, { "database": "PubMed", "id": "22333915", "url": "https://pubmed.ncbi.nlm.nih.gov/22333915" } ], "site_lbl": "Ser47", "uniprot_canonical_ac": "P53718-1" } ], "record_id": "pubmed.22333915", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two-site recognition of phosphatidylinositol 3-phosphate by PROPPINs in autophagy.", "journal": "Mol. Cell", "date": "2012", "authors": "Baskaran Sulochanadevi, Ragusa Michael J, Boura Evzen, Hurley James H", "reference": { "type": "PubMed", "id": "22704557", "url": "https://pubmed.ncbi.nlm.nih.gov/22704557" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22704557", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autophagosome formation can be achieved in the absence of Atg18 by expressing engineered PAS-targeted Atg2.", "journal": "FEBS letters", "date": "2012-07-30", "authors": "Kobayashi Takafumi, Suzuki Kuninori, Ohsumi Yoshinori", "reference": { "type": "PubMed", "id": "22728243", "url": "https://pubmed.ncbi.nlm.nih.gov/22728243" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53855-1", "protein_name": "Autophagy-related protein 2", "gene_name": "ATG2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22728243", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and functional characterization of the two phosphoinositide binding sites of PROPPINs, a \u03b2-propeller protein family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012-07-24", "authors": "Krick Roswitha, Busse Ricarda A, Scacioc Andreea, Stephan Milena, Janshoff Andreas, Thumm Michael, K\u00fchnel Karin", "reference": { "type": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 264, "end_pos": 264, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs membrane-association.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 268, "end_pos": 268, "sequence_org": "T", "sequence_mut": "A", "comment": "Impairs membrane-association.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 271, "end_pos": 271, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs membrane-association.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 285, "end_pos": 285, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs membrane-association.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 285, "end_pos": 286, "sequence_org": "RR", "sequence_mut": "GG", "comment": "Loss of recruitment to vacuole membrane.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 285, "end_pos": 286, "sequence_org": "RR", "sequence_mut": "TT", "comment": "Leads to a 40-fold decrease of affinity to PIP2.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "15103325", "url": "https://pubmed.ncbi.nlm.nih.gov/15103325" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 286, "end_pos": 286, "sequence_org": "R", "sequence_mut": "A", "comment": "Impairs membrane-association.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 311, "end_pos": 311, "sequence_org": "S", "sequence_mut": "A", "comment": "Impairs membrane-association.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 313, "end_pos": 313, "sequence_org": "T", "sequence_mut": "A", "comment": "Impairs membrane-association.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" }, { "start_pos": 315, "end_pos": 315, "sequence_org": "H", "sequence_mut": "A", "comment": "Impairs membrane-association.", "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" }, { "database": "PubMed", "id": "22753491", "url": "https://pubmed.ncbi.nlm.nih.gov/22753491" } ], "uniprot_canonical_ac": "P43601-1" } ], "record_id": "pubmed.22753491", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast vacuoles fragment in an asymmetrical two-phase process with distinct protein requirements.", "journal": "Molecular biology of the cell", "date": "2012-09", "authors": "Zieger Martin, Mayer Andreas", "reference": { "type": "PubMed", "id": "22787281", "url": "https://pubmed.ncbi.nlm.nih.gov/22787281" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22787281", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KCS1 deletion in Saccharomyces cerevisiae leads to a defect in translocation of autophagic proteins and reduces autophagosome formation.", "journal": "Autophagy", "date": "2012", "authors": "Taylor Robert, Chen Po-Hao, Chou Chia-Ching, Patel Jasmin, Jin Shengkan V", "reference": { "type": "PubMed", "id": "22889849", "url": "https://pubmed.ncbi.nlm.nih.gov/22889849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22889849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Early steps in autophagy depend on direct phosphorylation of Atg9 by the Atg1 kinase.", "journal": "Mol. Cell", "date": "2014", "authors": "Papinski Daniel, Schuschnig Martina, Reiter Wolfgang, Wilhelm Larissa, Barnes Christopher A, Maiolica Alessio, Hansmann Isabella, Pfaffenwimmer Thaddaeus, Kijanska Monika, Stoffel Ingrid, Lee Sung Sik, Brezovich Andrea, Lou Jane Hua, Turk Benjamin E, Aebersold Ruedi, Ammerer Gustav, Peter Matthias, Kraft Claudine", "reference": { "type": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53855-1", "protein_name": "Autophagy-related protein 2", "gene_name": "ATG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12038-1", "protein_name": "Exocytosis protein SRO7", "gene_name": "SRO7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32383-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase 1", "gene_name": "PLC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32465-1", "protein_name": "Low-affinity glucose transporter HXT1", "gene_name": "HXT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P34225-1", "protein_name": "Guanine-nucleotide exchange factor YEL1", "gene_name": "YEL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36048-1", "protein_name": "Pre-mRNA-splicing factor SNU114", "gene_name": "SNU114", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36117-1", "protein_name": "Arrestin-related trafficking adapter 6", "gene_name": "ALY1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38274-1", "protein_name": "Protein arginine N-methyltransferase HSL7", "gene_name": "HSL7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47065-1", "protein_name": "Protein PET130", "gene_name": "PET130", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47107-1", "protein_name": "Uncharacterized protein YJR039W", "gene_name": "J1614", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06821-1", "protein_name": "Uncharacterized protein YPR084W", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38227-1", "protein_name": "Quinidine resistance protein 3", "gene_name": "QDR3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39538-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 12", "gene_name": "UBP12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53104-1", "protein_name": "Serine/threonine-protein kinase ATG1", "gene_name": "ATG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38849-1", "protein_name": "Maintenance of telomere capping protein 6", "gene_name": "MTC6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43623-1", "protein_name": "Putative cystathionine beta-lyase", "gene_name": "IRC7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03782-1", "protein_name": "56 kDa U1 small nuclear ribonucleoprotein component", "gene_name": "SNU56", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q06216-1", "protein_name": "Serine/threonine-protein phosphatase 1 regulatory subunit PIG1", "gene_name": "PIG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07500-1", "protein_name": "External NADH-ubiquinone oxidoreductase 2, mitochondrial", "gene_name": "NDE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P23293-1", "protein_name": "Serine/threonine-protein kinase BUR1", "gene_name": "SGV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40969-1", "protein_name": "Centromere DNA-binding protein complex CBF3 subunit B", "gene_name": "CEP3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04397-1", "protein_name": "Bifunctional protein GAL10", "gene_name": "GAL10", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38242-1", "protein_name": "UDP-N-acetylglucosamine transferase subunit ALG14", "gene_name": "ALG14", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28737-1", "protein_name": "Outer mitochondrial transmembrane helix translocase", "gene_name": "MSP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 1086, "end_pos": 1086, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect autophagy; when associated with A-249.", "evidence": [ { "database": "UniProtKB", "id": "P53855", "url": "https://www.uniprot.org/uniprotkb/P53855" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "P53855-1" }, { "start_pos": 1086, "end_pos": 1086, "sequence_org": "S", "sequence_mut": "D", "comment": "Phospho-mimetic mutant; does not affect autophagy; when associated with D-249.", "evidence": [ { "database": "UniProtKB", "id": "P53855", "url": "https://www.uniprot.org/uniprotkb/P53855" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "P53855-1" }, { "start_pos": 249, "end_pos": 249, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect autophagy; when associated with A-1086.", "evidence": [ { "database": "UniProtKB", "id": "P53855", "url": "https://www.uniprot.org/uniprotkb/P53855" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "P53855-1" }, { "start_pos": 249, "end_pos": 249, "sequence_org": "S", "sequence_mut": "D", "comment": "Phospho-mimetic mutant; does not affect autophagy; when associated with D-1086.", "evidence": [ { "database": "UniProtKB", "id": "P53855", "url": "https://www.uniprot.org/uniprotkb/P53855" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "P53855-1" }, { "start_pos": 19, "end_pos": 19, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation; when associated with A-657, A-802, A-804, A-831, A-842, A-948 and A-969.", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 657, "end_pos": 657, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation; when associated with A-19, A-802, A-804, A-831, A-842, A-948 and A-969.", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 802, "end_pos": 802, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation; when associated with A-19, A-657, A-804, A-831, A-842, A-948 and A-969.", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 804, "end_pos": 804, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolished autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation; when associated with A-19, A-657, A-802, A-831, A-842, A-948 and A-969.", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 831, "end_pos": 831, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation; when associated with A-19, A-657, A-802, A-804, A-842, A-948 and A-969.", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 842, "end_pos": 842, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation; when associated with A-19, A-657, A-802, A-804, A-831, A-948 and A-969.", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 948, "end_pos": 948, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation; when associated with A-19, A-657, A-802, A-804, A-831, A-842 and A-969.", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 969, "end_pos": 969, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolished autophagy and cytoplasm to vacuole transport (Cvt) vesicle formation; when associated with A-19, A-657, A-802, A-804, A-831 and A-842.", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 211, "end_pos": 211, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolished kinase activity. Loss of cell viability under starvation.", "evidence": [ { "database": "UniProtKB", "id": "P53104", "url": "https://www.uniprot.org/uniprotkb/P53104" }, { "database": "PubMed", "id": "9224897", "url": "https://pubmed.ncbi.nlm.nih.gov/9224897" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" }, { "database": "PubMed", "id": "23549786", "url": "https://pubmed.ncbi.nlm.nih.gov/23549786" }, { "database": "PubMed", "id": "28821724", "url": "https://pubmed.ncbi.nlm.nih.gov/28821724" } ], "uniprot_canonical_ac": "P53104-1" } ], "phosphorylation": [ { "start_pos": 1086, "end_pos": 1086, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "P53855", "url": "https://www.uniprot.org/uniprotkb/P53855" }, { "database": "iPTMnet", "id": "P53855", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53855" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser1086", "uniprot_canonical_ac": "P53855-1" }, { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "P53855", "url": "https://www.uniprot.org/uniprotkb/P53855" }, { "database": "SGD", "id": "S000005186", "url": "https://www.yeastgenome.org/locus/S000005186" }, { "database": "iPTMnet", "id": "P53855", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53855" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P53855-1" }, { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006236", "url": "https://www.yeastgenome.org/locus/S000006236" }, { "database": "iPTMnet", "id": "Q12038", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12038" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "Q12038-1" }, { "start_pos": 223, "end_pos": 223, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006189", "url": "https://www.yeastgenome.org/locus/S000006189" }, { "database": "iPTMnet", "id": "P32383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32383" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser223", "uniprot_canonical_ac": "P32383-1" }, { "start_pos": 46, "end_pos": 46, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P32465", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32465" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000001136", "url": "https://www.yeastgenome.org/locus/S000001136" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser46", "uniprot_canonical_ac": "P32465-1" }, { "start_pos": 155, "end_pos": 155, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000156", "url": "https://www.yeastgenome.org/locus/S000000156" }, { "database": "iPTMnet", "id": "P34225", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P34225" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser155", "uniprot_canonical_ac": "P34225-1" }, { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001656", "url": "https://www.yeastgenome.org/locus/S000001656" }, { "database": "iPTMnet", "id": "P36048", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36048" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser351", "uniprot_canonical_ac": "P36048-1" }, { "start_pos": 157, "end_pos": 157, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001729", "url": "https://www.yeastgenome.org/locus/S000001729" }, { "database": "iPTMnet", "id": "P36117", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P36117" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser157", "uniprot_canonical_ac": "P36117-1" }, { "start_pos": 343, "end_pos": 343, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000337", "url": "https://www.yeastgenome.org/locus/S000000337" }, { "database": "iPTMnet", "id": "P38274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38274" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser343", "uniprot_canonical_ac": "P38274-1" }, { "start_pos": 257, "end_pos": 257, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003560", "url": "https://www.yeastgenome.org/locus/S000003560" }, { "database": "iPTMnet", "id": "P47065", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47065" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser257", "uniprot_canonical_ac": "P47065-1" }, { "start_pos": 1057, "end_pos": 1057, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003800", "url": "https://www.yeastgenome.org/locus/S000003800" }, { "database": "iPTMnet", "id": "P47107", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P47107" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser1057", "uniprot_canonical_ac": "P47107-1" }, { "start_pos": 203, "end_pos": 203, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006288", "url": "https://www.yeastgenome.org/locus/S000006288" }, { "database": "iPTMnet", "id": "Q06821", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06821" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser203", "uniprot_canonical_ac": "Q06821-1" }, { "start_pos": 125, "end_pos": 125, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000247", "url": "https://www.yeastgenome.org/locus/S000000247" }, { "database": "iPTMnet", "id": "P38227", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38227" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser125", "uniprot_canonical_ac": "P38227-1" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "SGD", "id": "S000002308", "url": "https://www.yeastgenome.org/locus/S000002308" }, { "database": "iPTMnet", "id": "Q12142", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser19", "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 657, "end_pos": 657, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "SGD", "id": "S000002308", "url": "https://www.yeastgenome.org/locus/S000002308" }, { "database": "iPTMnet", "id": "Q12142", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser657", "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 802, "end_pos": 802, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "SGD", "id": "S000002308", "url": "https://www.yeastgenome.org/locus/S000002308" }, { "database": "iPTMnet", "id": "Q12142", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12142" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser802", "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 804, "end_pos": 804, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "SGD", "id": "S000002308", "url": "https://www.yeastgenome.org/locus/S000002308" }, { "database": "iPTMnet", "id": "Q12142", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Thr804", "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 831, "end_pos": 831, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "SGD", "id": "S000002308", "url": "https://www.yeastgenome.org/locus/S000002308" }, { "database": "iPTMnet", "id": "Q12142", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser831", "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 842, "end_pos": 842, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "SGD", "id": "S000002308", "url": "https://www.yeastgenome.org/locus/S000002308" }, { "database": "iPTMnet", "id": "Q12142", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser842", "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 948, "end_pos": 948, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "SGD", "id": "S000002308", "url": "https://www.yeastgenome.org/locus/S000002308" }, { "database": "iPTMnet", "id": "Q12142", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser948", "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 969, "end_pos": 969, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATG1", "evidence": [ { "database": "UniProtKB", "id": "Q12142", "url": "https://www.uniprot.org/uniprotkb/Q12142" }, { "database": "SGD", "id": "S000002308", "url": "https://www.yeastgenome.org/locus/S000002308" }, { "database": "iPTMnet", "id": "Q12142", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q12142" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser969", "uniprot_canonical_ac": "Q12142-1" }, { "start_pos": 982, "end_pos": 982, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003733", "url": "https://www.yeastgenome.org/locus/S000003733" }, { "database": "iPTMnet", "id": "P39538", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39538" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser982", "uniprot_canonical_ac": "P39538-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "P53104-1", "kinase_gene_name": "ATG1", "residue": "Ser", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "P53104", "url": "https://www.uniprot.org/uniprotkb/P53104" }, { "database": "iPTMnet", "id": "P53104", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53104" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser356", "uniprot_canonical_ac": "P53104-1" }, { "start_pos": 390, "end_pos": 390, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P53104", "url": "https://www.uniprot.org/uniprotkb/P53104" }, { "database": "iPTMnet", "id": "P53104", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53104" }, { "database": "PubMed", "id": "20489023", "url": "https://pubmed.ncbi.nlm.nih.gov/20489023" }, { "database": "PubMed", "id": "20953146", "url": "https://pubmed.ncbi.nlm.nih.gov/20953146" }, { "database": "PubMed", "id": "21460632", "url": "https://pubmed.ncbi.nlm.nih.gov/21460632" }, { "database": "SGD", "id": "S000003148", "url": "https://www.yeastgenome.org/locus/S000003148" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser390", "uniprot_canonical_ac": "P53104-1" }, { "start_pos": 517, "end_pos": 517, "kinase_uniprot_canonical_ac": "P53104-1", "kinase_gene_name": "ATG1", "residue": "Ser", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "P53104", "url": "https://www.uniprot.org/uniprotkb/P53104" }, { "database": "iPTMnet", "id": "P53104", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53104" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser517", "uniprot_canonical_ac": "P53104-1" }, { "start_pos": 517, "end_pos": 517, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P53104", "url": "https://www.uniprot.org/uniprotkb/P53104" }, { "database": "iPTMnet", "id": "P53104", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53104" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "20953146", "url": "https://pubmed.ncbi.nlm.nih.gov/20953146" }, { "database": "SGD", "id": "S000003148", "url": "https://www.yeastgenome.org/locus/S000003148" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser517", "uniprot_canonical_ac": "P53104-1" }, { "start_pos": 187, "end_pos": 187, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001194", "url": "https://www.yeastgenome.org/locus/S000001194" }, { "database": "iPTMnet", "id": "P38849", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38849" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser187", "uniprot_canonical_ac": "P38849-1" }, { "start_pos": 109, "end_pos": 109, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000001952", "url": "https://www.yeastgenome.org/locus/S000001952" }, { "database": "iPTMnet", "id": "P43623", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43623" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser109", "uniprot_canonical_ac": "P43623-1" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002648", "url": "https://www.yeastgenome.org/locus/S000002648" }, { "database": "iPTMnet", "id": "Q03782", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03782" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser160", "uniprot_canonical_ac": "Q03782-1" }, { "start_pos": 446, "end_pos": 446, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004263", "url": "https://www.yeastgenome.org/locus/S000004263" }, { "database": "iPTMnet", "id": "Q06216", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q06216" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser446", "uniprot_canonical_ac": "Q06216-1" }, { "start_pos": 499, "end_pos": 499, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000002243", "url": "https://www.yeastgenome.org/locus/S000002243" }, { "database": "iPTMnet", "id": "Q07500", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q07500" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser499", "uniprot_canonical_ac": "Q07500-1" }, { "start_pos": 144, "end_pos": 144, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006365", "url": "https://www.yeastgenome.org/locus/S000006365" }, { "database": "iPTMnet", "id": "P23293", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P23293" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser144", "uniprot_canonical_ac": "P23293-1" }, { "start_pos": 532, "end_pos": 532, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000004778", "url": "https://www.yeastgenome.org/locus/S000004778" }, { "database": "iPTMnet", "id": "P40969", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40969" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser532", "uniprot_canonical_ac": "P40969-1" }, { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000223", "url": "https://www.yeastgenome.org/locus/S000000223" }, { "database": "iPTMnet", "id": "P04397", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04397" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser47", "uniprot_canonical_ac": "P04397-1" }, { "start_pos": 85, "end_pos": 85, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000000274", "url": "https://www.yeastgenome.org/locus/S000000274" }, { "database": "iPTMnet", "id": "P38242", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38242" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser85", "uniprot_canonical_ac": "P38242-1" }, { "start_pos": 106, "end_pos": 106, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000003260", "url": "https://www.yeastgenome.org/locus/S000003260" }, { "database": "iPTMnet", "id": "P28737", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P28737" }, { "database": "PubMed", "id": "24440502", "url": "https://pubmed.ncbi.nlm.nih.gov/24440502" } ], "site_lbl": "Ser106", "uniprot_canonical_ac": "P28737-1" } ], "record_id": "pubmed.24440502", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 36 }, { "field": "total_sites", "count": 34 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Atg1 kinase organizes autophagosome formation by phosphorylating Atg9.", "journal": "Autophagy", "date": "2014-07", "authors": "Papinski Daniel, Kraft Claudine", "reference": { "type": "PubMed", "id": "24905091", "url": "https://pubmed.ncbi.nlm.nih.gov/24905091" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12142-1", "protein_name": "Autophagy-related protein 9", "gene_name": "ATG9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53104-1", "protein_name": "Serine/threonine-protein kinase ATG1", "gene_name": "ATG1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.24905091", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The crystal structure of Atg18 reveals a new binding site for Atg2 in Saccharomyces cerevisiae.", "journal": "Cell. Mol. Life Sci.", "date": "2021", "authors": "Lei Yuqing, Tang Dan, Liao Ga, Xu Liangting, Liu Shiyan, Chen Qianqian, Li Chunxia, Duan Jinsong, Wang Kunjie, Wang Jiawei, Sun Bo, Li Zhonghan, Dai Lunzhi, Cheng Wei, Qi Shiqian, Lu Kefeng", "reference": { "type": "PubMed", "id": "32809042", "url": "https://pubmed.ncbi.nlm.nih.gov/32809042" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43601-1", "protein_name": "Autophagy-related protein 18", "gene_name": "ATG18", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53855-1", "protein_name": "Autophagy-related protein 2", "gene_name": "ATG2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43601", "url": "https://www.uniprot.org/uniprotkb/P43601" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.32809042", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PY motifs of Rod1 are required for binding to Rsp5 and for drug resistance.", "journal": "FEBS letters", "date": "2002-08-14", "authors": "Andoh Tomoko, Hirata Yuzoh, Kikuchi Akira", "reference": { "type": "PubMed", "id": "12163175", "url": "https://pubmed.ncbi.nlm.nih.gov/12163175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43602-1", "protein_name": "Protein ROG3", "gene_name": "ROG3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02805-1", "protein_name": "Protein ROD1", "gene_name": "ROD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39940-1", "protein_name": "E3 ubiquitin-protein ligase RSP5", "gene_name": "RSP5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43602", "url": "https://www.uniprot.org/uniprotkb/P43602" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 460, "end_pos": 461, "sequence_org": "PP", "sequence_mut": "QA", "comment": "Reduced binding to RSP5.", "evidence": [ { "database": "UniProtKB", "id": "P43602", "url": "https://www.uniprot.org/uniprotkb/P43602" }, { "database": "PubMed", "id": "12163175", "url": "https://pubmed.ncbi.nlm.nih.gov/12163175" } ], "uniprot_canonical_ac": "P43602-1" }, { "start_pos": 625, "end_pos": 626, "sequence_org": "PP", "sequence_mut": "QA", "comment": "Reduced binding to RSP5.", "evidence": [ { "database": "UniProtKB", "id": "P43602", "url": "https://www.uniprot.org/uniprotkb/P43602" }, { "database": "PubMed", "id": "12163175", "url": "https://pubmed.ncbi.nlm.nih.gov/12163175" } ], "uniprot_canonical_ac": "P43602-1" }, { "start_pos": 487, "end_pos": 488, "sequence_org": "PP", "sequence_mut": "QA", "comment": "Reduced binding to RSP5.", "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" }, { "database": "PubMed", "id": "12163175", "url": "https://pubmed.ncbi.nlm.nih.gov/12163175" } ], "uniprot_canonical_ac": "Q02805-1" }, { "start_pos": 656, "end_pos": 657, "sequence_org": "PP", "sequence_mut": "QA", "comment": "Reduced binding to RSP5.", "evidence": [ { "database": "UniProtKB", "id": "Q02805", "url": "https://www.uniprot.org/uniprotkb/Q02805" }, { "database": "PubMed", "id": "12163175", "url": "https://pubmed.ncbi.nlm.nih.gov/12163175" } ], "uniprot_canonical_ac": "Q02805-1" } ], "record_id": "pubmed.12163175", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The alternative pathway of glutathione degradation is mediated by a novel protein complex involving three new genes in Saccharomyces cerevisiae.", "journal": "Genetics", "date": "2007-03", "authors": "Ganguli Dwaipayan, Kumar Chitranshu, Bachhawat Anand Kumar", "reference": { "type": "PubMed", "id": "17179087", "url": "https://pubmed.ncbi.nlm.nih.gov/17179087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43616-1", "protein_name": "Cys-Gly metallodipeptidase DUG1", "gene_name": "DUG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38149-1", "protein_name": "Probable di- and tripeptidase DUG2", "gene_name": "DUG2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53871-1", "protein_name": "Probable glutamine amidotransferase DUG3", "gene_name": "DUG3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43616", "url": "https://www.uniprot.org/uniprotkb/P43616" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17179087", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dug1p Is a Cys-Gly peptidase of the gamma-glutamyl cycle of Saccharomyces cerevisiae and represents a novel family of Cys-Gly peptidases.", "journal": "The Journal of biological chemistry", "date": "2009-05-22", "authors": "Kaur Hardeep, Kumar Chitranshu, Junot Christophe, Toledano Michel B, Bachhawat Anand K", "reference": { "type": "PubMed", "id": "19346245", "url": "https://pubmed.ncbi.nlm.nih.gov/19346245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43616-1", "protein_name": "Cys-Gly metallodipeptidase DUG1", "gene_name": "DUG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q96KP4-1", "protein_name": "Cytosolic non-specific dipeptidase", "gene_name": "CNDP2", "tax_name": "Human" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43616", "url": "https://www.uniprot.org/uniprotkb/P43616" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.19346245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of a 36.2 kb DNA sequence including the right telomere of chromosome VI from Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1996", "authors": "Eki T, Naitou M, Hagiwara H, Ozawa M, Sasanuma S I, Sasanuma M, Tsuchiya Y, Shibata T, Hanaoka F, Murakami Y", "reference": { "type": "PubMed", "id": "8686379", "url": "https://pubmed.ncbi.nlm.nih.gov/8686379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43616-1", "protein_name": "Cys-Gly metallodipeptidase DUG1", "gene_name": "DUG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P30657-1", "protein_name": "Proteasome subunit beta type-7", "gene_name": "PRE4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32496-1", "protein_name": "26S proteasome regulatory subunit RPN12", "gene_name": "RPN12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43618-1", "protein_name": "Inner kinetochore subunit CNN1", "gene_name": "CNN1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43617-1", "protein_name": "Uncharacterized mitochondrial carrier YFR045W", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43622-1", "protein_name": "Uncharacterized protein YFR054C", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43625-1", "protein_name": "Uncharacterized protein YFR057W", "gene_name": "", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43613-1", "protein_name": "ER-localized J domain-containing protein 5", "gene_name": "ERJ5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43614-1", "protein_name": "Beta-1,6-glucan synthesis-associated protein KEG1", "gene_name": "KEG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43615-1", "protein_name": "Increased recombination centers protein 6", "gene_name": "IRC6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43619-1", "protein_name": "Nicotinate-nucleotide pyrophosphorylase [carboxylating]", "gene_name": "BNA6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43620-1", "protein_name": "Sporulation protein RMD8", "gene_name": "RMD8", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43621-1", "protein_name": "Coatomer subunit delta", "gene_name": "RET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43623-1", "protein_name": "Putative cystathionine beta-lyase", "gene_name": "IRC7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43612-1", "protein_name": "SIT4-associating protein SAP155", "gene_name": "SAP155", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P04806-1", "protein_name": "Hexokinase-1", "gene_name": "HXK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19955-1", "protein_name": "Alpha-ketoglutarate dehydrogenase subunit 4, mitochondrial", "gene_name": "YMR31", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43616", "url": "https://www.uniprot.org/uniprotkb/P43616" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8686379", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Linking genome and proteome by mass spectrometry: large-scale identification of yeast proteins from two dimensional gels.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Shevchenko A, Jensen O N, Podtelejnikov A V, Sagliocco F, Wilm M, Vorm O, Mortensen P, Shevchenko A, Boucherie H, Mann M", "reference": { "type": "PubMed", "id": "8962070", "url": "https://pubmed.ncbi.nlm.nih.gov/8962070" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43616-1", "protein_name": "Cys-Gly metallodipeptidase DUG1", "gene_name": "DUG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47169-1", "protein_name": "Sulfite reductase [NADPH] subunit beta", "gene_name": "MET5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38788-1", "protein_name": "Ribosome-associated complex subunit SSZ1", "gene_name": "SSZ1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53920-1", "protein_name": "Pro-apoptotic serine protease NMA111", "gene_name": "NMA111", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40495-1", "protein_name": "Homoisocitrate dehydrogenase, mitochondrial", "gene_name": "LYS12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P47120-1", "protein_name": "Deoxyhypusine hydroxylase", "gene_name": "LIA1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P06168-1", "protein_name": "Ketol-acid reductoisomerase, mitochondrial", "gene_name": "ILV5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43616", "url": "https://www.uniprot.org/uniprotkb/P43616" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8962070", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alk1 and Alk2 are two new cell cycle-regulated haspin-like proteins in budding yeast.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2006-07", "authors": "Nespoli Alessandro, Vercillo Raffaella, di Nola Lisa, Diani Laura, Giannattasio Michele, Plevani Paolo, Muzi-Falconi Marco", "reference": { "type": "PubMed", "id": "16855400", "url": "https://pubmed.ncbi.nlm.nih.gov/16855400" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43633-1", "protein_name": "Serine/threonine-protein kinase Haspin homolog ALK1", "gene_name": "ALK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32789-1", "protein_name": "Serine/threonine-protein kinase Haspin homolog ALK2", "gene_name": "ALK2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43633", "url": "https://www.uniprot.org/uniprotkb/P43633" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 606, "end_pos": 610, "sequence_org": "EHRNL", "sequence_mut": "AAAAA", "comment": "Strongly reduces kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P43633", "url": "https://www.uniprot.org/uniprotkb/P43633" }, { "database": "PubMed", "id": "16855400", "url": "https://pubmed.ncbi.nlm.nih.gov/16855400" } ], "uniprot_canonical_ac": "P43633-1" }, { "start_pos": 528, "end_pos": 532, "sequence_org": "EHRNL", "sequence_mut": "AAAAA", "comment": "Strongly reduces kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "P32789", "url": "https://www.uniprot.org/uniprotkb/P32789" }, { "database": "PubMed", "id": "16855400", "url": "https://pubmed.ncbi.nlm.nih.gov/16855400" } ], "uniprot_canonical_ac": "P32789-1" } ], "record_id": "pubmed.16855400", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional comparison of citrate synthase isoforms from S. cerevisiae.", "journal": "Archives of biochemistry and biophysics", "date": "2007-09-01", "authors": "Graybill Eric R, Rouhier Matthew F, Kirby Charles E, Hawes John W", "reference": { "type": "PubMed", "id": "17570335", "url": "https://pubmed.ncbi.nlm.nih.gov/17570335" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43635-1", "protein_name": "Citrate synthase 3, mitochondrial", "gene_name": "CIT3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P00890-1", "protein_name": "Citrate synthase, mitochondrial", "gene_name": "CIT1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43635", "url": "https://www.uniprot.org/uniprotkb/P43635" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.17570335", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The CIT3 gene of Saccharomyces cerevisiae encodes a second mitochondrial isoform of citrate synthase.", "journal": "Molecular microbiology", "date": "1997-04", "authors": "Jia Y K, B\u00e9cam A M, Herbert C J", "reference": { "type": "PubMed", "id": "9140965", "url": "https://pubmed.ncbi.nlm.nih.gov/9140965" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43635-1", "protein_name": "Citrate synthase 3, mitochondrial", "gene_name": "CIT3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43635", "url": "https://www.uniprot.org/uniprotkb/P43635" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9140965", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Topological restriction of SNARE-dependent membrane fusion.", "journal": "Nature", "date": "2000-09-14", "authors": "Parlati F, McNew J A, Fukuda R, Miller R, S\u00f6llner T H, Rothman J E", "reference": { "type": "PubMed", "id": "11001058", "url": "https://pubmed.ncbi.nlm.nih.gov/11001058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43682-1", "protein_name": "Protein transport protein SFT1", "gene_name": "SFT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22804-1", "protein_name": "Protein transport protein BET1", "gene_name": "BET1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25385-1", "protein_name": "Protein transport protein BOS1", "gene_name": "BOS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22214-1", "protein_name": "Protein transport protein SEC22", "gene_name": "SEC22", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43682", "url": "https://www.uniprot.org/uniprotkb/P43682" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11001058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retrograde transport of the mannosyltransferase Och1p to the early Golgi requires a component of the COG transport complex.", "journal": "The Journal of biological chemistry", "date": "2004-09-17", "authors": "Bruinsma Paul, Spelbrink Robert G, Nothwehr Steven F", "reference": { "type": "PubMed", "id": "15229219", "url": "https://pubmed.ncbi.nlm.nih.gov/15229219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43682-1", "protein_name": "Protein transport protein SFT1", "gene_name": "SFT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P31755-1", "protein_name": "Initiation-specific alpha-1,6-mannosyltransferase", "gene_name": "OCH1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43682", "url": "https://www.uniprot.org/uniprotkb/P43682" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15229219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A SNARE-like protein required for traffic through the Golgi complex.", "journal": "Nature", "date": "1995-06-29", "authors": "Banfield D K, Lewis M J, Pelham H R", "reference": { "type": "PubMed", "id": "7596416", "url": "https://pubmed.ncbi.nlm.nih.gov/7596416" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43682-1", "protein_name": "Protein transport protein SFT1", "gene_name": "SFT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38166-1", "protein_name": "Protein transport protein SFT2", "gene_name": "SFT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43682", "url": "https://www.uniprot.org/uniprotkb/P43682" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.7596416", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence of a 7.8 kb segment on the left arm of yeast chromosome XI reveals four open reading frames, including the CAP1 gene, an intron-containing gene and a gene encoding a homolog to the mammalian UOG-1 gene.", "journal": "Yeast", "date": "1993", "authors": "Boyer J, Pascolo S, Richard G F, Dujon B", "reference": { "type": "PubMed", "id": "8488728", "url": "https://pubmed.ncbi.nlm.nih.gov/8488728" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P43682-1", "protein_name": "Protein transport protein SFT1", "gene_name": "SFT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28496-1", "protein_name": "Ceramide synthase LAC1", "gene_name": "LAC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36105-1", "protein_name": "Large ribosomal subunit protein eL14A", "gene_name": "RPL14A", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P36106-1", "protein_name": "Transcription factor BYE1", "gene_name": "BYE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28495-1", "protein_name": "F-actin-capping protein subunit alpha", "gene_name": "CAP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P33201-1", "protein_name": "Ribosome assembly factor MRT4", "gene_name": "MRT4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P43682", "url": "https://www.uniprot.org/uniprotkb/P43682" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8488728", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ATP hydrolysis activity of the DEAD box protein Rok1p is required for in vivo ROK1 function.", "journal": "Nucleic acids research", "date": "1999-07-01", "authors": "Oh J Y, Kim J", "reference": { "type": "PubMed", "id": "10373593", "url": "https://pubmed.ncbi.nlm.nih.gov/10373593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 166, "end_pos": 166, "sequence_org": "G", "sequence_mut": "D", "comment": "No cell growth and 2-fold decrease in ATPase activity in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" }, { "database": "PubMed", "id": "10373593", "url": "https://pubmed.ncbi.nlm.nih.gov/10373593" } ], "uniprot_canonical_ac": "P45818-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "K", "sequence_mut": "G", "comment": "Slow cell growth.", "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" }, { "database": "PubMed", "id": "10373593", "url": "https://pubmed.ncbi.nlm.nih.gov/10373593" } ], "uniprot_canonical_ac": "P45818-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "K", "sequence_mut": "L", "comment": "No cell growth and drastic decrease in ATPase activity in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" }, { "database": "PubMed", "id": "10373593", "url": "https://pubmed.ncbi.nlm.nih.gov/10373593" } ], "uniprot_canonical_ac": "P45818-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "K", "sequence_mut": "R", "comment": "Slow cell growth.", "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" }, { "database": "PubMed", "id": "10373593", "url": "https://pubmed.ncbi.nlm.nih.gov/10373593" } ], "uniprot_canonical_ac": "P45818-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "K", "sequence_mut": "S", "comment": "Slow cell growth.", "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" }, { "database": "PubMed", "id": "10373593", "url": "https://pubmed.ncbi.nlm.nih.gov/10373593" } ], "uniprot_canonical_ac": "P45818-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "K", "sequence_mut": "W", "comment": "Slow cell growth.", "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" }, { "database": "PubMed", "id": "10373593", "url": "https://pubmed.ncbi.nlm.nih.gov/10373593" } ], "uniprot_canonical_ac": "P45818-1" }, { "start_pos": 280, "end_pos": 280, "sequence_org": "D", "sequence_mut": "A", "comment": "Slow cell growth.", "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" }, { "database": "PubMed", "id": "10373593", "url": "https://pubmed.ncbi.nlm.nih.gov/10373593" } ], "uniprot_canonical_ac": "P45818-1" }, { "start_pos": 280, "end_pos": 280, "sequence_org": "D", "sequence_mut": "V", "comment": "Slow cell growth.", "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" }, { "database": "PubMed", "id": "10373593", "url": "https://pubmed.ncbi.nlm.nih.gov/10373593" } ], "uniprot_canonical_ac": "P45818-1" } ], "record_id": "pubmed.10373593", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two-hybrid cloning and characterization of OSH3, a yeast oxysterol-binding protein homolog.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Park Young-Un, Hwang Oksun, Kim Jinmi", "reference": { "type": "PubMed", "id": "12054531", "url": "https://pubmed.ncbi.nlm.nih.gov/12054531" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.12054531", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The path from nucleolar 90S to cytoplasmic 40S pre-ribosomes.", "journal": "EMBO J.", "date": "2003", "authors": "Sch\u00e4fer Thorsten, Strauss Daniela, Petfalski Elisabeth, Tollervey David, Hurt Ed", "reference": { "type": "PubMed", "id": "12628929", "url": "https://pubmed.ncbi.nlm.nih.gov/12628929" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07381-1", "protein_name": "Ribosome biogenesis protein TSR1", "gene_name": "TSR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08444-1", "protein_name": "20S-pre-rRNA D-site endonuclease NOB1", "gene_name": "NOB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99216-1", "protein_name": "Pre-rRNA-processing protein PNO1", "gene_name": "PNO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12754-1", "protein_name": "Ribosomal RNA-processing protein 12", "gene_name": "RRP12", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P41819-1", "protein_name": "Dimethyladenosine transferase", "gene_name": "DIM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P29295-1", "protein_name": "Casein kinase I homolog HRR25", "gene_name": "HRR25", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38333-1", "protein_name": "Essential nuclear protein 1", "gene_name": "ENP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40160-1", "protein_name": "Serine/threonine-protein kinase RIO2", "gene_name": "RIO2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "mutagenesis": [ { "start_pos": 186, "end_pos": 186, "sequence_org": "I", "sequence_mut": "V", "comment": "In RIO2-1; nuclear export of ribosomal 40S subunits impaired; when associated with H-73, H-210, D-364, G-371 and G-417.", "evidence": [ { "database": "UniProtKB", "id": "P40160", "url": "https://www.uniprot.org/uniprotkb/P40160" }, { "database": "PubMed", "id": "12628929", "url": "https://pubmed.ncbi.nlm.nih.gov/12628929" } ], "uniprot_canonical_ac": "P40160-1" }, { "start_pos": 210, "end_pos": 210, "sequence_org": "Y", "sequence_mut": "H", "comment": "In RIO2-1; nuclear export of ribosomal 40S subunits impaired; when associated with H-73, V-186, D-364, G-371 and G-417.", "evidence": [ { "database": "UniProtKB", "id": "P40160", "url": "https://www.uniprot.org/uniprotkb/P40160" }, { "database": "PubMed", "id": "12628929", "url": "https://pubmed.ncbi.nlm.nih.gov/12628929" } ], "uniprot_canonical_ac": "P40160-1" }, { "start_pos": 364, "end_pos": 364, "sequence_org": "E", "sequence_mut": "D", "comment": "In RIO2-1; nuclear export of ribosomal 40S subunits impaired; when associated with H-73, V-186, H-210, G-371 and G-417.", "evidence": [ { "database": "UniProtKB", "id": "P40160", "url": "https://www.uniprot.org/uniprotkb/P40160" }, { "database": "PubMed", "id": "12628929", "url": "https://pubmed.ncbi.nlm.nih.gov/12628929" } ], "uniprot_canonical_ac": "P40160-1" }, { "start_pos": 371, "end_pos": 371, "sequence_org": "D", "sequence_mut": "G", "comment": "In RIO2-1; nuclear export of ribosomal 40S subunits impaired; when associated with H-73, V-186, H-210, D-364 and G-417.", "evidence": [ { "database": "UniProtKB", "id": "P40160", "url": "https://www.uniprot.org/uniprotkb/P40160" }, { "database": "PubMed", "id": "12628929", "url": "https://pubmed.ncbi.nlm.nih.gov/12628929" } ], "uniprot_canonical_ac": "P40160-1" }, { "start_pos": 417, "end_pos": 417, "sequence_org": "D", "sequence_mut": "G", "comment": "In RIO2-1; nuclear export of ribosomal 40S subunits impaired; when associated with H-73, V-186, H-210, D-364 and G-371.", "evidence": [ { "database": "UniProtKB", "id": "P40160", "url": "https://www.uniprot.org/uniprotkb/P40160" }, { "database": "PubMed", "id": "12628929", "url": "https://pubmed.ncbi.nlm.nih.gov/12628929" } ], "uniprot_canonical_ac": "P40160-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "Y", "sequence_mut": "H", "comment": "In RIO2-1; nuclear export of ribosomal 40S subunits impaired; when associated with V-186, H-210, D-364, G-371 and G-417.", "evidence": [ { "database": "UniProtKB", "id": "P40160", "url": "https://www.uniprot.org/uniprotkb/P40160" }, { "database": "PubMed", "id": "12628929", "url": "https://pubmed.ncbi.nlm.nih.gov/12628929" } ], "uniprot_canonical_ac": "P40160-1" } ], "record_id": "pubmed.12628929", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deletion of OSH3 gene confers resistance against ISP-1 in Saccharomyces cerevisiae.", "journal": "Biochemical and biophysical research communications", "date": "2004-02-27", "authors": "Yano Tatsuya, Inukai Masatoshi, Isono Fujio", "reference": { "type": "PubMed", "id": "15013450", "url": "https://pubmed.ncbi.nlm.nih.gov/15013450" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22147-1", "protein_name": "5'-3' exoribonuclease 1", "gene_name": "XRN1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15013450", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Posttranscriptional regulation of the karyogamy gene by Kem1p/Xrn1p exoribonuclease and Rok1p RNA helicase of Saccharomyces cerevisiae.", "journal": "Biochemical and biophysical research communications", "date": "2004-09-03", "authors": "Kim Jaehee, Jeon Soonmee, Yang Yun-Seok, Kim Jinmi", "reference": { "type": "PubMed", "id": "15358132", "url": "https://pubmed.ncbi.nlm.nih.gov/15358132" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22147-1", "protein_name": "5'-3' exoribonuclease 1", "gene_name": "XRN1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15358132", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "U3 snoRNP and Rrp5p associate independently with Saccharomyces cerevisiae 35S pre-rRNA, but Rrp5p is essential for association of Rok1p.", "journal": "Nucleic Acids Res.", "date": "2004", "authors": "Vos Harmjan R, Bax Ralph, Faber Alex W, Vos Jan C, Rau\u00e9 Hendrik A", "reference": { "type": "PubMed", "id": "15523097", "url": "https://pubmed.ncbi.nlm.nih.gov/15523097" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15523097", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ROK1, a high-copy-number plasmid suppressor of kem1, encodes a putative ATP-dependent RNA helicase in Saccharomyces cerevisiae.", "journal": "Gene", "date": "1995", "authors": "Song Y, Kim S, Kim J", "reference": { "type": "PubMed", "id": "8529880", "url": "https://pubmed.ncbi.nlm.nih.gov/8529880" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8529880", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A putative helicase, the SUA5, PMR1, tRNALys1 genes and four open reading frames have been detected in the DNA sequence of an 8.8 kb fragment of the left arm of chromosome VII of Saccharomyces cerevisiae.", "journal": "Yeast", "date": "1996", "authors": "Klima R, Coglievina M, Zaccaria P, Bertani I, Bruschi C V", "reference": { "type": "PubMed", "id": "8896267", "url": "https://pubmed.ncbi.nlm.nih.gov/8896267" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32579-1", "protein_name": "Threonylcarbamoyl-AMP synthase", "gene_name": "SUA5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P45820-1", "protein_name": "Putative uncharacterized protein HUR1", "gene_name": "HUR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P45819-1", "protein_name": "Sporulation-specific protein 74", "gene_name": "SPO74", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P13586-1", "protein_name": "Calcium-transporting ATPase 1", "gene_name": "PMR1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.8896267", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rok1p is a putative RNA helicase required for rRNA processing.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Venema J, Bousquet-Antonelli C, Gelugne JP, Caizergues-Ferrer M, Tollervey D", "reference": { "type": "PubMed", "id": "9154839", "url": "https://pubmed.ncbi.nlm.nih.gov/9154839" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9154839", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two mutant forms of the S1/TPR-containing protein Rrp5p affect the 18S rRNA synthesis in Saccharomyces cerevisiae.", "journal": "RNA (New York, N.Y.)", "date": "1998-12", "authors": "Torchet C, Jacq C, Hermann-Le Denmat S", "reference": { "type": "PubMed", "id": "9848659", "url": "https://pubmed.ncbi.nlm.nih.gov/9848659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45818-1", "protein_name": "ATP-dependent RNA helicase ROK1", "gene_name": "ROK1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45818", "url": "https://www.uniprot.org/uniprotkb/P45818" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.9848659", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Scd6 targets eIF4G to repress translation: RGG motif proteins as a class of eIF4G-binding proteins.", "journal": "Molecular cell", "date": "2012-01-27", "authors": "Rajyaguru Purusharth, She Meipei, Parker Roy", "reference": { "type": "PubMed", "id": "22284680", "url": "https://pubmed.ncbi.nlm.nih.gov/22284680" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45978-1", "protein_name": "Protein SCD6", "gene_name": "SCD6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45978", "url": "https://www.uniprot.org/uniprotkb/P45978" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.22284680", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arginine methylation promotes translation repression activity of eIF4G-binding protein, Scd6.", "journal": "Nucleic acids research", "date": "2016", "authors": "Poornima G, Shah S, Vignesh V, Parker R, Rajyaguru PI", "reference": { "type": "PubMed", "id": "27613419", "url": "https://pubmed.ncbi.nlm.nih.gov/27613419" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45978-1", "protein_name": "Protein SCD6", "gene_name": "SCD6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45978", "url": "https://www.uniprot.org/uniprotkb/P45978" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.27613419", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the TORC1 interactome reveals a spatially distinct function of TORC1 in mRNP complexes.", "journal": "The Journal of cell biology", "date": "2021-04-05", "authors": "Chang Yeonji, Lim Gyubum, Huh Won-Ki", "reference": { "type": "PubMed", "id": "33566094", "url": "https://pubmed.ncbi.nlm.nih.gov/33566094" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45978-1", "protein_name": "Protein SCD6", "gene_name": "SCD6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45978", "url": "https://www.uniprot.org/uniprotkb/P45978" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 256, "end_pos": 256, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006333", "url": "https://www.yeastgenome.org/locus/S000006333" }, { "database": "iPTMnet", "id": "P45978", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P45978" }, { "database": "PubMed", "id": "33566094", "url": "https://pubmed.ncbi.nlm.nih.gov/33566094" } ], "site_lbl": "Ser256", "uniprot_canonical_ac": "P45978-1" }, { "start_pos": 280, "end_pos": 280, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006333", "url": "https://www.yeastgenome.org/locus/S000006333" }, { "database": "iPTMnet", "id": "P45978", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P45978" }, { "database": "PubMed", "id": "33566094", "url": "https://pubmed.ncbi.nlm.nih.gov/33566094" } ], "site_lbl": "Ser280", "uniprot_canonical_ac": "P45978-1" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "SGD", "id": "S000006333", "url": "https://www.yeastgenome.org/locus/S000006333" }, { "database": "iPTMnet", "id": "P45978", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P45978" }, { "database": "PubMed", "id": "33566094", "url": "https://pubmed.ncbi.nlm.nih.gov/33566094" } ], "site_lbl": "Ser287", "uniprot_canonical_ac": "P45978-1" } ], "record_id": "pubmed.33566094", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discovery of Arginine Methylation, Phosphorylation, and Their Co-occurrence in Condensate-Associated Proteins in Saccharomyces cerevisiae.", "journal": "Journal of proteome research", "date": "2021-05-07", "authors": "Hamey Joshua J, Nguyen Amy, Wilkins Marc R", "reference": { "type": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P45978-1", "protein_name": "Protein SCD6", "gene_name": "SCD6", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28007-1", "protein_name": "H/ACA ribonucleoprotein complex subunit GAR1", "gene_name": "GAR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32505-1", "protein_name": "Nuclear polyadenylated RNA-binding protein NAB2", "gene_name": "NAB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32588-1", "protein_name": "Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1", "gene_name": "PUB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q05775-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit J", "gene_name": "HCR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38922-1", "protein_name": "Serine/arginine (SR)-type shuttling mRNA binding protein HRB1", "gene_name": "HRB1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P50109-1", "protein_name": "Protein PSP2", "gene_name": "PSP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q02796-1", "protein_name": "Transcriptional regulatory protein LGE1", "gene_name": "LGE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P24783-1", "protein_name": "ATP-dependent RNA helicase DBP2", "gene_name": "DBP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P25555-1", "protein_name": "Serine/arginine (SR)-type shuttling mRNA binding protein GBP2", "gene_name": "GBP2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P27476-1", "protein_name": "Nuclear localization sequence-binding protein", "gene_name": "NSR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40070-1", "protein_name": "LSM complex subunit LSM4", "gene_name": "LSM4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q99383-1", "protein_name": "Nuclear polyadenylated RNA-binding protein 4", "gene_name": "HRP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P06634-1", "protein_name": "ATP-dependent RNA helicase DED1", "gene_name": "DED1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P10080-1", "protein_name": "Single-stranded nucleic acid-binding protein", "gene_name": "SBP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P39935-1", "protein_name": "Eukaryotic initiation factor 4F subunit p150", "gene_name": "TIF4631", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q01560-1", "protein_name": "Serine/arginine (SR)-type shuttling mRNA binding protein NPL3", "gene_name": "NPL3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P15646-1", "protein_name": "rRNA 2'-O-methyltransferase fibrillarin", "gene_name": "NOP1", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P45978", "url": "https://www.uniprot.org/uniprotkb/P45978" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "phosphorylation": [ { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P45978", "url": "https://www.uniprot.org/uniprotkb/P45978" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000006333", "url": "https://www.yeastgenome.org/locus/S000006333" }, { "database": "iPTMnet", "id": "P45978", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P45978" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr139", "uniprot_canonical_ac": "P45978-1" }, { "start_pos": 254, "end_pos": 254, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P32505", "url": "https://www.uniprot.org/uniprotkb/P32505" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000003090", "url": "https://www.yeastgenome.org/locus/S000003090" }, { "database": "iPTMnet", "id": "P32505", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P32505" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr254", "uniprot_canonical_ac": "P32505-1" }, { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q05775", "url": "https://www.uniprot.org/uniprotkb/Q05775" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "Q05775", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05775" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000004182", "url": "https://www.yeastgenome.org/locus/S000004182" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser65", "uniprot_canonical_ac": "Q05775-1" }, { "start_pos": 75, "end_pos": 75, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q05775", "url": "https://www.uniprot.org/uniprotkb/Q05775" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q05775", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q05775" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004182", "url": "https://www.yeastgenome.org/locus/S000004182" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr75", "uniprot_canonical_ac": "Q05775-1" }, { "start_pos": 338, "end_pos": 338, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38922", "url": "https://www.uniprot.org/uniprotkb/P38922" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P38922", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38922" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004949", "url": "https://www.yeastgenome.org/locus/S000004949" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser338", "uniprot_canonical_ac": "P38922-1" }, { "start_pos": 343, "end_pos": 343, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38922", "url": "https://www.uniprot.org/uniprotkb/P38922" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "P38922", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38922" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000004949", "url": "https://www.yeastgenome.org/locus/S000004949" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser343", "uniprot_canonical_ac": "P38922-1" }, { "start_pos": 355, "end_pos": 355, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P38922", "url": "https://www.uniprot.org/uniprotkb/P38922" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "SGD", "id": "S000004949", "url": "https://www.yeastgenome.org/locus/S000004949" }, { "database": "iPTMnet", "id": "P38922", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P38922" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser355", "uniprot_canonical_ac": "P38922-1" }, { "start_pos": 150, "end_pos": 150, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P50109", "url": "https://www.uniprot.org/uniprotkb/P50109" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000004479", "url": "https://www.yeastgenome.org/locus/S000004479" }, { "database": "iPTMnet", "id": "P50109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P50109" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser150", "uniprot_canonical_ac": "P50109-1" }, { "start_pos": 238, "end_pos": 238, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P50109", "url": "https://www.uniprot.org/uniprotkb/P50109" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "iPTMnet", "id": "P50109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P50109" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004479", "url": "https://www.yeastgenome.org/locus/S000004479" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser238", "uniprot_canonical_ac": "P50109-1" }, { "start_pos": 340, "end_pos": 340, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P50109", "url": "https://www.uniprot.org/uniprotkb/P50109" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "iPTMnet", "id": "P50109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P50109" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000004479", "url": "https://www.yeastgenome.org/locus/S000004479" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "31208443", "url": "https://pubmed.ncbi.nlm.nih.gov/31208443" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" }, { "database": "PubMed", "id": "34965436", "url": "https://pubmed.ncbi.nlm.nih.gov/34965436" } ], "site_lbl": "Ser340", "uniprot_canonical_ac": "P50109-1" }, { "start_pos": 522, "end_pos": 522, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P50109", "url": "https://www.uniprot.org/uniprotkb/P50109" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P50109", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P50109" } ], "site_lbl": "Ser522", "uniprot_canonical_ac": "P50109-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P25555", "url": "https://www.uniprot.org/uniprotkb/P25555" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P25555", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25555" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "SGD", "id": "S000000517", "url": "https://www.yeastgenome.org/locus/S000000517" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P25555-1" }, { "start_pos": 116, "end_pos": 116, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27476", "url": "https://www.uniprot.org/uniprotkb/P27476" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P27476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27476" } ], "site_lbl": "Ser116", "uniprot_canonical_ac": "P27476-1" }, { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27476", "url": "https://www.uniprot.org/uniprotkb/P27476" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000003391", "url": "https://www.yeastgenome.org/locus/S000003391" }, { "database": "iPTMnet", "id": "P27476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27476" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser127", "uniprot_canonical_ac": "P27476-1" }, { "start_pos": 129, "end_pos": 129, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27476", "url": "https://www.uniprot.org/uniprotkb/P27476" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000003391", "url": "https://www.yeastgenome.org/locus/S000003391" }, { "database": "iPTMnet", "id": "P27476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27476" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser129", "uniprot_canonical_ac": "P27476-1" }, { "start_pos": 131, "end_pos": 131, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27476", "url": "https://www.uniprot.org/uniprotkb/P27476" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000003391", "url": "https://www.yeastgenome.org/locus/S000003391" }, { "database": "iPTMnet", "id": "P27476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27476" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" } ], "site_lbl": "Ser131", "uniprot_canonical_ac": "P27476-1" }, { "start_pos": 143, "end_pos": 143, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27476", "url": "https://www.uniprot.org/uniprotkb/P27476" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000003391", "url": "https://www.yeastgenome.org/locus/S000003391" }, { "database": "iPTMnet", "id": "P27476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27476" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser143", "uniprot_canonical_ac": "P27476-1" }, { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27476", "url": "https://www.uniprot.org/uniprotkb/P27476" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P27476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27476" } ], "site_lbl": "Ser93", "uniprot_canonical_ac": "P27476-1" }, { "start_pos": 95, "end_pos": 95, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27476", "url": "https://www.uniprot.org/uniprotkb/P27476" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P27476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27476" } ], "site_lbl": "Ser95", "uniprot_canonical_ac": "P27476-1" }, { "start_pos": 96, "end_pos": 96, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27476", "url": "https://www.uniprot.org/uniprotkb/P27476" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P27476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27476" } ], "site_lbl": "Ser96", "uniprot_canonical_ac": "P27476-1" }, { "start_pos": 97, "end_pos": 97, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P27476", "url": "https://www.uniprot.org/uniprotkb/P27476" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P27476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27476" } ], "site_lbl": "Ser97", "uniprot_canonical_ac": "P27476-1" }, { "start_pos": 181, "end_pos": 181, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P40070", "url": "https://www.uniprot.org/uniprotkb/P40070" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000000914", "url": "https://www.yeastgenome.org/locus/S000000914" }, { "database": "iPTMnet", "id": "P40070", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40070" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser181", "uniprot_canonical_ac": "P40070-1" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q99383", "url": "https://www.uniprot.org/uniprotkb/Q99383" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q99383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99383" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000005483", "url": "https://www.yeastgenome.org/locus/S000005483" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "Q99383-1" }, { "start_pos": 3, "end_pos": 3, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q99383", "url": "https://www.uniprot.org/uniprotkb/Q99383" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q99383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99383" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000005483", "url": "https://www.yeastgenome.org/locus/S000005483" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser3", "uniprot_canonical_ac": "Q99383-1" }, { "start_pos": 460, "end_pos": 460, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q99383", "url": "https://www.uniprot.org/uniprotkb/Q99383" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000005483", "url": "https://www.yeastgenome.org/locus/S000005483" }, { "database": "iPTMnet", "id": "Q99383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99383" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" } ], "site_lbl": "Ser460", "uniprot_canonical_ac": "Q99383-1" }, { "start_pos": 462, "end_pos": 462, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q99383", "url": "https://www.uniprot.org/uniprotkb/Q99383" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "Q99383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99383" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000005483", "url": "https://www.yeastgenome.org/locus/S000005483" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser462", "uniprot_canonical_ac": "Q99383-1" }, { "start_pos": 51, "end_pos": 51, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q99383", "url": "https://www.uniprot.org/uniprotkb/Q99383" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "Q99383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99383" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000005483", "url": "https://www.yeastgenome.org/locus/S000005483" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser51", "uniprot_canonical_ac": "Q99383-1" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q99383", "url": "https://www.uniprot.org/uniprotkb/Q99383" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "Q99383", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q99383" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000005483", "url": "https://www.yeastgenome.org/locus/S000005483" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser87", "uniprot_canonical_ac": "Q99383-1" }, { "start_pos": 539, "end_pos": 539, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06634", "url": "https://www.uniprot.org/uniprotkb/P06634" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P06634", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06634" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "PubMed", "id": "31141444", "url": "https://pubmed.ncbi.nlm.nih.gov/31141444" }, { "database": "SGD", "id": "S000005730", "url": "https://www.yeastgenome.org/locus/S000005730" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser539", "uniprot_canonical_ac": "P06634-1" }, { "start_pos": 543, "end_pos": 543, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06634", "url": "https://www.uniprot.org/uniprotkb/P06634" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P06634", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06634" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "PubMed", "id": "31141444", "url": "https://pubmed.ncbi.nlm.nih.gov/31141444" }, { "database": "SGD", "id": "S000005730", "url": "https://www.yeastgenome.org/locus/S000005730" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "24909858", "url": "https://pubmed.ncbi.nlm.nih.gov/24909858" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser543", "uniprot_canonical_ac": "P06634-1" }, { "start_pos": 16, "end_pos": 16, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10080", "url": "https://www.uniprot.org/uniprotkb/P10080" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000001026", "url": "https://www.yeastgenome.org/locus/S000001026" }, { "database": "iPTMnet", "id": "P10080", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10080" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser16", "uniprot_canonical_ac": "P10080-1" }, { "start_pos": 287, "end_pos": 287, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P10080", "url": "https://www.uniprot.org/uniprotkb/P10080" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000001026", "url": "https://www.yeastgenome.org/locus/S000001026" }, { "database": "iPTMnet", "id": "P10080", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10080" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr287", "uniprot_canonical_ac": "P10080-1" }, { "start_pos": 289, "end_pos": 289, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10080", "url": "https://www.uniprot.org/uniprotkb/P10080" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000001026", "url": "https://www.yeastgenome.org/locus/S000001026" }, { "database": "iPTMnet", "id": "P10080", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10080" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser289", "uniprot_canonical_ac": "P10080-1" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10080", "url": "https://www.uniprot.org/uniprotkb/P10080" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P10080", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10080" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "SGD", "id": "S000001026", "url": "https://www.yeastgenome.org/locus/S000001026" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser2", "uniprot_canonical_ac": "P10080-1" }, { "start_pos": 49, "end_pos": 49, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P10080", "url": "https://www.uniprot.org/uniprotkb/P10080" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000001026", "url": "https://www.yeastgenome.org/locus/S000001026" }, { "database": "iPTMnet", "id": "P10080", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10080" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr49", "uniprot_canonical_ac": "P10080-1" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P10080", "url": "https://www.uniprot.org/uniprotkb/P10080" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000001026", "url": "https://www.yeastgenome.org/locus/S000001026" }, { "database": "iPTMnet", "id": "P10080", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10080" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser66", "uniprot_canonical_ac": "P10080-1" }, { "start_pos": 91, "end_pos": 91, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P10080", "url": "https://www.uniprot.org/uniprotkb/P10080" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P10080", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P10080" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000001026", "url": "https://www.yeastgenome.org/locus/S000001026" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Thr91", "uniprot_canonical_ac": "P10080-1" }, { "start_pos": 163, "end_pos": 163, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39935", "url": "https://www.uniprot.org/uniprotkb/P39935" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P39935", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39935" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "19795423", "url": "https://pubmed.ncbi.nlm.nih.gov/19795423" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "SGD", "id": "S000003394", "url": "https://www.yeastgenome.org/locus/S000003394" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "29438499", "url": "https://pubmed.ncbi.nlm.nih.gov/29438499" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser163", "uniprot_canonical_ac": "P39935-1" }, { "start_pos": 195, "end_pos": 195, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39935", "url": "https://www.uniprot.org/uniprotkb/P39935" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P39935", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39935" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "SGD", "id": "S000003394", "url": "https://www.yeastgenome.org/locus/S000003394" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "29438499", "url": "https://pubmed.ncbi.nlm.nih.gov/29438499" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser195", "uniprot_canonical_ac": "P39935-1" }, { "start_pos": 503, "end_pos": 503, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39935", "url": "https://www.uniprot.org/uniprotkb/P39935" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P39935", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39935" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000003394", "url": "https://www.yeastgenome.org/locus/S000003394" }, { "database": "PubMed", "id": "29438499", "url": "https://pubmed.ncbi.nlm.nih.gov/29438499" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser503", "uniprot_canonical_ac": "P39935-1" }, { "start_pos": 892, "end_pos": 892, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39935", "url": "https://www.uniprot.org/uniprotkb/P39935" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P39935", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39935" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000003394", "url": "https://www.yeastgenome.org/locus/S000003394" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "29438499", "url": "https://pubmed.ncbi.nlm.nih.gov/29438499" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser892", "uniprot_canonical_ac": "P39935-1" }, { "start_pos": 896, "end_pos": 896, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39935", "url": "https://www.uniprot.org/uniprotkb/P39935" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P39935", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39935" }, { "database": "PubMed", "id": "17287358", "url": "https://pubmed.ncbi.nlm.nih.gov/17287358" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "SGD", "id": "S000003394", "url": "https://www.yeastgenome.org/locus/S000003394" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "29438499", "url": "https://pubmed.ncbi.nlm.nih.gov/29438499" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser896", "uniprot_canonical_ac": "P39935-1" }, { "start_pos": 908, "end_pos": 908, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39935", "url": "https://www.uniprot.org/uniprotkb/P39935" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "P39935", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39935" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "SGD", "id": "S000003394", "url": "https://www.yeastgenome.org/locus/S000003394" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "29438499", "url": "https://pubmed.ncbi.nlm.nih.gov/29438499" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser908", "uniprot_canonical_ac": "P39935-1" }, { "start_pos": 948, "end_pos": 948, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P39935", "url": "https://www.uniprot.org/uniprotkb/P39935" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "P39935", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P39935" }, { "database": "PubMed", "id": "19684113", "url": "https://pubmed.ncbi.nlm.nih.gov/19684113" }, { "database": "PubMed", "id": "19823750", "url": "https://pubmed.ncbi.nlm.nih.gov/19823750" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "SGD", "id": "S000003394", "url": "https://www.yeastgenome.org/locus/S000003394" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "30516470", "url": "https://pubmed.ncbi.nlm.nih.gov/30516470" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser948", "uniprot_canonical_ac": "P39935-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q01560", "url": "https://www.uniprot.org/uniprotkb/Q01560" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "Q01560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01560" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "Q01560-1" }, { "start_pos": 212, "end_pos": 212, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q01560", "url": "https://www.uniprot.org/uniprotkb/Q01560" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000002840", "url": "https://www.yeastgenome.org/locus/S000002840" }, { "database": "iPTMnet", "id": "Q01560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01560" }, { "database": "PubMed", "id": "18818768", "url": "https://pubmed.ncbi.nlm.nih.gov/18818768" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser212", "uniprot_canonical_ac": "Q01560-1" }, { "start_pos": 224, "end_pos": 224, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q01560", "url": "https://www.uniprot.org/uniprotkb/Q01560" }, { "database": "PubMed", "id": "18407956", "url": "https://pubmed.ncbi.nlm.nih.gov/18407956" }, { "database": "PubMed", "id": "17330950", "url": "https://pubmed.ncbi.nlm.nih.gov/17330950" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "PubMed", "id": "19779198", "url": "https://pubmed.ncbi.nlm.nih.gov/19779198" }, { "database": "iPTMnet", "id": "Q01560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01560" }, { "database": "PubMed", "id": "15665377", "url": "https://pubmed.ncbi.nlm.nih.gov/15665377" }, { "database": "PubMed", "id": "17563356", "url": "https://pubmed.ncbi.nlm.nih.gov/17563356" }, { "database": "PubMed", "id": "20190278", "url": "https://pubmed.ncbi.nlm.nih.gov/20190278" }, { "database": "PubMed", "id": "20702584", "url": "https://pubmed.ncbi.nlm.nih.gov/20702584" }, { "database": "PubMed", "id": "21126336", "url": "https://pubmed.ncbi.nlm.nih.gov/21126336" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "PubMed", "id": "18818768", "url": "https://pubmed.ncbi.nlm.nih.gov/18818768" }, { "database": "SGD", "id": "S000002840", "url": "https://www.yeastgenome.org/locus/S000002840" }, { "database": "PubMed", "id": "22218487", "url": "https://pubmed.ncbi.nlm.nih.gov/22218487" }, { "database": "PubMed", "id": "23749301", "url": "https://pubmed.ncbi.nlm.nih.gov/23749301" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33481703", "url": "https://pubmed.ncbi.nlm.nih.gov/33481703" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser224", "uniprot_canonical_ac": "Q01560-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q01560", "url": "https://www.uniprot.org/uniprotkb/Q01560" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "iPTMnet", "id": "Q01560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01560" }, { "database": "PubMed", "id": "21177495", "url": "https://pubmed.ncbi.nlm.nih.gov/21177495" }, { "database": "PubMed", "id": "18818768", "url": "https://pubmed.ncbi.nlm.nih.gov/18818768" }, { "database": "SGD", "id": "S000002840", "url": "https://www.yeastgenome.org/locus/S000002840" }, { "database": "PubMed", "id": "32597660", "url": "https://pubmed.ncbi.nlm.nih.gov/32597660" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser356", "uniprot_canonical_ac": "Q01560-1" }, { "start_pos": 79, "end_pos": 79, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q01560", "url": "https://www.uniprot.org/uniprotkb/Q01560" }, { "database": "PubMed", "id": "33856219", "url": "https://pubmed.ncbi.nlm.nih.gov/33856219" }, { "database": "SGD", "id": "S000002840", "url": "https://www.yeastgenome.org/locus/S000002840" }, { "database": "iPTMnet", "id": "Q01560", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q01560" }, { "database": "PubMed", "id": "18818768", "url": "https://pubmed.ncbi.nlm.nih.gov/18818768" }, { "database": "PubMed", "id": "33491328", "url": "https://pubmed.ncbi.nlm.nih.gov/33491328" } ], "site_lbl": "Ser79", "uniprot_canonical_ac": "Q01560-1" } ], "record_id": "pubmed.33856219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 49 }, { "field": "total_sites", "count": 48 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex.", "journal": "Biochemistry", "date": "2001", "authors": "Grandier-Vazeille X, Bathany K, Chaignepain S, Camougrand N, Manon S, Schmitter J M", "reference": { "type": "PubMed", "id": "11502169", "url": "https://pubmed.ncbi.nlm.nih.gov/11502169" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46367-1", "protein_name": "Potassium-activated aldehyde dehydrogenase, mitochondrial", "gene_name": "ALD4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P48412-1", "protein_name": "Nonsense-mediated mRNA decay protein 3", "gene_name": "UPF3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P28241-1", "protein_name": "Isocitrate dehydrogenase [NAD] subunit 2, mitochondrial", "gene_name": "IDH2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32316-1", "protein_name": "Acetyl-CoA hydrolase", "gene_name": "ACH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32340-1", "protein_name": "Rotenone-insensitive NADH-ubiquinone oxidoreductase, mitochondrial", "gene_name": "NDI1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32891-1", "protein_name": "D-lactate dehydrogenase [cytochrome] 1, mitochondrial", "gene_name": "DLD1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38071-1", "protein_name": "Enoyl-[acyl-carrier-protein] reductase, mitochondrial", "gene_name": "ETR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q03104-1", "protein_name": "Meiotic sister chromatid recombination protein 1", "gene_name": "MSC1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38126-1", "protein_name": "Pachytene checkpoint protein 2", "gene_name": "PCH2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q00711-1", "protein_name": "Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial", "gene_name": "SDH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12211-1", "protein_name": "tRNA pseudouridine synthase 1", "gene_name": "PUS1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40215-1", "protein_name": "External NADH-ubiquinone oxidoreductase 1, mitochondrial", "gene_name": "NDE1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P16547-1", "protein_name": "Mitochondrial outer membrane protein OM45", "gene_name": "OM45", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P52893-1", "protein_name": "Alanine aminotransferase, mitochondrial", "gene_name": "ALT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q07500-1", "protein_name": "External NADH-ubiquinone oxidoreductase 2, mitochondrial", "gene_name": "NDE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q08822-1", "protein_name": "Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial", "gene_name": "CIR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q12008-1", "protein_name": "Phosphoglycerate mutase 2", "gene_name": "GPM2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P22134-1", "protein_name": "DNA-3-methyladenine glycosylase", "gene_name": "MAG1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P00175-1", "protein_name": "L-lactate dehydrogenase (cytochrome)", "gene_name": "CYB2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P00359-1", "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase 3", "gene_name": "TDH3", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P00360-1", "protein_name": "Glyceraldehyde-3-phosphate dehydrogenase 1", "gene_name": "TDH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P00560-1", "protein_name": "Phosphoglycerate kinase", "gene_name": "PGK1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P00890-1", "protein_name": "Citrate synthase, mitochondrial", "gene_name": "CIT1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P00924-1", "protein_name": "Enolase 1", "gene_name": "ENO1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07213-1", "protein_name": "Mitochondrial import receptor subunit TOM70", "gene_name": "TOM70", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07251-1", "protein_name": "ATP synthase subunit alpha, mitochondrial", "gene_name": "ATP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07256-1", "protein_name": "Cytochrome b-c1 complex subunit 1, mitochondrial", "gene_name": "COR1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07257-1", "protein_name": "Cytochrome b-c1 complex subunit 2, mitochondrial", "gene_name": "QCR2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P08417-1", "protein_name": "Fumarate hydratase, mitochondrial", "gene_name": "FUM1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P17505-1", "protein_name": "Malate dehydrogenase, mitochondrial", "gene_name": "MDH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P19882-1", "protein_name": "Heat shock protein 60, mitochondrial", "gene_name": "HSP60", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P07275-1", "protein_name": "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial", "gene_name": "PUT2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32191-1", "protein_name": "Glycerol-3-phosphate dehydrogenase, mitochondrial", "gene_name": "GUT2", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46367", "url": "https://www.uniprot.org/uniprotkb/P46367" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.11502169", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of the ALD gene family of Saccharomyces cerevisiae during anaerobic growth on glucose: the NADP+-dependent Ald6p and Ald5p isoforms play a major role in acetate formation.", "journal": "Microbiology (Reading, England)", "date": "2004-07", "authors": "Saint-Prix Florence, B\u00f6nquist Linda, Dequin Sylvie", "reference": { "type": "PubMed", "id": "15256563", "url": "https://pubmed.ncbi.nlm.nih.gov/15256563" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46367-1", "protein_name": "Potassium-activated aldehyde dehydrogenase, mitochondrial", "gene_name": "ALD4", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P40047-1", "protein_name": "Aldehyde dehydrogenase 5, mitochondrial", "gene_name": "ALD5", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Saccharomyces cerevisiae S288C", "taxid": 559292, "evidence": [ { "database": "UniProtKB", "id": "P46367", "url": "https://www.uniprot.org/uniprotkb/P46367" } ], "common_name": "Baker's yeast", "glygen_name": "Yeast", "reference_species": "Saccharomyces cerevisiae S288C [559292]" } ], "record_id": "pubmed.15256563", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]