[ { "title": "Molecular population genetics of inducible antibacterial peptide genes in Drosophila melanogaster.", "journal": "Molecular biology and evolution", "date": "2003", "authors": "Lazzaro BP, Clark AG", "reference": { "type": "PubMed", "id": "12716986", "url": "https://pubmed.ncbi.nlm.nih.gov/12716986" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P36193-1", "protein_name": "Drosocin antimicrobial peptides", "gene_name": "Dro", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24395-1", "protein_name": "Metchnikowin", "gene_name": "Mtk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P36192-1", "protein_name": "Defensin", "gene_name": "Def", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12716986", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila immunity: the Drosocin gene encodes two host defence peptides with pathogen-specific roles.", "journal": "Proceedings. Biological sciences", "date": "2022-06-29", "authors": "Hanson M A, Kondo S, Lemaitre B", "reference": { "type": "PubMed", "id": "35730150", "url": "https://pubmed.ncbi.nlm.nih.gov/35730150" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P36193-1", "protein_name": "Drosocin antimicrobial peptides", "gene_name": "Dro", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.35730150", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for translation inhibition by the glycosylated drosocin peptide.", "journal": "Nature chemical biology", "date": "2023-09", "authors": "Koller Timm O, Morici Martino, Berger Max, Safdari Haaris A, Lele Deepti S, Beckert Bertrand, Kaur Kanwal J, Wilson Daniel N", "reference": { "type": "PubMed", "id": "36997646", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P36193-1", "protein_name": "Drosocin antimicrobial peptides", "gene_name": "Dro", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8AKN&bu=0&command=select+.A:11;+center+selection;+zoom+selection" }, "start_pos": 32, "start_aa": "Thr", "end_pos": 32, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr32", "evidence": [ { "id": "P36193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P36193#ptm_processing" }, { "id": "36997646", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" }, { "id": "9736738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9736738" }, { "id": "8AM9", "database": "PDB", "url": "https://www.rcsb.org/sequence/8AM9" }, { "id": "8325867", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8325867" }, { "id": "8AKN", "database": "PDB", "url": "https://www.rcsb.org/sequence/8AKN" }, { "id": "8ANA", "database": "PDB", "url": "https://www.rcsb.org/sequence/8ANA" }, { "id": "9888811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9888811" } ], "filter_code": "000000000000000010000.00000010000000.00.01100", "uniprot_canonical_ac": "P36193-1" } ], "mutagenesis": [ { "start_pos": 28, "end_pos": 33, "sequence_org": "SPRPTS", "sequence_mut": "PPRPPP", "comment": "Significant loss of antimicrobial activity.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997646", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 36, "end_pos": 36, "sequence_org": "R", "sequence_mut": "A", "comment": "Significant loss of translation inhibition activity, possibly due to disruption of interaction with bacterial 23S rRNA.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997646", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 39, "end_pos": 39, "sequence_org": "R", "sequence_mut": "A", "comment": "Complete loss of ability to inhibit translation, possibly due to disruption of interactions with prfA/RF1.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997646", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 39, "end_pos": 39, "sequence_org": "R", "sequence_mut": "K", "comment": "No loss of translation inhibition activity.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997646", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" } ], "uniprot_canonical_ac": "P36193-1" } ], "record_id": "pubmed.36997646", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of translation termination by the antimicrobial peptide Drosocin.", "journal": "Nature chemical biology", "date": "2023-09", "authors": "Mangano Kyle, Klepacki Dorota, Ohanmu Irueosa, Baliga Chetana, Huang Weiping, Brakel Alexandra, Krizsan Andor, Polikanov Yury S, Hoffmann Ralf, V\u00e1zquez-Laslop Nora, Mankin Alexander S", "reference": { "type": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P36193-1", "protein_name": "Drosocin antimicrobial peptides", "gene_name": "Dro", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 22, "end_pos": 22, "sequence_org": "G", "sequence_mut": "A", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 22, "end_pos": 22, "sequence_org": "G", "sequence_mut": "K", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 22, "end_pos": 22, "sequence_org": "G", "sequence_mut": "T", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 24, "end_pos": 24, "sequence_org": "P", "sequence_mut": "K", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 26, "end_pos": 26, "sequence_org": "P", "sequence_mut": "D", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 26, "end_pos": 26, "sequence_org": "P", "sequence_mut": "N", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 27, "end_pos": 27, "sequence_org": "Y", "sequence_mut": "A", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 27, "end_pos": 27, "sequence_org": "Y", "sequence_mut": "P", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 27, "end_pos": 27, "sequence_org": "Y", "sequence_mut": "Q", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 27, "end_pos": 27, "sequence_org": "Y", "sequence_mut": "R", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 27, "end_pos": 27, "sequence_org": "Y", "sequence_mut": "S", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 28, "end_pos": 28, "sequence_org": "S", "sequence_mut": "T", "comment": "Enhanced translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 29, "end_pos": 29, "sequence_org": "P", "sequence_mut": "H", "comment": "No significant impact on translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 32, "end_pos": 32, "sequence_org": "T", "sequence_mut": "P", "comment": "Significantly enhanced translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 32, "end_pos": 32, "sequence_org": "T", "sequence_mut": "R", "comment": "Significantly enhanced translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 33, "end_pos": 33, "sequence_org": "S", "sequence_mut": "G", "comment": "Enhanced translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 33, "end_pos": 33, "sequence_org": "S", "sequence_mut": "P", "comment": "Enhanced translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 34, "end_pos": 34, "sequence_org": "H", "sequence_mut": "F", "comment": "Enhanced translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 35, "end_pos": 35, "sequence_org": "P", "sequence_mut": "M", "comment": "Significantly enhanced translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 36, "end_pos": 36, "sequence_org": "R", "sequence_mut": "A", "comment": "Significant loss of translation inhibition activity, possibly due to disruption of interaction with bacterial 23S rRNA.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997646", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 38, "end_pos": 38, "sequence_org": "I", "sequence_mut": "M", "comment": "Enhanced translation inhibition efficiency.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" }, { "start_pos": 39, "end_pos": 39, "sequence_org": "R", "sequence_mut": "A", "comment": "Complete loss of ability to inhibit translation, possibly due to disruption of interactions with prfA/RF1.", "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" }, { "database": "PubMed", "id": "36997646", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" }, { "database": "PubMed", "id": "36997647", "url": "https://pubmed.ncbi.nlm.nih.gov/36997647" } ], "uniprot_canonical_ac": "P36193-1" } ], "record_id": "pubmed.36997647", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel inducible antibacterial peptide of Drosophila carries an O-glycosylated substitution.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Bulet P, Dimarcq JL, Hetru C, Lagueux M, Charlet M, Hegy G, Van Dorsselaer A, Hoffmann JA", "reference": { "type": "PubMed", "id": "8325867", "url": "https://pubmed.ncbi.nlm.nih.gov/8325867" }, "referenced_glycans": [ { "glytoucan_ac": "G00031MO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P36193-1", "protein_name": "Drosocin antimicrobial peptides", "gene_name": "Dro", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8AKN&bu=0&command=select+.A:11;+center+selection;+zoom+selection" }, "start_pos": 32, "start_aa": "Thr", "end_pos": 32, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr32", "evidence": [ { "id": "P36193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P36193#ptm_processing" }, { "id": "36997646", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" }, { "id": "9736738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9736738" }, { "id": "8AM9", "database": "PDB", "url": "https://www.rcsb.org/sequence/8AM9" }, { "id": "8325867", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8325867" }, { "id": "8AKN", "database": "PDB", "url": "https://www.rcsb.org/sequence/8AKN" }, { "id": "8ANA", "database": "PDB", "url": "https://www.rcsb.org/sequence/8ANA" }, { "id": "9888811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9888811" } ], "filter_code": "000000000000000010000.00000010000000.00.01100", "uniprot_canonical_ac": "P36193-1" } ], "record_id": "pubmed.8325867", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of the gene encoding the antibacterial peptide drosocin involved in Drosophila immunity. Expression studies during the immune response.", "journal": "European journal of biochemistry", "date": "1996", "authors": "Charlet M, Lagueux M, Reichhart JM, Hoffmann D, Braun A, Meister M", "reference": { "type": "PubMed", "id": "8944755", "url": "https://pubmed.ncbi.nlm.nih.gov/8944755" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P36193-1", "protein_name": "Drosocin antimicrobial peptides", "gene_name": "Dro", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8944755", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential display of peptides induced during the immune response of Drosophila: a matrix-assisted laser desorption ionization time-of-flight mass spectrometry study.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Uttenweiler-Joseph S, Moniatte M, Lagueux M, Van Dorsselaer A, Hoffmann JA, Bulet P", "reference": { "type": "PubMed", "id": "9736738", "url": "https://pubmed.ncbi.nlm.nih.gov/9736738" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P36193-1", "protein_name": "Drosocin antimicrobial peptides", "gene_name": "Dro", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P41964-1", "protein_name": "Drosomycin", "gene_name": "Drs", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P82706-1", "protein_name": "Bomanin Short 1", "gene_name": "BomS1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24395-1", "protein_name": "Metchnikowin", "gene_name": "Mtk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q95NH6-1", "protein_name": "Attacin-C", "gene_name": "AttC", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O77150-1", "protein_name": "Bomanin Short 2", "gene_name": "BomS2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P82705-1", "protein_name": "Daisho1", "gene_name": "Dso1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P83869-1", "protein_name": "Daisho2", "gene_name": "Dso2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V8G0-1", "protein_name": "Bomanin Short 3", "gene_name": "BomS3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V8F5-1", "protein_name": "Bomanin Bicipital 1", "gene_name": "BomBc1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "C0HM00-1", "protein_name": "Baramicin A2", "gene_name": "BaraA2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "C0HLZ9-1", "protein_name": "Baramicin A1", "gene_name": "BaraA1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P82701-1", "protein_name": "Immune-induced peptide 18", "gene_name": "IM18; Pai", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 28, "start_aa": "Ser", "end_pos": 28, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser28", "evidence": [ { "id": "P36193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P36193#ptm_processing" }, { "id": "9736738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9736738" } ], "filter_code": "000000000000000100000.00000010000000.00.01100", "uniprot_canonical_ac": "P36193-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8AKN&bu=0&command=select+.A:11;+center+selection;+zoom+selection" }, "start_pos": 32, "start_aa": "Thr", "end_pos": 32, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr32", "evidence": [ { "id": "P36193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P36193#ptm_processing" }, { "id": "36997646", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" }, { "id": "9736738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9736738" }, { "id": "8AM9", "database": "PDB", "url": "https://www.rcsb.org/sequence/8AM9" }, { "id": "8325867", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8325867" }, { "id": "8AKN", "database": "PDB", "url": "https://www.rcsb.org/sequence/8AKN" }, { "id": "8ANA", "database": "PDB", "url": "https://www.rcsb.org/sequence/8ANA" }, { "id": "9888811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9888811" } ], "filter_code": "000000000000000010000.00000010000000.00.01100", "uniprot_canonical_ac": "P36193-1" } ], "record_id": "pubmed.9736738", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conformational studies by NMR of the antimicrobial peptide, drosocin, and its non-glycosylated derivative: effects of glycosylation on solution conformation.", "journal": "Biochemistry", "date": "1999", "authors": "McManus AM, Otvos L Jr, Hoffmann R, Craik DJ", "reference": { "type": "PubMed", "id": "9888811", "url": "https://pubmed.ncbi.nlm.nih.gov/9888811" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P36193-1", "protein_name": "Drosocin antimicrobial peptides", "gene_name": "Dro", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P36193", "url": "https://www.uniprot.org/uniprotkb/P36193" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8AKN&bu=0&command=select+.A:11;+center+selection;+zoom+selection" }, "start_pos": 32, "start_aa": "Thr", "end_pos": 32, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr32", "evidence": [ { "id": "P36193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P36193#ptm_processing" }, { "id": "36997646", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36997646" }, { "id": "9736738", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9736738" }, { "id": "8AM9", "database": "PDB", "url": "https://www.rcsb.org/sequence/8AM9" }, { "id": "8325867", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8325867" }, { "id": "8AKN", "database": "PDB", "url": "https://www.rcsb.org/sequence/8AKN" }, { "id": "8ANA", "database": "PDB", "url": "https://www.rcsb.org/sequence/8ANA" }, { "id": "9888811", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9888811" } ], "filter_code": "000000000000000010000.00000010000000.00.01100", "uniprot_canonical_ac": "P36193-1" } ], "record_id": "pubmed.9888811", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discs Lost, a novel multi-PDZ domain protein, establishes and maintains epithelial polarity.", "journal": "Cell", "date": "1999-03-19", "authors": "Bhat M A, Izaddoost S, Lu Y, Cho K O, Choi K W, Bellen H J", "reference": { "type": "PubMed", "id": "10102271", "url": "https://pubmed.ncbi.nlm.nih.gov/10102271" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NB04-1", "protein_name": "Patj homolog", "gene_name": "Patj", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94887-1", "protein_name": "Neurexin-4", "gene_name": "Nrx-IV", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10102271", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Apical, lateral, and basal polarization cues contribute to the development of the follicular epithelium during Drosophila oogenesis.", "journal": "The Journal of cell biology", "date": "2000-11-13", "authors": "Tanentzapf G, Smith C, McGlade J, Tepass U", "reference": { "type": "PubMed", "id": "11076972", "url": "https://pubmed.ncbi.nlm.nih.gov/11076972" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NB04-1", "protein_name": "Patj homolog", "gene_name": "Patj", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11076972", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila Stardust is a partner of Crumbs in the control of epithelial cell polarity.", "journal": "Nature", "date": "2001-12-06", "authors": "Bachmann A, Schneider M, Theilenberg E, Grawe F, Knust E", "reference": { "type": "PubMed", "id": "11740560", "url": "https://pubmed.ncbi.nlm.nih.gov/11740560" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NB04-1", "protein_name": "Patj homolog", "gene_name": "Patj", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11740560", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of Par-6 and Crumbs complexes is essential for photoreceptor morphogenesis in Drosophila.", "journal": "Development (Cambridge, England)", "date": "2003-09", "authors": "Nam Sang-Chul, Choi Kwang-Wook", "reference": { "type": "PubMed", "id": "12900452", "url": "https://pubmed.ncbi.nlm.nih.gov/12900452" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NB04-1", "protein_name": "Patj homolog", "gene_name": "Patj", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12900452", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of N-glycosylated proteins from the central nervous system of Drosophila melanogaster.", "journal": "Glycobiology", "date": "2007", "authors": "Koles K, Lim JM, Aoki K, Porterfield M, Tiemeyer M, Wells L, Panin V", "reference": { "type": "PubMed", "id": "17893096", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P10379-1", "protein_name": "Protein unzipped", "gene_name": "uzip", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P40689-1", "protein_name": "Torso-like protein", "gene_name": "tsl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P20241-1", "protein_name": "Neuroglian", "gene_name": "Nrg", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P34082-1", "protein_name": "Fasciclin-2", "gene_name": "Fas2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P06002-1", "protein_name": "Opsin Rh1", "gene_name": "ninaE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P42787-1", "protein_name": "Carboxypeptidase D", "gene_name": "svr", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q868Z9-1", "protein_name": "Papilin", "gene_name": "Ppn", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q95T64-1", "protein_name": "Peptidoglycan-recognition protein LA", "gene_name": "PGRP-LA", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NFP1-1", "protein_name": "Vanin-like protein 1", "gene_name": "vanin-like", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCR7-1", "protein_name": "Cystinosin", "gene_name": "Ctns", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VEX0-1", "protein_name": "Extracellular sulfatase SULF-1 homolog", "gene_name": "Sulf1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VW12-1", "protein_name": "UPF0389 protein CG9231", "gene_name": "Dmel\\CG9231", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VZZ4-1", "protein_name": "Peroxidasin", "gene_name": "Pxn", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P10674-1", "protein_name": "Fasciclin-1", "gene_name": "Fas1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P12024-1", "protein_name": "Chaoptin", "gene_name": "chp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08510-1", "protein_name": "Potassium voltage-gated channel protein Shaker", "gene_name": "Sh", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A0A1F4-1", "protein_name": "Protein eyes shut", "gene_name": "eys", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08171-1", "protein_name": "Esterase-6", "gene_name": "Est-6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P11046-1", "protein_name": "Laminin subunit beta-1", "gene_name": "LanB1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O97394-1", "protein_name": "Protein sidekick", "gene_name": "sdk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O61307-1", "protein_name": "Teneurin-m", "gene_name": "Ten-m", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O44386-1", "protein_name": "Integrin alpha-PS3", "gene_name": "scb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P11147-1", "protein_name": "Heat shock 70 kDa protein cognate 4", "gene_name": "Hsc70-4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P11584-1", "protein_name": "Integrin beta-PS", "gene_name": "mys", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q00748-1", "protein_name": "Multidrug resistance protein homolog 65", "gene_name": "Mdr65", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8MM24-1", "protein_name": "Chitinase-like protein Idgf1", "gene_name": "Idgf1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8MVS5-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 35A", "gene_name": "Pgant35A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24048-1", "protein_name": "Sodium/potassium-transporting ATPase subunit beta-2", "gene_name": "nrv2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P91685-1", "protein_name": "Metabotropic glutamate receptor", "gene_name": "mGluR", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24046-1", "protein_name": "Sodium/potassium-transporting ATPase subunit beta-1", "gene_name": "nrv1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24247-1", "protein_name": "Integrin alpha-PS1", "gene_name": "mew", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q27367-1", "protein_name": "Protein croquemort", "gene_name": "crq", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VR07-1", "protein_name": "Sodium- and chloride-dependent GABA transporter ine", "gene_name": "ine", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V496-1", "protein_name": "Apolipophorins", "gene_name": "apolpp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V498-1", "protein_name": "Calsyntenin-1", "gene_name": "Cals", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VN14-1", "protein_name": "Contactin", "gene_name": "Cont", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VNJ5-1", "protein_name": "Protein dispatched", "gene_name": "disp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VGG5-1", "protein_name": "Cadherin-87A", "gene_name": "Cad87A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W4C5-1", "protein_name": "Sodium-dependent nutrient amino acid transporter 1", "gene_name": "NAAT1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W568-1", "protein_name": "Protein halfway", "gene_name": "hfw", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q00174-1", "protein_name": "Laminin subunit alpha", "gene_name": "LanA", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q09101-1", "protein_name": "Locomotion-related protein Hikaru genki", "gene_name": "hig", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q0KHY3-3", "protein_name": "Protein mesh", "gene_name": "mesh", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24418-1", "protein_name": "Glutamate [NMDA] receptor subunit 1", "gene_name": "Nmdar1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7K0P4-1", "protein_name": "Post-GPI attachment to proteins factor 3", "gene_name": "PGAP3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94887-1", "protein_name": "Neurexin-4", "gene_name": "Nrx-IV", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W2M2-1", "protein_name": "Trehalase", "gene_name": "Treh", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1100, "start_aa": "Asn", "end_pos": 1100, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1100", "evidence": [ { "id": "P10040", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P10040#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P10040-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 232, "start_aa": "Asn", "end_pos": 232, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn232", "evidence": [ { "id": "P10379", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P10379#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P10379-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 264, "start_aa": "Asn", "end_pos": 264, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn264", "evidence": [ { "id": "P40689", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P40689#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P40689-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 198, "start_aa": "Asn", "end_pos": 198, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn198", "evidence": [ { "id": "P20241", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P20241#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P20241-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 411, "start_aa": "Asn", "end_pos": 411, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn411", "evidence": [ { "id": "P20241", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P20241#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P20241-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 330, "start_aa": "Asn", "end_pos": 330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn330", "evidence": [ { "id": "P34082", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P34082#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P34082-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 576, "start_aa": "Asn", "end_pos": 576, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn576", "evidence": [ { "id": "P34082", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P34082#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P34082-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 196, "start_aa": "Asn", "end_pos": 196, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn196", "evidence": [ { "id": "P06002", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P06002#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P06002-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1251, "start_aa": "Asn", "end_pos": 1251, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1251", "evidence": [ { "id": "P42787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P42787#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" }, { "id": "PRU00498", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/PRU00498" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P42787-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 669, "start_aa": "Asn", "end_pos": 669, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn669", "evidence": [ { "id": "Q868Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q868Z9#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q868Z9-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 320, "start_aa": "Asn", "end_pos": 320, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn320", "evidence": [ { "id": "Q95T64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q95T64#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q95T64-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 354, "start_aa": "Asn", "end_pos": 354, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn354", "evidence": [ { "id": "Q9NFP1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9NFP1#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9NFP1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 86, "start_aa": "Asn", "end_pos": 86, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn86", "evidence": [ { "id": "Q9VCR7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9VCR7#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9VCR7-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 743, "start_aa": "Asn", "end_pos": 743, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn743", "evidence": [ { "id": "Q9VEX0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9VEX0#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9VEX0-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 112, "start_aa": "Asn", "end_pos": 112, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn112", "evidence": [ { "id": "Q9VW12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9VW12#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9VW12-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 497, "start_aa": "Asn", "end_pos": 497, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn497", "evidence": [ { "id": "P10674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P10674#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P10674-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "High mannose", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (high mannose) asparagine;High mannose", "icn3d_view": {}, "start_pos": 1122, "start_aa": "Asn", "end_pos": 1122, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1122", "evidence": [ { "id": "P12024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12024#ptm_processing" }, { "id": "19415110", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19415110" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00000000000000.00.01000", "uniprot_canonical_ac": "P12024-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "High mannose", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (high mannose) asparagine;High mannose", "icn3d_view": {}, "start_pos": 1171, "start_aa": "Asn", "end_pos": 1171, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1171", "evidence": [ { "id": "P12024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12024#ptm_processing" }, { "id": "19415110", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19415110" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00000000000000.00.01000", "uniprot_canonical_ac": "P12024-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (paucimannose) asparagine", "icn3d_view": {}, "start_pos": 305, "start_aa": "Asn", "end_pos": 305, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn305", "evidence": [ { "id": "P12024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12024#ptm_processing" }, { "id": "19415110", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19415110" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P12024-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "High mannose", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (high mannose) asparagine;High mannose", "icn3d_view": {}, "start_pos": 692, "start_aa": "Asn", "end_pos": 692, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn692", "evidence": [ { "id": "P12024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12024#ptm_processing" }, { "id": "19415110", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19415110" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00000000000000.00.01000", "uniprot_canonical_ac": "P12024-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "High mannose", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (high mannose) asparagine;High mannose", "icn3d_view": {}, "start_pos": 936, "start_aa": "Asn", "end_pos": 936, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn936", "evidence": [ { "id": "P12024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P12024#ptm_processing" }, { "id": "19415110", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19415110" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00000000000000.00.01000", "uniprot_canonical_ac": "P12024-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 259, "start_aa": "Asn", "end_pos": 259, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn259", "evidence": [ { "id": "P08510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08510#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P08510-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 263, "start_aa": "Asn", "end_pos": 263, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn263", "evidence": [ { "id": "P08510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08510#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P08510-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1471, "start_aa": "Asn", "end_pos": 1471, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1471", "evidence": [ { "id": "A0A1F4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A1F4#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "A0A1F4-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 420, "start_aa": "Asn", "end_pos": 420, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn420", "evidence": [ { "id": "P08171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08171#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P08171-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "P08171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08171#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P08171-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 456, "start_aa": "Asn", "end_pos": 456, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn456", "evidence": [ { "id": "P08171", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08171#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P08171-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1493, "start_aa": "Asn", "end_pos": 1493, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1493", "evidence": [ { "id": "P11046", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11046#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P11046-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 870, "start_aa": "Asn", "end_pos": 870, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn870", "evidence": [ { "id": "O97394", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O97394#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O97394-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 857, "start_aa": "Asn", "end_pos": 857, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn857", "evidence": [ { "id": "O61307", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O61307#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O61307-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 82, "start_aa": "Asn", "end_pos": 82, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn82", "evidence": [ { "id": "O44386", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O44386#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O44386-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 35, "start_aa": "Asn", "end_pos": 35, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn35", "evidence": [ { "id": "P11147", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11147#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P11147-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 403, "start_aa": "Asn", "end_pos": 403, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn403", "evidence": [ { "id": "P11584", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11584#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P11584-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 557, "start_aa": "Asn", "end_pos": 557, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn557", "evidence": [ { "id": "P11584", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11584#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P11584-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 718, "start_aa": "Asn", "end_pos": 718, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn718", "evidence": [ { "id": "P11584", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P11584#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P11584-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "Q00748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q00748#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q00748-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "Q8MM24", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8MM24#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q8MM24-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 206, "start_aa": "Asn", "end_pos": 206, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn206", "evidence": [ { "id": "Q24048", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q24048#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q24048-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 112, "start_aa": "Asn", "end_pos": 112, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn112", "evidence": [ { "id": "P91685", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P91685#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P91685-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 133, "start_aa": "Asn", "end_pos": 133, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn133", "evidence": [ { "id": "Q24046", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q24046#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q24046-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 211, "start_aa": "Asn", "end_pos": 211, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn211", "evidence": [ { "id": "Q24046", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q24046#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q24046-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1027, "start_aa": "Asn", "end_pos": 1027, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1027", "evidence": [ { "id": "Q24247", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q24247#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q24247-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 657, "start_aa": "Asn", "end_pos": 657, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn657", "evidence": [ { "id": "Q24247", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q24247#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q24247-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 104, "start_aa": "Asn", "end_pos": 104, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn104", "evidence": [ { "id": "Q27367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q27367#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q27367-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 110, "start_aa": "Asn", "end_pos": 110, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn110", "evidence": [ { "id": "Q27367", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q27367#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q27367-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 476, "start_aa": "Asn", "end_pos": 476, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn476", "evidence": [ { "id": "Q9VR07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9VR07#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9VR07-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 2822, "start_aa": "Asn", "end_pos": 2822, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2822", "evidence": [ { "id": "Q9V496", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9V496#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9V496-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 304, "start_aa": "Asn", "end_pos": 304, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn304", "evidence": [ { "id": "Q9V498", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9V498#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9V498-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1307, "start_aa": "Asn", "end_pos": 1307, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1307", "evidence": [ { "id": "Q9VN14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9VN14#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9VN14-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 912, "start_aa": "Asn", "end_pos": 912, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn912", "evidence": [ { "id": "Q9VN14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9VN14#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9VN14-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 388, "start_aa": "Asn", "end_pos": 388, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn388", "evidence": [ { "id": "Q9VNJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9VNJ5#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9VNJ5-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1576, "start_aa": "Asn", "end_pos": 1576, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1576", "evidence": [ { "id": "Q9VGG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9VGG5#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9VGG5-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 424, "start_aa": "Asn", "end_pos": 424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn424", "evidence": [ { "id": "Q9VGG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9VGG5#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9VGG5-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 190, "start_aa": "Asn", "end_pos": 190, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn190", "evidence": [ { "id": "Q9W4C5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9W4C5#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9W4C5-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 221, "start_aa": "Asn", "end_pos": 221, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn221", "evidence": [ { "id": "Q9W568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9W568#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9W568-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "Q9W568", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9W568#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19349973" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9W568-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 2196, "start_aa": "Asn", "end_pos": 2196, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2196", "evidence": [ { "id": "Q00174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q00174#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q00174-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 2538, "start_aa": "Asn", "end_pos": 2538, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn2538", "evidence": [ { "id": "Q00174", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q00174#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q00174-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 376, "start_aa": "Asn", "end_pos": 376, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn376", "evidence": [ { "id": "Q09101", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q09101#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q09101-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 888, "start_aa": "Asn", "end_pos": 888, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn888", "evidence": [ { "id": "Q0KHY3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q0KHY3#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q0KHY3-3" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 693, "start_aa": "Asn", "end_pos": 693, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn693", "evidence": [ { "id": "Q24418", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q24418#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q24418-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 42, "start_aa": "Asn", "end_pos": 42, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn42", "evidence": [ { "id": "Q7K0P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q7K0P4#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q7K0P4-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 1137, "start_aa": "Asn", "end_pos": 1137, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1137", "evidence": [ { "id": "Q94887", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q94887#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q94887-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 451, "start_aa": "Asn", "end_pos": 451, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn451", "evidence": [ { "id": "Q9W2M2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9W2M2#ptm_processing" }, { "id": "17893096", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17893096" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9W2M2-1" } ], "record_id": "pubmed.17893096", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 48 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 64 }, { "field": "total_sites", "count": 64 }, { "field": "n_linked_sites", "count": 64 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 64 }, { "field": "exact_n_linked_sites", "count": 64 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 64 }, { "field": "total_sites", "count": 64 }, { "field": "n_linked_sites", "count": 64 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 64 }, { "field": "exact_n_linked_sites", "count": 64 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila Crumbs signal peptide is unusually long and is a substrate for signal peptide peptidase.", "journal": "European journal of cell biology", "date": "2010-06", "authors": "Kilic Annett, Klose Sven, Dobberstein Bernhard, Knust Elisabeth, Kapp Katja", "reference": { "type": "PubMed", "id": "20189678", "url": "https://pubmed.ncbi.nlm.nih.gov/20189678" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VPQ7-1", "protein_name": "Signal peptide peptidase", "gene_name": "Spp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q86P97-1", "protein_name": "Signal peptide peptidase-like", "gene_name": "SppL", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 274, "end_pos": 274, "sequence_org": "D", "sequence_mut": "A", "comment": "Disrupts catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9VPQ7", "url": "https://www.uniprot.org/uniprotkb/Q9VPQ7" }, { "database": "PubMed", "id": "17517891", "url": "https://pubmed.ncbi.nlm.nih.gov/17517891" }, { "database": "PubMed", "id": "20189678", "url": "https://pubmed.ncbi.nlm.nih.gov/20189678" } ], "uniprot_canonical_ac": "Q9VPQ7-1" } ], "record_id": "pubmed.20189678", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "crumbs encodes an EGF-like protein expressed on apical membranes of Drosophila epithelial cells and required for organization of epithelia.", "journal": "Cell", "date": "1990-06-01", "authors": "Tepass U, Theres C, Knust E", "reference": { "type": "PubMed", "id": "2344615", "url": "https://pubmed.ncbi.nlm.nih.gov/2344615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2344615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crumbs interacts with Xpd for nuclear division control in Drosophila.", "journal": "Oncogene", "date": "2015-05-21", "authors": "Yeom E, Hong S-T, Choi K-W", "reference": { "type": "PubMed", "id": "25065591", "url": "https://pubmed.ncbi.nlm.nih.gov/25065591" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V968-1", "protein_name": "MIP18 family protein galla-1", "gene_name": "galla-1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VTC4-1", "protein_name": "MIP18 family protein galla-2", "gene_name": "galla-2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.25065591", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The apical protein Apnoia interacts with Crumbs to regulate tracheal growth and inflation.", "journal": "PLoS genetics", "date": "2019-01", "authors": "Skouloudaki Kassiani, Papadopoulos Dimitrios K, Tomancak Pavel, Knust Elisabeth", "reference": { "type": "PubMed", "id": "30645584", "url": "https://pubmed.ncbi.nlm.nih.gov/30645584" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VFX3-1", "protein_name": "Protein apnoia", "gene_name": "apn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.30645584", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EGF homologous sequences encoded in the genome of Drosophila melanogaster, and their relation to neurogenic genes.", "journal": "EMBO J.", "date": "1987", "authors": "Knust E, Dietrich U, Tepass U, Bremer K A, Weigel D, V\u00e4ssin H, Campos-Ortega J A", "reference": { "type": "PubMed", "id": "3107986", "url": "https://pubmed.ncbi.nlm.nih.gov/3107986" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P10041-1", "protein_name": "Neurogenic locus protein delta", "gene_name": "Delta", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.3107986", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The brachyceran de novo gene PIP82, a phosphorylation target of aPKC, is essential for proper formation and maintenance of the rhabdomeric photoreceptor apical domain in Drosophila.", "journal": "PLoS genetics", "date": "2020", "authors": "Zelhof AC, Mahato S, Liang X, Rylee J, Bergh E, Feder LE, Larsen ME, Britt SG, Friedrich M", "reference": { "type": "PubMed", "id": "32579558", "url": "https://pubmed.ncbi.nlm.nih.gov/32579558" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10040-1", "protein_name": "Protein crumbs", "gene_name": "crb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W3E2-1", "protein_name": "Protein PIP82", "gene_name": "PIP82", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10040", "url": "https://www.uniprot.org/uniprotkb/P10040" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.32579558", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The regulatory complex of Drosophila melanogaster 26S proteasomes. Subunit composition and localization of a deubiquitylating enzyme.", "journal": "J. Cell Biol.", "date": "2000", "authors": "H\u00f6lzl H, Kapelari B, Kellermann J, Seem\u00fcller E, S\u00fcmegi M, Udvardy A, Medalia O, Sperling J, M\u00fcller S A, Engel A, Baumeister W", "reference": { "type": "PubMed", "id": "10893261", "url": "https://pubmed.ncbi.nlm.nih.gov/10893261" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7KLV9-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 11", "gene_name": "Rpn6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3H2-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 14", "gene_name": "Rpn11", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P26270-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 7", "gene_name": "Rpn8", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3P6-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 1", "gene_name": "Rpn2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q7KLV9", "url": "https://www.uniprot.org/uniprotkb/Q7KLV9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10893261", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The proteasome regulatory particle subunit Rpn6 is required for Drosophila development and interacts physically with signalosome subunit Alien/CSN2.", "journal": "Gene", "date": "2002", "authors": "Lier Simone, Paululat Achim", "reference": { "type": "PubMed", "id": "12426099", "url": "https://pubmed.ncbi.nlm.nih.gov/12426099" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7KLV9-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 11", "gene_name": "Rpn6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94899-1", "protein_name": "COP9 signalosome complex subunit 2", "gene_name": "alien", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q7KLV9", "url": "https://www.uniprot.org/uniprotkb/Q7KLV9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12426099", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide RNAi analysis of JAK/STAT signaling components in Drosophila.", "journal": "Genes & development", "date": "2005", "authors": "Baeg GH, Zhou R, Perrimon N", "reference": { "type": "PubMed", "id": "16055650", "url": "https://pubmed.ncbi.nlm.nih.gov/16055650" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4Z8K6-1", "protein_name": "Ran-binding proteins 9/10 homolog", "gene_name": "RanBPM", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VWX2-1", "protein_name": "Unpaired 2", "gene_name": "upd2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24592-1", "protein_name": "Tyrosine-protein kinase hopscotch", "gene_name": "hop", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VWE0-1", "protein_name": "Cytokine receptor", "gene_name": "dome", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q59E38-1", "protein_name": "Unpaired 3", "gene_name": "upd3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24151-1", "protein_name": "Signal transducer and transcription activator", "gene_name": "Stat92E", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q4Z8K6", "url": "https://www.uniprot.org/uniprotkb/Q4Z8K6" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16055650", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RanBPM regulates cell shape, arrangement, and capacity of the female germline stem cell niche in Drosophila melanogaster.", "journal": "The Journal of cell biology", "date": "2008-09-08", "authors": "Dansereau David A, Lasko Paul", "reference": { "type": "PubMed", "id": "18762575", "url": "https://pubmed.ncbi.nlm.nih.gov/18762575" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q4Z8K6-1", "protein_name": "Ran-binding proteins 9/10 homolog", "gene_name": "RanBPM", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q4Z8K6", "url": "https://www.uniprot.org/uniprotkb/Q4Z8K6" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18762575", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heparan sulfate proteoglycan syndecan promotes axonal and myotube guidance by slit/robo signaling.", "journal": "Current biology : CB", "date": "2004-02-03", "authors": "Steigemann Patrick, Molitor Andreas, Fellert Sonja, J\u00e4ckle Herbert, Vorbr\u00fcggen Gerd", "reference": { "type": "PubMed", "id": "14761655", "url": "https://pubmed.ncbi.nlm.nih.gov/14761655" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49415-1", "protein_name": "Syndecan", "gene_name": "Sdc", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P49415", "url": "https://www.uniprot.org/uniprotkb/P49415" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.14761655", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila syndecan: conservation of a cell-surface heparan sulfate proteoglycan.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994-04-12", "authors": "Spring J, Paine-Saunders S E, Hynes R O, Bernfield M", "reference": { "type": "PubMed", "id": "8159748", "url": "https://pubmed.ncbi.nlm.nih.gov/8159748" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49415-1", "protein_name": "Syndecan", "gene_name": "Sdc", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P49415", "url": "https://www.uniprot.org/uniprotkb/P49415" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8159748", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The staufen/pumilio pathway is involved in Drosophila long-term memory.", "journal": "Curr. Biol.", "date": "2003", "authors": "Dubnau Josh, Chiang Ann-Shyn, Grady Lori, Barditch Jody, Gossweiler Scott, McNeil John, Smith Patrick, Buldoc Francois, Scott Rod, Certa Uli, Broger Clemens, Tully Tim", "reference": { "type": "PubMed", "id": "12593794", "url": "https://pubmed.ncbi.nlm.nih.gov/12593794" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7K2Y9-1", "protein_name": "Protein N-terminal glutamine amidohydrolase", "gene_name": "tun", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VNE2-1", "protein_name": "Protein krasavietz", "gene_name": "kra", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q7K2Y9", "url": "https://www.uniprot.org/uniprotkb/Q7K2Y9" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12593794", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cuticle protein genes of Drosophila: structure, organization and evolution of four clustered genes.", "journal": "Cell", "date": "1982", "authors": "Snyder M, Hunkapiller M, Yuen D, Silvert D, Fristrom J, Davidson N", "reference": { "type": "PubMed", "id": "6817923", "url": "https://pubmed.ncbi.nlm.nih.gov/6817923" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07187-1", "protein_name": "Larval cuticle protein 2", "gene_name": "Lcp2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P07189-1", "protein_name": "Larval cuticle protein 4", "gene_name": "Lcp4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P02839-1", "protein_name": "Larval cuticle protein 1", "gene_name": "Lcp1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P07188-1", "protein_name": "Larval cuticle protein 3", "gene_name": "Lcp3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07187", "url": "https://www.uniprot.org/uniprotkb/P07187" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.6817923", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Asymmetric Notch activation specifies photoreceptors R3 and R4 and planar polarity in the Drosophila eye.", "journal": "Nature", "date": "1999", "authors": "Fanto M, Mlodzik M", "reference": { "type": "PubMed", "id": "10028968", "url": "https://pubmed.ncbi.nlm.nih.gov/10028968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P92208-1", "protein_name": "Stress-activated protein kinase JNK", "gene_name": "bsk", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10028968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction and specificity of Rel-related proteins in regulating Drosophila immunity gene expression.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Han ZS, Ip YT", "reference": { "type": "PubMed", "id": "10409696", "url": "https://pubmed.ncbi.nlm.nih.gov/10409696" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24537-1", "protein_name": "High mobility group protein DSP1", "gene_name": "Dsp1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24151-1", "protein_name": "Signal transducer and transcription activator", "gene_name": "Stat92E", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94517-1", "protein_name": "Histone deacetylase HDAC1", "gene_name": "HDAC1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94527-1", "protein_name": "Nuclear factor NF-kappa-B p110 subunit", "gene_name": "Rel", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10409696", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Decoding vectorial information from a gradient: sequential roles of the receptors Frizzled and Notch in establishing planar polarity in the Drosophila eye.", "journal": "Development (Cambridge, England)", "date": "1999", "authors": "Tomlinson A, Struhl G", "reference": { "type": "PubMed", "id": "10572048", "url": "https://pubmed.ncbi.nlm.nih.gov/10572048" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P92208-1", "protein_name": "Stress-activated protein kinase JNK", "gene_name": "bsk", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10572048", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Jun mediates Frizzled-induced R3/R4 cell fate distinction and planar polarity determination in the Drosophila eye.", "journal": "Development (Cambridge, England)", "date": "2000", "authors": "Weber U, Paricio N, Mlodzik M", "reference": { "type": "PubMed", "id": "10903185", "url": "https://pubmed.ncbi.nlm.nih.gov/10903185" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P92208-1", "protein_name": "Stress-activated protein kinase JNK", "gene_name": "bsk", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10903185", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of the Drosophila NF-kappaB factor Relish by rapid endoproteolytic cleavage.", "journal": "EMBO reports", "date": "2000", "authors": "Stoven S, Ando I, Kadalayil L, Engstrom Y, Hultmark D", "reference": { "type": "PubMed", "id": "11269501", "url": "https://pubmed.ncbi.nlm.nih.gov/11269501" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24537-1", "protein_name": "High mobility group protein DSP1", "gene_name": "Dsp1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24151-1", "protein_name": "Signal transducer and transcription activator", "gene_name": "Stat92E", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94517-1", "protein_name": "Histone deacetylase HDAC1", "gene_name": "HDAC1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94527-1", "protein_name": "Nuclear factor NF-kappa-B p110 subunit", "gene_name": "Rel", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11269501", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CKA, a novel multidomain protein, regulates the JUN N-terminal kinase signal transduction pathway in Drosophila.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Chen HW, Marinissen MJ, Oh SW, Chen X, Melnick M, Perrimon N, Gutkind JS, Hou SX", "reference": { "type": "PubMed", "id": "11865058", "url": "https://pubmed.ncbi.nlm.nih.gov/11865058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q23977-1", "protein_name": "Dual specificity mitogen-activated protein kinase kinase hemipterous", "gene_name": "hep", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P92208-1", "protein_name": "Stress-activated protein kinase JNK", "gene_name": "bsk", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11865058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Caspase-mediated processing of the Drosophila NF-kappaB factor Relish.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Stoven S, Silverman N, Junell A, Hedengren-Olcott M, Erturk D, Engstrom Y, Maniatis T, Hultmark D", "reference": { "type": "PubMed", "id": "12732719", "url": "https://pubmed.ncbi.nlm.nih.gov/12732719" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P35128-1", "protein_name": "Ubiquitin-conjugating enzyme E2 N", "gene_name": "ben", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P15357-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RpS27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P18101-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "RpL40", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VRL1-1", "protein_name": "Ubiquitin-conjugating enzyme variant 1A, isoform A; Ubiquitin-conjugating enzyme variant 1A, isoform C", "gene_name": "Uev1A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P0CG69-1", "protein_name": "Polyubiquitin", "gene_name": "Ubi-p63E", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24537-1", "protein_name": "High mobility group protein DSP1", "gene_name": "Dsp1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7K4Z4-1", "protein_name": "Protein immune deficiency", "gene_name": "imd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24307-1", "protein_name": "Death-associated inhibitor of apoptosis 2", "gene_name": "Diap2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8IRY7-1", "protein_name": "Caspase-8", "gene_name": "Dredd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3B4-1", "protein_name": "Fas-associated death domain protein", "gene_name": "Fadd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3Q6-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 7", "gene_name": "Tak1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9GYV5-1", "protein_name": "NF-kappa-B essential modulator", "gene_name": "key", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24151-1", "protein_name": "Signal transducer and transcription activator", "gene_name": "Stat92E", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94517-1", "protein_name": "Histone deacetylase HDAC1", "gene_name": "HDAC1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94527-1", "protein_name": "Nuclear factor NF-kappa-B p110 subunit", "gene_name": "Rel", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VEZ5-1", "protein_name": "Inhibitor of nuclear factor kappa-B kinase subunit beta", "gene_name": "IKKbeta", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VXN9-1", "protein_name": "Peptidoglycan-recognition protein LE", "gene_name": "PGRP-LE", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12732719", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Downregulation of lipopolysaccharide response in Drosophila by negative crosstalk between the AP1 and NF-kappaB signaling modules.", "journal": "Nature immunology", "date": "2005", "authors": "Kim T, Yoon J, Cho H, Lee WB, Kim J, Song YH, Kim SN, Yoon JH, Kim-Ha J, Kim YJ", "reference": { "type": "PubMed", "id": "15640802", "url": "https://pubmed.ncbi.nlm.nih.gov/15640802" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24537-1", "protein_name": "High mobility group protein DSP1", "gene_name": "Dsp1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24151-1", "protein_name": "Signal transducer and transcription activator", "gene_name": "Stat92E", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94517-1", "protein_name": "Histone deacetylase HDAC1", "gene_name": "HDAC1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94527-1", "protein_name": "Nuclear factor NF-kappa-B p110 subunit", "gene_name": "Rel", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15640802", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila homolog of the mammalian jun oncogene is expressed during embryonic development and activates transcription in mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1990-08", "authors": "Zhang K, Chaillet J R, Perkins L A, Halazonetis T D, Perrimon N", "reference": { "type": "PubMed", "id": "1696724", "url": "https://pubmed.ncbi.nlm.nih.gov/1696724" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1696724", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oncogenic and transcriptional cooperation with Ha-Ras requires phosphorylation of c-Jun on serines 63 and 73.", "journal": "Nature", "date": "1991", "authors": "Smeal T, Binetruy B, Mercola DA, Birrer M, Karin M", "reference": { "type": "PubMed", "id": "1749429", "url": "https://pubmed.ncbi.nlm.nih.gov/1749429" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P92208-1", "protein_name": "Stress-activated protein kinase JNK", "gene_name": "bsk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P17325-1", "protein_name": "Transcription factor Jun", "gene_name": "Jun", "tax_name": "Rat" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "phosphorylation": [ { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "P20171-1", "kinase_gene_name": "Hras", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17325" }, { "database": "PubMed", "id": "1749429", "url": "https://pubmed.ncbi.nlm.nih.gov/1749429" } ], "site_lbl": "Ser63", "uniprot_canonical_ac": "P17325-1" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "P20171-1", "kinase_gene_name": "Hras", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P17325", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P17325" }, { "database": "PubMed", "id": "1749429", "url": "https://pubmed.ncbi.nlm.nih.gov/1749429" } ], "site_lbl": "Ser73", "uniprot_canonical_ac": "P17325-1" } ], "record_id": "pubmed.1749429", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Down-regulation of NF-kappaB target genes by the AP-1 and STAT complex during the innate immune response in Drosophila.", "journal": "PLoS biology", "date": "2007", "authors": "Kim LK, Choi UY, Cho HS, Lee JS, Lee WB, Kim J, Jeong K, Shim J, Kim-Ha J, Kim YJ", "reference": { "type": "PubMed", "id": "17803358", "url": "https://pubmed.ncbi.nlm.nih.gov/17803358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24537-1", "protein_name": "High mobility group protein DSP1", "gene_name": "Dsp1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24151-1", "protein_name": "Signal transducer and transcription activator", "gene_name": "Stat92E", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94517-1", "protein_name": "Histone deacetylase HDAC1", "gene_name": "HDAC1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q94527-1", "protein_name": "Nuclear factor NF-kappa-B p110 subunit", "gene_name": "Rel", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17803358", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of c-jun mediated by MAP kinases.", "journal": "Nature", "date": "1991", "authors": "Pulverer BJ, Kyriakis JM, Avruch J, Nikolakaki E, Woodgett JR", "reference": { "type": "PubMed", "id": "1922387", "url": "https://pubmed.ncbi.nlm.nih.gov/1922387" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P92208-1", "protein_name": "Stress-activated protein kinase JNK", "gene_name": "bsk", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1922387", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction between Drosophila bZIP proteins Atf3 and Jun prevents replacement of epithelial cells during metamorphosis.", "journal": "Development", "date": "2010", "authors": "Sekyrova Petra, Bohmann Dirk, Jindra Marek, Uhlirova Mirka", "reference": { "type": "PubMed", "id": "20023169", "url": "https://pubmed.ncbi.nlm.nih.gov/20023169" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9XZS8-1", "protein_name": "Activating transcription factor 3", "gene_name": "Atf3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.20023169", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila Fos-related AP-1 protein is a developmentally regulated transcription factor.", "journal": "Genes & development", "date": "1990-05", "authors": "Perkins K K, Admon A, Patel N, Tjian R", "reference": { "type": "PubMed", "id": "2116361", "url": "https://pubmed.ncbi.nlm.nih.gov/2116361" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2116361", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A JNK signal transduction pathway that mediates morphogenesis and an immune response in Drosophila.", "journal": "Genes & development", "date": "1996", "authors": "Sluss HK, Han Z, Barrett T, Goberdhan DC, Wilson C, Davis RJ, Ip YT", "reference": { "type": "PubMed", "id": "8946915", "url": "https://pubmed.ncbi.nlm.nih.gov/8946915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q23977-1", "protein_name": "Dual specificity mitogen-activated protein kinase kinase hemipterous", "gene_name": "hep", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P92208-1", "protein_name": "Stress-activated protein kinase JNK", "gene_name": "bsk", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8946915", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila Jun-N-terminal kinase is required for cell morphogenesis but not for DJun-dependent cell fate specification in the eye.", "journal": "Genes & development", "date": "1996", "authors": "Riesgo-Escovar JR, Jenni M, Fritz A, Hafen E", "reference": { "type": "PubMed", "id": "8946916", "url": "https://pubmed.ncbi.nlm.nih.gov/8946916" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P21525-5", "protein_name": "Transcription factor kayak, isoforms A/B/F", "gene_name": "kay", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P92208-1", "protein_name": "Stress-activated protein kinase JNK", "gene_name": "bsk", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 225, "end_pos": 225, "sequence_org": "G", "sequence_mut": "E", "comment": "In BSK-1; defect in dorsal closure.", "evidence": [ { "database": "UniProtKB", "id": "P92208", "url": "https://www.uniprot.org/uniprotkb/P92208" }, { "database": "PubMed", "id": "8946916", "url": "https://pubmed.ncbi.nlm.nih.gov/8946916" } ], "uniprot_canonical_ac": "P92208-1" }, { "start_pos": 316, "end_pos": 372, "sequence_org": "KHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHNTNNRTR", "sequence_mut": "", "comment": "In BSK-2; defect in dorsal closure.", "evidence": [ { "database": "UniProtKB", "id": "P92208", "url": "https://www.uniprot.org/uniprotkb/P92208" }, { "database": "PubMed", "id": "8946916", "url": "https://pubmed.ncbi.nlm.nih.gov/8946916" } ], "uniprot_canonical_ac": "P92208-1" } ], "record_id": "pubmed.8946916", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Jun in Drosophila development: redundant and nonredundant functions and regulation by two MAPK signal transduction pathways.", "journal": "Genes & development", "date": "1997-07-01", "authors": "Kockel L, Zeitlinger J, Staszewski L M, Mlodzik M, Bohmann D", "reference": { "type": "PubMed", "id": "9224723", "url": "https://pubmed.ncbi.nlm.nih.gov/9224723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P18289-1", "protein_name": "Transcription factor Jra", "gene_name": "Jra", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P18289", "url": "https://www.uniprot.org/uniprotkb/P18289" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9224723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of Drosophila transcription factor Adf-1 reveals homology to Myb oncoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992-01-15", "authors": "England B P, Admon A, Tjian R", "reference": { "type": "PubMed", "id": "1731341", "url": "https://pubmed.ncbi.nlm.nih.gov/1731341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05552-1", "protein_name": "Transcription factor Adf-1", "gene_name": "Adf1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05552", "url": "https://www.uniprot.org/uniprotkb/P05552" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1731341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purified Drosophila transcription factor, Adh distal factor-1 (Adf-1), binds to sites in several Drosophila promoters and activates transcription.", "journal": "The Journal of biological chemistry", "date": "1990-03-25", "authors": "England B P, Heberlein U, Tjian R", "reference": { "type": "PubMed", "id": "2318884", "url": "https://pubmed.ncbi.nlm.nih.gov/2318884" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05552-1", "protein_name": "Transcription factor Adf-1", "gene_name": "Adf1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05552", "url": "https://www.uniprot.org/uniprotkb/P05552" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2318884", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA-binding and trans-activation properties of Drosophila E2F and DP proteins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1994", "authors": "Dynlacht B D, Brook A, Dembski M, Yenush L, Dyson N", "reference": { "type": "PubMed", "id": "8022787", "url": "https://pubmed.ncbi.nlm.nih.gov/8022787" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q24318-1", "protein_name": "Transcription factor Dp", "gene_name": "Dp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q27368-1", "protein_name": "Transcription factor E2f1", "gene_name": "E2f1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q24318", "url": "https://www.uniprot.org/uniprotkb/Q24318" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8022787", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in Drosophila DP and E2F distinguish G1-S progression from an associated transcriptional program.", "journal": "Genes Dev.", "date": "1997", "authors": "Royzman I, Whittaker A J, Orr-Weaver T L", "reference": { "type": "PubMed", "id": "9271122", "url": "https://pubmed.ncbi.nlm.nih.gov/9271122" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q24318-1", "protein_name": "Transcription factor Dp", "gene_name": "Dp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q27368-1", "protein_name": "Transcription factor E2f1", "gene_name": "E2f1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q24318", "url": "https://www.uniprot.org/uniprotkb/Q24318" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9271122", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic and molecular identification of a Drosophila histidine decarboxylase gene required in photoreceptor transmitter synthesis.", "journal": "The EMBO journal", "date": "1993-03", "authors": "Burg M G, Sarthy P V, Koliantz G, Pak W L", "reference": { "type": "PubMed", "id": "8096176", "url": "https://pubmed.ncbi.nlm.nih.gov/8096176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q05733-1", "protein_name": "Histidine decarboxylase", "gene_name": "Hdc", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q05733", "url": "https://www.uniprot.org/uniprotkb/Q05733" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8096176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The USP46 deubiquitylase complex increases Wingless/Wnt signaling strength by stabilizing Arrow/LRP6.", "journal": "Nature communications", "date": "2023-10-05", "authors": "Spencer Zachary T, Ng Victoria H, Benchabane Hassina, Siddiqui Ghalia Saad, Duwadi Deepesh, Maines Ben, Bryant Jamal M, Schwarzkopf Anna, Yuan Kai, Kassel Sara N, Mishra Anant, Pimentel Ashley, Lebensohn Andres M, Rohatgi Rajat, Gerber Scott A, Robbins David J, Lee Ethan, Ahmed Yashi", "reference": { "type": "PubMed", "id": "37798281", "url": "https://pubmed.ncbi.nlm.nih.gov/37798281" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q1LZ08-1", "protein_name": "WD repeat-containing protein 48 homolog", "gene_name": "Uaf1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCT9-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 12/46 homolog", "gene_name": "Usp12-46", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VBC4-1", "protein_name": "WD repeat-containing protein 20 homolog", "gene_name": "Wdr20", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q1LZ08", "url": "https://www.uniprot.org/uniprotkb/Q1LZ08" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.37798281", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila castor gene is involved in postembryonic brain development.", "journal": "Mech. Dev.", "date": "2001", "authors": "Hitier R, Chaminade M, Pr\u00e9at T", "reference": { "type": "PubMed", "id": "11335107", "url": "https://pubmed.ncbi.nlm.nih.gov/11335107" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7M3M8-1", "protein_name": "Transcription factor castor", "gene_name": "cas", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q7M3M8", "url": "https://www.uniprot.org/uniprotkb/Q7M3M8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11335107", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ming is expressed in neuroblast sublineages and regulates gene expression in the Drosophila central nervous system.", "journal": "Development (Cambridge, England)", "date": "1992-12", "authors": "Cui X, Doe C Q", "reference": { "type": "PubMed", "id": "1339340", "url": "https://pubmed.ncbi.nlm.nih.gov/1339340" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7M3M8-1", "protein_name": "Transcription factor castor", "gene_name": "cas", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q7M3M8", "url": "https://www.uniprot.org/uniprotkb/Q7M3M8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1339340", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "castor encodes a novel zinc finger protein required for the development of a subset of CNS neurons in Drosophila.", "journal": "Neuron", "date": "1992-11", "authors": "Mellerick D M, Kassis J A, Zhang S D, Odenwald W F", "reference": { "type": "PubMed", "id": "1418995", "url": "https://pubmed.ncbi.nlm.nih.gov/1418995" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7M3M8-1", "protein_name": "Transcription factor castor", "gene_name": "cas", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q7M3M8", "url": "https://www.uniprot.org/uniprotkb/Q7M3M8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1418995", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of the cell cycle and cytokinesis in regulating neuroblast sublineage gene expression in the Drosophila CNS.", "journal": "Development", "date": "1995", "authors": "Cui X, Doe C Q", "reference": { "type": "PubMed", "id": "7588058", "url": "https://pubmed.ncbi.nlm.nih.gov/7588058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7M3M8-1", "protein_name": "Transcription factor castor", "gene_name": "cas", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q7M3M8", "url": "https://www.uniprot.org/uniprotkb/Q7M3M8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7588058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of POU genes by castor and hunchback establishes layered compartments in the Drosophila CNS.", "journal": "Genes & development", "date": "1998-01-15", "authors": "Kambadur R, Koizumi K, Stivers C, Nagle J, Poole S J, Odenwald W F", "reference": { "type": "PubMed", "id": "9436984", "url": "https://pubmed.ncbi.nlm.nih.gov/9436984" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7M3M8-1", "protein_name": "Transcription factor castor", "gene_name": "cas", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q7M3M8", "url": "https://www.uniprot.org/uniprotkb/Q7M3M8" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9436984", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of Drosophila TFIID subunits.", "journal": "Nature", "date": "1994", "authors": "Kokubo T, Gong D W, Wootton J C, Horikoshi M, Roeder R G, Nakatani Y", "reference": { "type": "PubMed", "id": "7545910", "url": "https://pubmed.ncbi.nlm.nih.gov/7545910" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49905-1", "protein_name": "Transcription initiation factor TFIID subunit 12", "gene_name": "Taf12", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P49847-1", "protein_name": "Transcription initiation factor TFIID subunit 6", "gene_name": "Taf6", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q27272-1", "protein_name": "Transcription initiation factor TFIID subunit 9", "gene_name": "Taf9", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P49905", "url": "https://www.uniprot.org/uniprotkb/P49905" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7545910", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of dTAFII30 alpha and dTAFII30 beta: two small subunits of Drosophila TFIID.", "journal": "Genes Dev.", "date": "1993", "authors": "Yokomori K, Chen J L, Admon A, Zhou S, Tjian R", "reference": { "type": "PubMed", "id": "8276241", "url": "https://pubmed.ncbi.nlm.nih.gov/8276241" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49905-1", "protein_name": "Transcription initiation factor TFIID subunit 12", "gene_name": "Taf12", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P47825-1", "protein_name": "Transcription initiation factor TFIID subunit 4", "gene_name": "Taf4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24325-1", "protein_name": "Transcription initiation factor TFIID subunit 2", "gene_name": "Taf2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P20227-1", "protein_name": "TATA-box-binding protein", "gene_name": "Tbp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P49906-1", "protein_name": "Transcription initiation factor TFIID subunit 11", "gene_name": "Taf11", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P49905", "url": "https://www.uniprot.org/uniprotkb/P49905" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8276241", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila takeout gene is regulated by the somatic sex-determination pathway and affects male courtship behavior.", "journal": "Genes & development", "date": "2002-11-15", "authors": "Dauwalder Brigitte, Tsujimoto Susan, Moss Jason, Mattox William", "reference": { "type": "PubMed", "id": "12435630", "url": "https://pubmed.ncbi.nlm.nih.gov/12435630" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23023-1", "protein_name": "Protein doublesex", "gene_name": "dsx", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VBV3-1", "protein_name": "Protein takeout", "gene_name": "to", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8IN81-1", "protein_name": "Sex determination protein fruitless", "gene_name": "fru", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12435630", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The doublesex proteins of Drosophila melanogaster bind directly to a sex-specific yolk protein gene enhancer.", "journal": "EMBO J.", "date": "1991", "authors": "Burtis K C, Coschigano K T, Baker B S, Wensink P C", "reference": { "type": "PubMed", "id": "1907913", "url": "https://pubmed.ncbi.nlm.nih.gov/1907913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23023-1", "protein_name": "Protein doublesex", "gene_name": "dsx", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1907913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila doublesex gene controls somatic sexual differentiation by producing alternatively spliced mRNAs encoding related sex-specific polypeptides.", "journal": "Cell", "date": "1989", "authors": "Burtis K C, Baker B S", "reference": { "type": "PubMed", "id": "2493994", "url": "https://pubmed.ncbi.nlm.nih.gov/2493994" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23023-1", "protein_name": "Protein doublesex", "gene_name": "dsx", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2493994", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila doublesex proteins share a novel zinc finger related DNA binding domain.", "journal": "The EMBO journal", "date": "1993", "authors": "Erdman SE, Burtis KC", "reference": { "type": "PubMed", "id": "8440242", "url": "https://pubmed.ncbi.nlm.nih.gov/8440242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P23023-1", "protein_name": "Protein doublesex", "gene_name": "dsx", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 47, "end_pos": 47, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" }, { "database": "PubMed", "id": "8440242", "url": "https://pubmed.ncbi.nlm.nih.gov/8440242" } ], "uniprot_canonical_ac": "P23023-1" }, { "start_pos": 47, "end_pos": 47, "sequence_org": "C", "sequence_mut": "H", "comment": "Abolishes DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" }, { "database": "PubMed", "id": "8440242", "url": "https://pubmed.ncbi.nlm.nih.gov/8440242" } ], "uniprot_canonical_ac": "P23023-1" }, { "start_pos": 50, "end_pos": 50, "sequence_org": "H", "sequence_mut": "Y", "comment": "Abolishes DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" }, { "database": "PubMed", "id": "8440242", "url": "https://pubmed.ncbi.nlm.nih.gov/8440242" } ], "uniprot_canonical_ac": "P23023-1" }, { "start_pos": 59, "end_pos": 59, "sequence_org": "H", "sequence_mut": "Y", "comment": "Abolishes DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" }, { "database": "PubMed", "id": "8440242", "url": "https://pubmed.ncbi.nlm.nih.gov/8440242" } ], "uniprot_canonical_ac": "P23023-1" }, { "start_pos": 68, "end_pos": 68, "sequence_org": "C", "sequence_mut": "D", "comment": "Abolishes DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" }, { "database": "PubMed", "id": "8440242", "url": "https://pubmed.ncbi.nlm.nih.gov/8440242" } ], "uniprot_canonical_ac": "P23023-1" }, { "start_pos": 68, "end_pos": 68, "sequence_org": "C", "sequence_mut": "Y", "comment": "Abolishes DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" }, { "database": "PubMed", "id": "8440242", "url": "https://pubmed.ncbi.nlm.nih.gov/8440242" } ], "uniprot_canonical_ac": "P23023-1" }, { "start_pos": 70, "end_pos": 70, "sequence_org": "C", "sequence_mut": "Y", "comment": "Abolishes DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" }, { "database": "PubMed", "id": "8440242", "url": "https://pubmed.ncbi.nlm.nih.gov/8440242" } ], "uniprot_canonical_ac": "P23023-1" }, { "start_pos": 91, "end_pos": 91, "sequence_org": "R", "sequence_mut": "Q", "comment": "Abolishes DNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "P23023", "url": "https://www.uniprot.org/uniprotkb/P23023" }, { "database": "PubMed", "id": "8440242", "url": "https://pubmed.ncbi.nlm.nih.gov/8440242" } ], "uniprot_canonical_ac": "P23023-1" } ], "record_id": "pubmed.8440242", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A genetic screen for modifiers of E2F in Drosophila melanogaster.", "journal": "Genetics", "date": "1999-09", "authors": "Staehling-Hampton K, Ciampa P J, Brook A, Dyson N", "reference": { "type": "PubMed", "id": "10471712", "url": "https://pubmed.ncbi.nlm.nih.gov/10471712" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IN94-1", "protein_name": "Trithorax group protein osa", "gene_name": "osa", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q8IN94", "url": "https://www.uniprot.org/uniprotkb/Q8IN94" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10471712", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Osa associates with the Brahma chromatin remodeling complex and promotes the activation of some target genes.", "journal": "EMBO J.", "date": "1999", "authors": "Collins R T, Furukawa T, Tanese N, Treisman J E", "reference": { "type": "PubMed", "id": "10601025", "url": "https://pubmed.ncbi.nlm.nih.gov/10601025" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IN94-1", "protein_name": "Trithorax group protein osa", "gene_name": "osa", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P25439-1", "protein_name": "Brahma chromatin-remodeling complex ATPase subunit", "gene_name": "brm", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q8IN94", "url": "https://www.uniprot.org/uniprotkb/Q8IN94" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10601025", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila brahma complex is an essential coactivator for the trithorax group protein zeste.", "journal": "Genes & development", "date": "2000-05-01", "authors": "Kal A J, Mahmoudi T, Zak N B, Verrijzer C P", "reference": { "type": "PubMed", "id": "10809665", "url": "https://pubmed.ncbi.nlm.nih.gov/10809665" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IN94-1", "protein_name": "Trithorax group protein osa", "gene_name": "osa", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P25439-1", "protein_name": "Brahma chromatin-remodeling complex ATPase subunit", "gene_name": "brm", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYG2-1", "protein_name": "Brahma-associated protein of 60 kDa", "gene_name": "Bap60", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q8IN94", "url": "https://www.uniprot.org/uniprotkb/Q8IN94" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10809665", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Osa-containing Brahma chromatin remodeling complexes are required for the repression of wingless target genes.", "journal": "Genes & development", "date": "2000-12-15", "authors": "Collins R T, Treisman J E", "reference": { "type": "PubMed", "id": "11124806", "url": "https://pubmed.ncbi.nlm.nih.gov/11124806" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IN94-1", "protein_name": "Trithorax group protein osa", "gene_name": "osa", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q8IN94", "url": "https://www.uniprot.org/uniprotkb/Q8IN94" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11124806", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enhancer-promoter communication mediated by Chip during Pannier-driven proneural patterning is regulated by Osa.", "journal": "Genes & development", "date": "2003-03-01", "authors": "Heitzler Pascal, Vanolst Luc, Biryukova Inna, Ramain Philippe", "reference": { "type": "PubMed", "id": "12629041", "url": "https://pubmed.ncbi.nlm.nih.gov/12629041" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IN94-1", "protein_name": "Trithorax group protein osa", "gene_name": "osa", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P52168-1", "protein_name": "GATA-binding factor A", "gene_name": "pnr", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q8IN94", "url": "https://www.uniprot.org/uniprotkb/Q8IN94" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12629041", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "eyelid antagonizes wingless signaling during Drosophila development and has homology to the Bright family of DNA-binding proteins.", "journal": "Genes & development", "date": "1997-08-01", "authors": "Treisman J E, Luk A, Rubin G M, Heberlein U", "reference": { "type": "PubMed", "id": "9271118", "url": "https://pubmed.ncbi.nlm.nih.gov/9271118" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IN94-1", "protein_name": "Trithorax group protein osa", "gene_name": "osa", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q8IN94", "url": "https://www.uniprot.org/uniprotkb/Q8IN94" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9271118", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The trithorax group gene osa encodes an ARID-domain protein that genetically interacts with the brahma chromatin-remodeling factor to regulate transcription.", "journal": "Development (Cambridge, England)", "date": "1999-02", "authors": "V\u00e1zquez M, Moore L, Kennison J A", "reference": { "type": "PubMed", "id": "9895321", "url": "https://pubmed.ncbi.nlm.nih.gov/9895321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IN94-1", "protein_name": "Trithorax group protein osa", "gene_name": "osa", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q8IN94", "url": "https://www.uniprot.org/uniprotkb/Q8IN94" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9895321", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of a protease cascade involved in patterning the Drosophila embryo.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "LeMosy EK, Tan YQ, Hashimoto C", "reference": { "type": "PubMed", "id": "11296245", "url": "https://pubmed.ncbi.nlm.nih.gov/11296245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11296245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autoproteolysis and feedback in a protease cascade directing Drosophila dorsal-ventral cell fate.", "journal": "The EMBO journal", "date": "2001", "authors": "Dissing M, Giordano H, DeLotto R", "reference": { "type": "PubMed", "id": "11350927", "url": "https://pubmed.ncbi.nlm.nih.gov/11350927" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11350927", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A gene required for the specification of dorsal-ventral pattern in Drosophila appears to encode a serine protease.", "journal": "Nature", "date": "1986-10-23", "authors": "DeLotto R, Spierer P", "reference": { "type": "PubMed", "id": "11486795", "url": "https://pubmed.ncbi.nlm.nih.gov/11486795" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11486795", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gastrulation defective, a complement factor C2/B-like protease, interprets a ventral prepattern in Drosophila.", "journal": "EMBO reports", "date": "2001", "authors": "DeLotto R", "reference": { "type": "PubMed", "id": "11493599", "url": "https://pubmed.ncbi.nlm.nih.gov/11493599" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11493599", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three-dimensional models of proteases involved in patterning of the Drosophila Embryo. Crucial role of predicted cation binding sites.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Rose T, LeMosy EK, Cantwell AM, Banerjee-Roy D, Skeath JB, Di Cera E", "reference": { "type": "PubMed", "id": "12493753", "url": "https://pubmed.ncbi.nlm.nih.gov/12493753" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 193, "end_pos": 193, "sequence_org": "E", "sequence_mut": "A", "comment": "Probable loss of calcium binding which might affect catalytic activity. Results in defective dorsoventral patterning showing a complete dorsalization in which there is no ventral furrow or headfold, cells at the posterior do not migrate, and multiple symmetric folds appear along the anterior-posterior axis of the embryo.", "evidence": [ { "database": "UniProtKB", "id": "P13582", "url": "https://www.uniprot.org/uniprotkb/P13582" }, { "database": "PubMed", "id": "12493753", "url": "https://pubmed.ncbi.nlm.nih.gov/12493753" } ], "uniprot_canonical_ac": "P13582-1" }, { "start_pos": 193, "end_pos": 193, "sequence_org": "E", "sequence_mut": "K", "comment": "Probable loss of calcium binding which might affect catalytic activity. Results in defective dorsoventral patterning showing a complete dorsalization in which there is no ventral furrow or headfold, cells at the posterior do not migrate, and multiple symmetric folds appear along the anterior-posterior axis of the embryo.", "evidence": [ { "database": "UniProtKB", "id": "P13582", "url": "https://www.uniprot.org/uniprotkb/P13582" }, { "database": "PubMed", "id": "12493753", "url": "https://pubmed.ncbi.nlm.nih.gov/12493753" } ], "uniprot_canonical_ac": "P13582-1" }, { "start_pos": 338, "end_pos": 338, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of catalytic activity results in defective dorsoventral patterning characterized by a complete dorsalization in which there is no ventral furrow or headfold, cells at the posterior do not migrate, and multiple symmetric folds appear along the anterior-posterior axis of the embryo.", "evidence": [ { "database": "UniProtKB", "id": "P13582", "url": "https://www.uniprot.org/uniprotkb/P13582" }, { "database": "PubMed", "id": "12493753", "url": "https://pubmed.ncbi.nlm.nih.gov/12493753" }, { "database": "PubMed", "id": "2107028", "url": "https://pubmed.ncbi.nlm.nih.gov/2107028" }, { "database": "PubMed", "id": "16566925", "url": "https://pubmed.ncbi.nlm.nih.gov/16566925" } ], "uniprot_canonical_ac": "P13582-1" }, { "start_pos": 373, "end_pos": 373, "sequence_org": "P", "sequence_mut": "I", "comment": "Probable loss of catalytic activity results in partially defective dorsoventral patterning; during gastrulation, shows defective ventralization; in late embryogenesis results in moderately dorsalized embryos presenting defective lateral filzkorper, head skeleton and ventral denticles.", "evidence": [ { "database": "UniProtKB", "id": "P13582", "url": "https://www.uniprot.org/uniprotkb/P13582" }, { "database": "PubMed", "id": "12493753", "url": "https://pubmed.ncbi.nlm.nih.gov/12493753" } ], "uniprot_canonical_ac": "P13582-1" }, { "start_pos": 373, "end_pos": 373, "sequence_org": "P", "sequence_mut": "S", "comment": "In EA 5022; probable loss of catalytic activity results in partially defective dorsoventral patterning; in gastrulation, shows an intermediate ventralization with the headfold prominent on the dorsal side and some anteriorward displacement of posterior cells along the dorsal site; in late embryogenesis, shows partial filzkorper and head skeleton, as well as ventral denticles erroneously in dorsal position.", "evidence": [ { "database": "UniProtKB", "id": "P13582", "url": "https://www.uniprot.org/uniprotkb/P13582" }, { "database": "PubMed", "id": "12493753", "url": "https://pubmed.ncbi.nlm.nih.gov/12493753" }, { "database": "PubMed", "id": "2107028", "url": "https://pubmed.ncbi.nlm.nih.gov/2107028" } ], "uniprot_canonical_ac": "P13582-1" }, { "start_pos": 373, "end_pos": 373, "sequence_org": "P", "sequence_mut": "Y", "comment": "Probable loss of catalytic activity results in partially defective dorsoventral patterning; during gastrulation, shows defective ventralization; in late embryogenesis results in moderately dorsalized embryos presenting defective lateral filzkorper, head skeleton and ventral denticles.", "evidence": [ { "database": "UniProtKB", "id": "P13582", "url": "https://www.uniprot.org/uniprotkb/P13582" }, { "database": "PubMed", "id": "12493753", "url": "https://pubmed.ncbi.nlm.nih.gov/12493753" } ], "uniprot_canonical_ac": "P13582-1" }, { "start_pos": 513, "end_pos": 513, "sequence_org": "Y", "sequence_mut": "A", "comment": "Results in a defective gastrulation with excessive ventralization showing very prominent ventral furrow, no anterior displacement of posterior cells and only a small headfold on the dorsal side of the embryo.", "evidence": [ { "database": "UniProtKB", "id": "O62589", "url": "https://www.uniprot.org/uniprotkb/O62589" }, { "database": "PubMed", "id": "12493753", "url": "https://pubmed.ncbi.nlm.nih.gov/12493753" } ], "uniprot_canonical_ac": "O62589-1" }, { "start_pos": 513, "end_pos": 513, "sequence_org": "Y", "sequence_mut": "P", "comment": "Results in a defective gastrulation with excessive ventralization showing very prominent ventral furrow, no anterior displacement of posterior cells and only a small headfold on the dorsal side of the embryo.", "evidence": [ { "database": "UniProtKB", "id": "O62589", "url": "https://www.uniprot.org/uniprotkb/O62589" }, { "database": "PubMed", "id": "12493753", "url": "https://pubmed.ncbi.nlm.nih.gov/12493753" } ], "uniprot_canonical_ac": "O62589-1" } ], "record_id": "pubmed.12493753", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of the Drosophila cytokine Spatzle to Toll is direct and establishes signaling.", "journal": "Nature immunology", "date": "2003", "authors": "Weber AN, Tauszig-Delamasure S, Hoffmann JA, Lelievre E, Gascan H, Ray KP, Morse MA, Imler JL, Gay NJ", "reference": { "type": "PubMed", "id": "12872120", "url": "https://pubmed.ncbi.nlm.nih.gov/12872120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P41964-1", "protein_name": "Drosomycin", "gene_name": "Drs", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12872120", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spatial regulation of developmental signaling by a serpin.", "journal": "Developmental cell", "date": "2003", "authors": "Hashimoto C, Kim DR, Weiss LA, Miller JW, Morisato D", "reference": { "type": "PubMed", "id": "14667416", "url": "https://pubmed.ncbi.nlm.nih.gov/14667416" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.14667416", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulated assembly of the Toll signaling complex drives Drosophila dorsoventral patterning.", "journal": "The EMBO journal", "date": "2004", "authors": "Sun H, Towb P, Chiem DN, Foster BA, Wasserman SA", "reference": { "type": "PubMed", "id": "14685264", "url": "https://pubmed.ncbi.nlm.nih.gov/14685264" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VJN5-1", "protein_name": "Zinc finger protein weckle", "gene_name": "wek", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q05652-1", "protein_name": "Serine/threonine-protein kinase pelle", "gene_name": "pll", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.14685264", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multimerization and interaction of Toll and Spatzle in Drosophila.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Hu X, Yagi Y, Tanji T, Zhou S, Ip YT", "reference": { "type": "PubMed", "id": "15197269", "url": "https://pubmed.ncbi.nlm.nih.gov/15197269" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15197269", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ligand-receptor and receptor-receptor interactions act in concert to activate signaling in the Drosophila toll pathway.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Weber AN, Moncrieffe MC, Gangloff M, Imler JL, Gay NJ", "reference": { "type": "PubMed", "id": "15795223", "url": "https://pubmed.ncbi.nlm.nih.gov/15795223" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15795223", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Spatzle-processing enzyme required for toll signaling activation in Drosophila innate immunity.", "journal": "Developmental cell", "date": "2006", "authors": "Jang IH, Chosa N, Kim SH, Nam HJ, Lemaitre B, Ochiai M, Kambris Z, Brun S, Hashimoto C, Ashida M, Brey PT, Lee WJ", "reference": { "type": "PubMed", "id": "16399077", "url": "https://pubmed.ncbi.nlm.nih.gov/16399077" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NHB0-1", "protein_name": "Gram-negative bacteria-binding protein 1", "gene_name": "GNBP1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VWU1-1", "protein_name": "Serine protease persephone", "gene_name": "psh", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYX7-1", "protein_name": "Peptidoglycan-recognition protein SA", "gene_name": "PGRP-SA", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 134, "end_pos": 134, "sequence_org": "R", "sequence_mut": "A", "comment": "Inhibits zymogen cleavage and thus activation and spz processing.", "evidence": [ { "database": "UniProtKB", "id": "Q9VCJ8", "url": "https://www.uniprot.org/uniprotkb/Q9VCJ8" }, { "database": "PubMed", "id": "16399077", "url": "https://pubmed.ncbi.nlm.nih.gov/16399077" } ], "uniprot_canonical_ac": "Q9VCJ8-1" }, { "start_pos": 220, "end_pos": 221, "sequence_org": "RV", "sequence_mut": "LN", "comment": "Not cleaved when expressed with activated SPE.", "evidence": [ { "database": "UniProtKB", "id": "P48607", "url": "https://www.uniprot.org/uniprotkb/P48607" }, { "database": "PubMed", "id": "16399077", "url": "https://pubmed.ncbi.nlm.nih.gov/16399077" } ], "uniprot_canonical_ac": "P48607-1" }, { "start_pos": 187, "end_pos": 187, "sequence_org": "H", "sequence_mut": "Y", "comment": "In psh1 and psh4; immune response defective. Reduced levels of Drs following immune challenge with fungal or bacterial proteases.", "evidence": [ { "database": "UniProtKB", "id": "Q9VWU1", "url": "https://www.uniprot.org/uniprotkb/Q9VWU1" }, { "database": "PubMed", "id": "12098703", "url": "https://pubmed.ncbi.nlm.nih.gov/12098703" }, { "database": "PubMed", "id": "21576362", "url": "https://pubmed.ncbi.nlm.nih.gov/21576362" }, { "database": "PubMed", "id": "18724373", "url": "https://pubmed.ncbi.nlm.nih.gov/18724373" }, { "database": "PubMed", "id": "16399077", "url": "https://pubmed.ncbi.nlm.nih.gov/16399077" } ], "uniprot_canonical_ac": "Q9VWU1-1" } ], "record_id": "pubmed.16399077", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and regulation of Spatzle-processing enzyme in Drosophila.", "journal": "FEBS letters", "date": "2006", "authors": "Mulinari S, Hacker U, Castillejo-Lopez C", "reference": { "type": "PubMed", "id": "16996061", "url": "https://pubmed.ncbi.nlm.nih.gov/16996061" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16996061", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of the Spatzle Pro-domain in the generation of an active toll receptor ligand.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Weber AN, Gangloff M, Moncrieffe MC, Hyvert Y, Imler JL, Gay NJ", "reference": { "type": "PubMed", "id": "17324925", "url": "https://pubmed.ncbi.nlm.nih.gov/17324925" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17324925", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insight into the mechanism of activation of the Toll receptor by the dimeric ligand Spatzle.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Gangloff M, Murali A, Xiong J, Arnot CJ, Weber AN, Sandercock AM, Robinson CV, Sarisky R, Holzenburg A, Kao C, Gay NJ", "reference": { "type": "PubMed", "id": "18347020", "url": "https://pubmed.ncbi.nlm.nih.gov/18347020" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18347020", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pipe-dependent ventral processing of Easter by Snake is the defining step in Drosophila embryo DV axis formation.", "journal": "Current biology : CB", "date": "2010-06-22", "authors": "Cho Yong Suk, Stevens Leslie M, Stein David", "reference": { "type": "PubMed", "id": "20605458", "url": "https://pubmed.ncbi.nlm.nih.gov/20605458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P98159-1", "protein_name": "Serine protease ndl", "gene_name": "ndl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q86BJ3-1", "protein_name": "Uronyl 2-sulfotransferase homolog pip", "gene_name": "pip", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 184, "end_pos": 184, "sequence_org": "P", "sequence_mut": "L", "comment": "Blocks cleavage by gd.", "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" }, { "database": "PubMed", "id": "20605458", "url": "https://pubmed.ncbi.nlm.nih.gov/20605458" } ], "uniprot_canonical_ac": "P05049-1" } ], "record_id": "pubmed.20605458", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A processed form of the Spatzle protein defines dorsal-ventral polarity in the Drosophila embryo.", "journal": "Development (Cambridge, England)", "date": "1994", "authors": "Schneider DS, Jin Y, Morisato D, Anderson KV", "reference": { "type": "PubMed", "id": "8026333", "url": "https://pubmed.ncbi.nlm.nih.gov/8026333" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8026333", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Positive and negative regulation of Easter, a member of the serine protease family that controls dorsal-ventral patterning in the Drosophila embryo.", "journal": "Development", "date": "1998", "authors": "Misra S, Hecht P, Maeda R, Anderson KV", "reference": { "type": "PubMed", "id": "9477324", "url": "https://pubmed.ncbi.nlm.nih.gov/9477324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P98159-1", "protein_name": "Serine protease ndl", "gene_name": "ndl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9477324", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteolytic processing of the Drosophila Spatzle protein by easter generates a dimeric NGF-like molecule with ventralising activity.", "journal": "Mechanisms of development", "date": "1998", "authors": "DeLotto Y, DeLotto R", "reference": { "type": "PubMed", "id": "9533958", "url": "https://pubmed.ncbi.nlm.nih.gov/9533958" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P05049-1", "protein_name": "Serine protease snk", "gene_name": "snk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P08953-1", "protein_name": "Protein toll", "gene_name": "Tl", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V3N1-1", "protein_name": "Serine protease inhibitor 27A", "gene_name": "Spn27A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VCJ8-1", "protein_name": "Spaetzle-processing enzyme", "gene_name": "SPE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13582-1", "protein_name": "Serine protease ea", "gene_name": "ea", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62589-1", "protein_name": "Serine protease gd", "gene_name": "gd", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22812-1", "protein_name": "Protein Tube", "gene_name": "tub", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48607-1", "protein_name": "Protein spaetzle", "gene_name": "spz", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P05049", "url": "https://www.uniprot.org/uniprotkb/P05049" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 318, "end_pos": 318, "sequence_org": "C", "sequence_mut": "S", "comment": "Reduced phenotypic rescue of a mutant.", "evidence": [ { "database": "UniProtKB", "id": "P48607", "url": "https://www.uniprot.org/uniprotkb/P48607" }, { "database": "PubMed", "id": "9533958", "url": "https://pubmed.ncbi.nlm.nih.gov/9533958" } ], "uniprot_canonical_ac": "P48607-1" }, { "start_pos": 318, "end_pos": 318, "sequence_org": "C", "sequence_mut": "T", "comment": "Reduced phenotypic rescue of a mutant.", "evidence": [ { "database": "UniProtKB", "id": "P48607", "url": "https://www.uniprot.org/uniprotkb/P48607" }, { "database": "PubMed", "id": "9533958", "url": "https://pubmed.ncbi.nlm.nih.gov/9533958" } ], "uniprot_canonical_ac": "P48607-1" } ], "record_id": "pubmed.9533958", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intrinsic negative cell cycle regulation provided by PIP box- and Cul4Cdt2-mediated destruction of E2f1 during S phase.", "journal": "Developmental cell", "date": "2008", "authors": "Shibutani ST, de la Cruz AF, Tran V, Turbyfill WJ 3rd, Reis T, Edgar BA, Duronio RJ", "reference": { "type": "PubMed", "id": "19081076", "url": "https://pubmed.ncbi.nlm.nih.gov/19081076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q27368-1", "protein_name": "Transcription factor E2f1", "gene_name": "E2f1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P17917-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24371-1", "protein_name": "Protein lethal(2)denticleless", "gene_name": "l(2)dtl", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q27368", "url": "https://www.uniprot.org/uniprotkb/Q27368" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.19081076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional conservation of the cell cycle-regulating transcription factor DRTF1/E2F and its pathway of control in Drosophila melanogaster.", "journal": "J. Cell Sci.", "date": "1995", "authors": "Hao X F, Alphey L, Bandara L R, Lam E W, Glover D, La Thangue N B", "reference": { "type": "PubMed", "id": "8537434", "url": "https://pubmed.ncbi.nlm.nih.gov/8537434" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q27368-1", "protein_name": "Transcription factor E2f1", "gene_name": "E2f1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q27368", "url": "https://www.uniprot.org/uniprotkb/Q27368" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8537434", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations of the Drosophila dDP, dE2F, and cyclin E genes reveal distinct roles for the E2F-DP transcription factor and cyclin E during the G1-S transition.", "journal": "Molecular and cellular biology", "date": "1998-01", "authors": "Duronio R J, Bonnette P C, O'Farrell P H", "reference": { "type": "PubMed", "id": "9418862", "url": "https://pubmed.ncbi.nlm.nih.gov/9418862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q27368-1", "protein_name": "Transcription factor E2f1", "gene_name": "E2f1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q27368", "url": "https://www.uniprot.org/uniprotkb/Q27368" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9418862", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Specification of regions of DNA replication initiation during embryogenesis in the 65-kilobase DNApolalpha-dE2F locus of Drosophila melanogaster.", "journal": "Mol. Cell. Biol.", "date": "1999", "authors": "Sasaki T, Sawado T, Yamaguchi M, Shinomiya T", "reference": { "type": "PubMed", "id": "9858578", "url": "https://pubmed.ncbi.nlm.nih.gov/9858578" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q27368-1", "protein_name": "Transcription factor E2f1", "gene_name": "E2f1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P26019-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "PolA1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q27368", "url": "https://www.uniprot.org/uniprotkb/Q27368" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9858578", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two genes become one: the genes encoding heterochromatin protein Su(var)3-9 and translation initiation factor subunit eIF-2gamma are joined to a dicistronic unit in holometabolic insects.", "journal": "Genetics", "date": "2000", "authors": "Krauss V, Reuter G", "reference": { "type": "PubMed", "id": "11063691", "url": "https://pubmed.ncbi.nlm.nih.gov/11063691" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q24208-1", "protein_name": "Eukaryotic translation initiation factor 2 subunit 3", "gene_name": "eIF2gamma", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P45975-1", "protein_name": "Histone-lysine N-methyltransferase Su(var)3-9", "gene_name": "Su(var)3-9", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q24208", "url": "https://www.uniprot.org/uniprotkb/Q24208" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11063691", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein encoded by the Drosophila position-effect variegation suppressor gene Su(var)3-9 combines domains of antagonistic regulators of homeotic gene complexes.", "journal": "EMBO J.", "date": "1994", "authors": "Tschiersch B, Hofmann A, Krauss V, Dorn R, Korge G, Reuter G", "reference": { "type": "PubMed", "id": "7915232", "url": "https://pubmed.ncbi.nlm.nih.gov/7915232" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q24208-1", "protein_name": "Eukaryotic translation initiation factor 2 subunit 3", "gene_name": "eIF2gamma", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P45975-1", "protein_name": "Histone-lysine N-methyltransferase Su(var)3-9", "gene_name": "Su(var)3-9", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q24208", "url": "https://www.uniprot.org/uniprotkb/Q24208" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7915232", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homeo box genes of the Antennapedia and bithorax complexes of Drosophila.", "journal": "Cell", "date": "1985", "authors": "Regulski M, Harding K, Kostriken R, Karch F, Levine M, McGinnis W", "reference": { "type": "PubMed", "id": "2416463", "url": "https://pubmed.ncbi.nlm.nih.gov/2416463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09087-1", "protein_name": "Homeobox protein abdominal-B", "gene_name": "Abd-B", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P02833-1", "protein_name": "Homeotic protein antennapedia", "gene_name": "Antp", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P07548-1", "protein_name": "Homeotic protein deformed", "gene_name": "Dfd", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P09087", "url": "https://www.uniprot.org/uniprotkb/P09087" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2416463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The morphogenetic and regulatory functions of the Drosophila Abdominal-B gene are encoded in overlapping RNAs transcribed from separate promoters.", "journal": "Genes Dev.", "date": "1989", "authors": "Zavortink M, Sakonju S", "reference": { "type": "PubMed", "id": "2482824", "url": "https://pubmed.ncbi.nlm.nih.gov/2482824" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09087-1", "protein_name": "Homeobox protein abdominal-B", "gene_name": "Abd-B", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P09087", "url": "https://www.uniprot.org/uniprotkb/P09087" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2482824", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The molecular genetics of the bithorax complex of Drosophila: characterization of the products of the Abdominal-B domain.", "journal": "Genes Dev.", "date": "1989", "authors": "Celniker S E, Keelan D J, Lewis E B", "reference": { "type": "PubMed", "id": "2575066", "url": "https://pubmed.ncbi.nlm.nih.gov/2575066" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09087-1", "protein_name": "Homeobox protein abdominal-B", "gene_name": "Abd-B", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P09087", "url": "https://www.uniprot.org/uniprotkb/P09087" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2575066", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence that the Abdominal-B r element function is conferred by a trans-regulatory homeoprotein.", "journal": "EMBO J.", "date": "1988", "authors": "DeLorenzi M, Ali N, Saari G, Henry C, Wilcox M, Bienz M", "reference": { "type": "PubMed", "id": "2903049", "url": "https://pubmed.ncbi.nlm.nih.gov/2903049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09087-1", "protein_name": "Homeobox protein abdominal-B", "gene_name": "Abd-B", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P50245-1", "protein_name": "Adenosylhomocysteinase-like 2", "gene_name": "AhcyL2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P09087", "url": "https://www.uniprot.org/uniprotkb/P09087" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2903049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Different transcripts of the Drosophila Abd-B gene correlate with distinct genetic sub-functions.", "journal": "EMBO J.", "date": "1988", "authors": "Kuziora M A, McGinnis W", "reference": { "type": "PubMed", "id": "2903050", "url": "https://pubmed.ncbi.nlm.nih.gov/2903050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09087-1", "protein_name": "Homeobox protein abdominal-B", "gene_name": "Abd-B", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P09087", "url": "https://www.uniprot.org/uniprotkb/P09087" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2903050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complete sequence of the bithorax complex of Drosophila.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Martin C H, Mayeda C A, Davis C A, Ericsson C L, Knafels J D, Mathog D R, Celniker S E, Lewis E B, Palazzolo M J", "reference": { "type": "PubMed", "id": "7667301", "url": "https://pubmed.ncbi.nlm.nih.gov/7667301" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09087-1", "protein_name": "Homeobox protein abdominal-B", "gene_name": "Abd-B", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48605-1", "protein_name": "T-complex protein 1 subunit gamma", "gene_name": "CCT3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P29555-1", "protein_name": "Homeobox protein abdominal-A", "gene_name": "abd-A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P50245-1", "protein_name": "Adenosylhomocysteinase-like 2", "gene_name": "AhcyL2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P53403-1", "protein_name": "Glucose transporter type 3", "gene_name": "Glut3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P83949-1", "protein_name": "Homeotic protein ultrabithorax", "gene_name": "Ubx", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P09087", "url": "https://www.uniprot.org/uniprotkb/P09087" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7667301", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peptidomics of the larval Drosophila melanogaster central nervous system.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Baggerman G, Cerstiaens A, De Loof A, Schoofs L", "reference": { "type": "PubMed", "id": "12171930", "url": "https://pubmed.ncbi.nlm.nih.gov/12171930" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61849-1", "protein_name": "Dromyosuppressin", "gene_name": "Ms", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P61855-1", "protein_name": "Adipokinetic hormone", "gene_name": "Akh", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P81829-1", "protein_name": "Leucokinin", "gene_name": "Lk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q26377-1", "protein_name": "Pro-corazonin", "gene_name": "Crz", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VIQ0-1", "protein_name": "Short neuropeptide F", "gene_name": "sNPF", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VVF7-1", "protein_name": "Allatostatins MIP", "gene_name": "Mip", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O77150-1", "protein_name": "Bomanin Short 2", "gene_name": "BomS2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P09040-1", "protein_name": "Drosulfakinins", "gene_name": "Dsk", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P10552-1", "protein_name": "FMRFamide-related peptides", "gene_name": "FMRFa", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P82705-1", "protein_name": "Daisho1", "gene_name": "Dso1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NIP6-1", "protein_name": "Cardio acceleratory peptide 2b", "gene_name": "Capa", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VC44-1", "protein_name": "Allatostatin-A", "gene_name": "AstA", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VG55-1", "protein_name": "Protein hugin", "gene_name": "Hug", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VU58-1", "protein_name": "Neuropeptide-like 2", "gene_name": "Nplp2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W0W6-1", "protein_name": "Neuropeptide-like 1", "gene_name": "Nplp1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VQ66-1", "protein_name": "Neuropeptide-like 4", "gene_name": "Nplp4", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VV28-1", "protein_name": "Neuropeptide-like 3", "gene_name": "Nplp3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P61849", "url": "https://www.uniprot.org/uniprotkb/P61849" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12171930", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and structural characterization of Drosophila TDVDHVFLRFamide and FMRFamide-containing neural peptides.", "journal": "J. Mol. Neurosci.", "date": "1992", "authors": "Nichols R", "reference": { "type": "PubMed", "id": "1390001", "url": "https://pubmed.ncbi.nlm.nih.gov/1390001" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P61849-1", "protein_name": "Dromyosuppressin", "gene_name": "Ms", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P10552-1", "protein_name": "FMRFamide-related peptides", "gene_name": "FMRFa", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P61849", "url": "https://www.uniprot.org/uniprotkb/P61849" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1390001", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]