[ { "title": "Effects of estrogen on global gene expression: identification of novel targets of estrogen action.", "journal": "Cancer Res.", "date": "2000", "authors": "Charpentier A H, Bednarek A K, Daniel R L, Hawkins K A, Laflin K J, Gaddis S, MacLeod M C, Aldaz C M", "reference": { "type": "PubMed", "id": "11085516", "url": "https://pubmed.ncbi.nlm.nih.gov/11085516" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NYJ1-1", "protein_name": "Cytochrome c oxidase assembly factor 4 homolog, mitochondrial", "gene_name": "COA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVP2-1", "protein_name": "Guanine nucleotide-binding protein-like 3", "gene_name": "GNL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJY1-1", "protein_name": "Heat shock protein beta-8", "gene_name": "HSPB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WUA8-1", "protein_name": "Tsukushi", "gene_name": "TSKU", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A26-1", "protein_name": "Protein FAM162A", "gene_name": "FAM162A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NYJ1", "url": "https://www.uniprot.org/uniprotkb/Q9NYJ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11085516", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the bovine kidney microsomal chloride channel p64 by p59fyn, a Src family tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "2000-10-13", "authors": "Edwards J C, Kapadia S", "reference": { "type": "PubMed", "id": "10930415", "url": "https://pubmed.ncbi.nlm.nih.gov/10930415" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZA1-1", "protein_name": "Chloride intracellular channel protein 5", "gene_name": "CLIC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0JNB0-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Bovine" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZA1", "url": "https://www.uniprot.org/uniprotkb/Q9NZA1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 33, "end_pos": 33, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "IntAct", "id": "Q9NZA1", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q9NZA1*" }, { "database": "iPTMnet", "id": "Q9NZA1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9NZA1" }, { "database": "PubMed", "id": "10930415", "url": "https://pubmed.ncbi.nlm.nih.gov/10930415" } ], "site_lbl": "Tyr33", "uniprot_canonical_ac": "Q9NZA1-1" } ], "record_id": "pubmed.10930415", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CLIC-5A functions as a chloride channel in vitro and associates with the cortical actin cytoskeleton in vitro and in vivo.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Berryman M, Bruno J, Price J, Edwards JC", "reference": { "type": "PubMed", "id": "15184393", "url": "https://pubmed.ncbi.nlm.nih.gov/15184393" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZA1-1", "protein_name": "Chloride intracellular channel protein 5", "gene_name": "CLIC5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZA1", "url": "https://www.uniprot.org/uniprotkb/Q9NZA1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15184393", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional reconstitution of mammalian 'chloride intracellular channels' CLIC1, CLIC4 and CLIC5 reveals differential regulation by cytoskeletal actin.", "journal": "The FEBS journal", "date": "2007-12", "authors": "Singh H, Cousin M A, Ashley R H", "reference": { "type": "PubMed", "id": "18028448", "url": "https://pubmed.ncbi.nlm.nih.gov/18028448" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZA1-1", "protein_name": "Chloride intracellular channel protein 5", "gene_name": "CLIC5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZA1", "url": "https://www.uniprot.org/uniprotkb/Q9NZA1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18028448", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Progressive hearing loss and vestibular dysfunction caused by a homozygous nonsense mutation in CLIC5.", "journal": "European journal of human genetics : EJHG", "date": "2015-02", "authors": "Seco Celia Zazo, Oonk Anne M M, Dom\u00ednguez-Ruiz Mar\u00eda, Draaisma Jos M T, Gand\u00eda Marta, Oostrik Jaap, Neveling Kornelia, Kunst Henricus P M, Hoefsloot Lies H, del Castillo Ignacio, Pennings Ronald J E, Kremer Hannie, Admiraal Ronald J C, Schraders Margit", "reference": { "type": "PubMed", "id": "24781754", "url": "https://pubmed.ncbi.nlm.nih.gov/24781754" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZA1-1", "protein_name": "Chloride intracellular channel protein 5", "gene_name": "CLIC5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZA1", "url": "https://www.uniprot.org/uniprotkb/Q9NZA1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24781754", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bi-Allelic Novel Variants in CLIC5 Identified in a Cameroonian Multiplex Family with Non-Syndromic Hearing Impairment.", "journal": "Genes", "date": "2020", "authors": "Wonkam-Tingang E, Schrauwen I, Esoh KK, Bharadwaj T, Nouel-Saied LM, Acharya A, Nasir A, Adadey SM, Mowla S, Leal SM, Wonkam A", "reference": { "type": "PubMed", "id": "33114113", "url": "https://pubmed.ncbi.nlm.nih.gov/33114113" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZA1-1", "protein_name": "Chloride intracellular channel protein 5", "gene_name": "CLIC5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZA1", "url": "https://www.uniprot.org/uniprotkb/Q9NZA1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33114113", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A comprehensively prognostic and immunological analysis of chloride intracellular channel protein 5 (CLIC5) in pan-cancer and identification in ovarian cancer.", "journal": "Journal of cancer research and clinical oncology", "date": "2023-09", "authors": "Huang Qiaoling, Lv Quankun, Tang Waner, Pan Yuhua, Xing Yue, He Min, Wu Huiyi, Huang Jiamin, Huang Che, Lan Haifeng, Chen Jingqi, Xiao Guohong", "reference": { "type": "PubMed", "id": "37286734", "url": "https://pubmed.ncbi.nlm.nih.gov/37286734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NZA1-1", "protein_name": "Chloride intracellular channel protein 5", "gene_name": "CLIC5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NZA1", "url": "https://www.uniprot.org/uniprotkb/Q9NZA1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37286734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Computational EST database analysis identifies a novel member of the neuropoietic cytokine family.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Shi Y, Wang W, Yourey PA, Gohari S, Zukauskas D, Zhang J, Ruben S, Alderson RF", "reference": { "type": "PubMed", "id": "10448081", "url": "https://pubmed.ncbi.nlm.nih.gov/10448081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10448081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel neurotrophin-1/B cell-stimulating factor-3: a cytokine of the IL-6 family.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999-09-28", "authors": "Senaldi G, Varnum B C, Sarmiento U, Starnes C, Lile J, Scully S, Guo J, Elliott G, McNinch J, Shaklee C L, Freeman D, Manu F, Simonet W S, Boone T, Chang M S", "reference": { "type": "PubMed", "id": "10500198", "url": "https://pubmed.ncbi.nlm.nih.gov/10500198" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QZM3-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "Clcf1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10500198", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Contributions of leukemia inhibitory factor receptor and oncostatin M receptor to signal transduction in heterodimeric complexes with glycoprotein 130.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1999", "authors": "Hermanns HM, Radtke S, Haan C, Schmitz-Van de Leur H, Tavernier J, Heinrich PC, Behrmann I", "reference": { "type": "PubMed", "id": "10586060", "url": "https://pubmed.ncbi.nlm.nih.gov/10586060" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10586060", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ciliary neurotrophic factor and its receptor, CNTFR alpha.", "journal": "Pharmaceutica acta Helvetiae", "date": "2000", "authors": "Sleeman MW, Anderson KD, Lambert PD, Yancopoulos GD, Wiegand SJ", "reference": { "type": "PubMed", "id": "10812968", "url": "https://pubmed.ncbi.nlm.nih.gov/10812968" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10812968", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CLF associates with CLC to form a functional heteromeric ligand for the CNTF receptor complex.", "journal": "Nature neuroscience", "date": "2000", "authors": "Elson GC, Lelievre E, Guillet C, Chevalier S, Plun-Favreau H, Froger J, Suard I, de Coignac AB, Delneste Y, Bonnefoy JY, Gauchat JF, Gascan H", "reference": { "type": "PubMed", "id": "10966616", "url": "https://pubmed.ncbi.nlm.nih.gov/10966616" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10966616", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ciliary neurotrophic factor receptor alpha component induces the secretion of and is required for functional responses to cardiotrophin-like cytokine.", "journal": "The EMBO journal", "date": "2001", "authors": "Plun-Favreau H, Elson G, Chabbert M, Froger J, deLapeyriere O, Lelievre E, Guillet C, Hermann J, Gauchat JF, Gascan H, Chevalier S", "reference": { "type": "PubMed", "id": "11285233", "url": "https://pubmed.ncbi.nlm.nih.gov/11285233" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11285233", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Signaling pathways recruited by the cardiotrophin-like cytokine/cytokine-like factor-1 composite cytokine: specific requirement of the membrane-bound form of ciliary neurotrophic factor receptor alpha component.", "journal": "The Journal of biological chemistry", "date": "2001-06-22", "authors": "Leli\u00e8vre E, Plun-Favreau H, Chevalier S, Froger J, Guillet C, Elson G C, Gauchat J F, Gascan H", "reference": { "type": "PubMed", "id": "11294841", "url": "https://pubmed.ncbi.nlm.nih.gov/11294841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11294841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cardiotrophin-1 stimulation of cardiac fibroblast growth: roles for glycoprotein 130/leukemia inhibitory factor receptor and the endothelin type A receptor.", "journal": "Circulation research", "date": "2002", "authors": "Tsuruda T, Jougasaki M, Boerrigter G, Huntley BK, Chen HH, D'Assoro AB, Lee SC, Larsen AM, Cataliotti A, Burnett JC Jr", "reference": { "type": "PubMed", "id": "11834704", "url": "https://pubmed.ncbi.nlm.nih.gov/11834704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11834704", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Membrane distal cytokine binding domain of LIFR interacts with soluble CNTFR in vitro.", "journal": "FEBS letters", "date": "2002", "authors": "He W, Gong K, Zhu G, Smith DK, Ip NY", "reference": { "type": "PubMed", "id": "11943154", "url": "https://pubmed.ncbi.nlm.nih.gov/11943154" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11943154", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the immunoglobulin-like domain of gp190, the leukemia inhibitory factor (LIF) receptor, increase or decrease its affinity for LIF.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bitard J, Daburon S, Duplomb L, Blanchard F, Vuisio P, Jacques Y, Godard A, Heath JK, Moreau JF, Taupin JL", "reference": { "type": "PubMed", "id": "12601009", "url": "https://pubmed.ncbi.nlm.nih.gov/12601009" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12601009", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Solution structure of the C-terminal domain of the ciliary neurotrophic factor (CNTF) receptor and ligand free associations among components of the CNTF receptor complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Man D, He W, Sze KH, Gong K, Smith DK, Zhu G, Ip NY", "reference": { "type": "PubMed", "id": "12707266", "url": "https://pubmed.ncbi.nlm.nih.gov/12707266" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12707266", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oncostatin M, a multifunctional cytokine.", "journal": "Reviews of physiology, biochemistry and pharmacology", "date": "2003", "authors": "Tanaka M, Miyajima A", "reference": { "type": "PubMed", "id": "12811586", "url": "https://pubmed.ncbi.nlm.nih.gov/12811586" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12811586", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel neurotrophin-1/B cell-stimulating factor-3 (NNT-1/BSF-3)/cardiotrophin-like cytokine (CLC)--a novel gp130 cytokine with pleiotropic functions.", "journal": "Cytokine & growth factor reviews", "date": "2004", "authors": "Vlotides G, Zitzmann K, Stalla GK, Auernhammer CJ", "reference": { "type": "PubMed", "id": "15450249", "url": "https://pubmed.ncbi.nlm.nih.gov/15450249" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15450249", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LIF receptor signaling modulates neural stem cell renewal.", "journal": "Molecular and cellular neurosciences", "date": "2004", "authors": "Pitman M, Emery B, Binder M, Wang S, Butzkueven H, Kilpatrick TJ", "reference": { "type": "PubMed", "id": "15519241", "url": "https://pubmed.ncbi.nlm.nih.gov/15519241" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15519241", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The N-terminal cytokine binding domain of LIFR is required for CNTF binding and signaling.", "journal": "FEBS letters", "date": "2005", "authors": "He W, Gong K, Smith DK, Ip NY", "reference": { "type": "PubMed", "id": "16051226", "url": "https://pubmed.ncbi.nlm.nih.gov/16051226" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16051226", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivation of cardiotrophin-like cytokine, a second ligand for ciliary neurotrophic factor receptor, leads to cold-induced sweating syndrome in a patient.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Rousseau F, Gauchat JF, McLeod JG, Chevalier S, Guillet C, Guilhot F, Cognet I, Froger J, Hahn AF, Knappskog PM, Gascan H, Boman H", "reference": { "type": "PubMed", "id": "16782820", "url": "https://pubmed.ncbi.nlm.nih.gov/16782820" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16782820", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular dissection of human interleukin-31-mediated signal transduction through site-directed mutagenesis.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Le Saux S, Rousseau F, Barbier F, Ravon E, Grimaud L, Danger Y, Froger J, Chevalier S, Gascan H", "reference": { "type": "PubMed", "id": "19920145", "url": "https://pubmed.ncbi.nlm.nih.gov/19920145" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19920145", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytokine-like factor 1 (CLF1): life after development?", "journal": "Cytokine", "date": "2011", "authors": "Kass DJ", "reference": { "type": "PubMed", "id": "21715184", "url": "https://pubmed.ncbi.nlm.nih.gov/21715184" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21715184", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning, sequence analysis, and functional expression of a novel growth regulator, oncostatin M.", "journal": "Molecular and cellular biology", "date": "1989", "authors": "Malik N, Kallestad JC, Gunderson NL, Austin SD, Neubauer MG, Ochs V, Marquardt H, Zarling JM, Shoyab M, Wei CM, et al.", "reference": { "type": "PubMed", "id": "2779549", "url": "https://pubmed.ncbi.nlm.nih.gov/2779549" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2779549", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cardiotrophin Like Cytokine Factor 1 (CLCF1) alleviates bone loss in osteoporosis mouse models by suppressing osteoclast differentiation through activating interferon signaling and repressing the nuclear factor-kappaB signaling pathway.", "journal": "Bone", "date": "2021", "authors": "Yokota S, Matsumae G, Shimizu T, Hasegawa T, Ebata T, Takahashi D, Heguo C, Tian Y, Alhasan H, Takahata M, Kadoya K, Terkawi MA, Iwasaki N", "reference": { "type": "PubMed", "id": "34364014", "url": "https://pubmed.ncbi.nlm.nih.gov/34364014" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34364014", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CRLF1 and CLCF1 in Development, Health and Disease.", "journal": "International journal of molecular sciences", "date": "2022", "authors": "Crisponi L, Buers I, Rutsch F", "reference": { "type": "PubMed", "id": "35055176", "url": "https://pubmed.ncbi.nlm.nih.gov/35055176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35055176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CLCF1 Is a Novel Potential Immune-Related Target With Predictive Value for Prognosis and Immunotherapy Response in Glioma.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Jiang Y, Ji Q, Long X, Wang P, Tu Z, Zhang X, Zhu X, Huang K, Li J", "reference": { "type": "PubMed", "id": "35265072", "url": "https://pubmed.ncbi.nlm.nih.gov/35265072" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35265072", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Intrahepatic paracrine signaling by cardiotrophin-like cytokine factor 1 ameliorates diet-induced NASH in mice.", "journal": "Hepatology (Baltimore, Md.)", "date": "2023-11-01", "authors": "Liu Tongyu, Wang Qiuyu, Zhou Linkang, Zhang Peng, Mi Lin, Qiu Xiaoxue, Chen Zhimin, Kuang Henry, Li Siming, Lin Jiandie D", "reference": { "type": "PubMed", "id": "35950514", "url": "https://pubmed.ncbi.nlm.nih.gov/35950514" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35950514", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insights into the assembly of gp130 family cytokine signaling complexes.", "journal": "Sci. Adv.", "date": "2023", "authors": "Zhou Yi, Stevis Panayiotis E, Cao Jing, Saotome Kei, Wu Jiaxi, Glatman Zaretsky Arielle, Haxhinasto Sokol, Yancopoulos George D, Murphy Andrew J, Sleeman Mark W, Olson William C, Franklin Matthew C", "reference": { "type": "PubMed", "id": "36930708", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8D7H&bu=0&command=select+.E:168;+center+selection;+zoom+selection" }, "start_pos": 168, "start_aa": "Asn", "end_pos": 168, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn168", "evidence": [ { "id": "O75462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75462#ptm_processing" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "8D7H", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D7H" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "O75462-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8D7H&bu=0&command=select+.E:292;+center+selection;+zoom+selection" }, "start_pos": 292, "start_aa": "Asn", "end_pos": 292, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn292", "evidence": [ { "id": "O75462", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75462#ptm_processing" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "8D7H", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D7H" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O75462-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7U7N&bu=0&command=select+.B:131;+center+selection;+zoom+selection" }, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "P40189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P40189#ptm_processing" }, { "id": "11098061", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11098061" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "39532904", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39532904" }, { "id": "8D7R", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D7R" }, { "id": "8D85", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D85" }, { "id": "8D74", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D74" }, { "id": "8D6A", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D6A" }, { "id": "8V29", "database": "PDB", "url": "https://www.rcsb.org/sequence/8V29" }, { "id": "8V2A", "database": "PDB", "url": "https://www.rcsb.org/sequence/8V2A" }, { "id": "7U7N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U7N" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P40189-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7U7N&bu=0&command=select+.B:157;+center+selection;+zoom+selection" }, "start_pos": 157, "start_aa": "Asn", "end_pos": 157, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn157", "evidence": [ { "id": "P40189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P40189#ptm_processing" }, { "id": "11098061", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11098061" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "39532904", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39532904" }, { "id": "8D7R", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D7R" }, { "id": "8D85", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D85" }, { "id": "8D74", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D74" }, { "id": "8D6A", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D6A" }, { "id": "8D82", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D82" }, { "id": "8V2A", "database": "PDB", "url": "https://www.rcsb.org/sequence/8V2A" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "7U7N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U7N" }, { "id": "8DPS", "database": "PDB", "url": "https://www.rcsb.org/structure/8DPS" }, { "id": "8DPT", "database": "PDB", "url": "https://www.rcsb.org/structure/8DPT" }, { "id": "8DPU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DPU" }, { "id": "8UPA", "database": "PDB", "url": "https://www.rcsb.org/structure/8UPA" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P40189-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8D82&bu=0&command=select+.A:227;+center+selection;+zoom+selection" }, "start_pos": 227, "start_aa": "Asn", "end_pos": 227, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn227", "evidence": [ { "id": "P40189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P40189#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "11098061", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11098061" }, { "id": "20489211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20489211" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "39532904", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39532904" }, { "id": "8D85", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D85" }, { "id": "8D82", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D82" }, { "id": "8V29", "database": "PDB", "url": "https://www.rcsb.org/sequence/8V29" }, { "id": "8V2A", "database": "PDB", "url": "https://www.rcsb.org/sequence/8V2A" }, { "id": "8UPA", "database": "PDB", "url": "https://www.rcsb.org/structure/8UPA" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P40189-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8D6A&bu=0&command=select+.A:379;+center+selection;+zoom+selection" }, "start_pos": 379, "start_aa": "Asn", "end_pos": 379, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn379", "evidence": [ { "id": "P40189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P40189#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "11098061", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11098061" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "39532904", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39532904" }, { "id": "8D7R", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D7R" }, { "id": "8D74", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D74" }, { "id": "8D6A", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D6A" }, { "id": "8D82", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D82" }, { "id": "8V29", "database": "PDB", "url": "https://www.rcsb.org/sequence/8V29" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P40189-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8D6A&bu=0&command=select+.A:383;+center+selection;+zoom+selection" }, "start_pos": 383, "start_aa": "Asn", "end_pos": 383, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn383", "evidence": [ { "id": "P40189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P40189#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "11098061", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11098061" }, { "id": "20489211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20489211" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "39532904", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39532904" }, { "id": "8D7R", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D7R" }, { "id": "8D74", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D74" }, { "id": "8D6A", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D6A" }, { "id": "8D82", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D82" }, { "id": "8V29", "database": "PDB", "url": "https://www.rcsb.org/sequence/8V29" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P40189-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8D6A&bu=0&command=select+.A:390;+center+selection;+zoom+selection" }, "start_pos": 390, "start_aa": "Asn", "end_pos": 390, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn390", "evidence": [ { "id": "P40189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P40189#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "39532904", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/39532904" }, { "id": "8D74", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D74" }, { "id": "8D6A", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D6A" }, { "id": "8D82", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D82" }, { "id": "8V29", "database": "PDB", "url": "https://www.rcsb.org/sequence/8V29" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "P40189-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 553, "start_aa": "Asn", "end_pos": 553, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn553", "evidence": [ { "id": "P40189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P40189#ptm_processing" }, { "id": "11098061", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11098061" }, { "id": "20489211", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20489211" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "8D82", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D82" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P40189-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8D82&bu=0&command=select+.A:564;+center+selection;+zoom+selection" }, "start_pos": 564, "start_aa": "Asn", "end_pos": 564, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn564", "evidence": [ { "id": "P40189", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P40189#ptm_processing" }, { "id": "11098061", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11098061" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "8D82", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D82" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P40189-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8D7R&bu=0&command=select+.B:426;+center+selection;+zoom+selection" }, "start_pos": 426, "start_aa": "Asn", "end_pos": 426, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn426", "evidence": [ { "id": "P42702", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P42702#ptm_processing" }, { "id": "18775332", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18775332" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "8D7R", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D7R" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P42702-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8D74&bu=0&command=select+.C:142;+center+selection;+zoom+selection" }, "start_pos": 142, "start_aa": "Asn", "end_pos": 142, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn142", "evidence": [ { "id": "P26992", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P26992#ptm_processing" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "8D7R", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D7R" }, { "id": "8D74", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D74" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P26992-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7U7N&bu=0&command=select+.A:76;+center+selection;+zoom+selection" }, "start_pos": 76, "start_aa": "Asn", "end_pos": 76, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn76", "evidence": [ { "id": "Q6UWB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6UWB1#ptm_processing" }, { "id": "36930708", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36930708" }, { "id": "8D85", "database": "PDB", "url": "https://www.rcsb.org/sequence/8D85" }, { "id": "7U7N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U7N" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q6UWB1-1" } ], "record_id": "pubmed.36930708", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 13 }, { "field": "n_linked_sites", "count": 13 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 13 }, { "field": "exact_n_linked_sites", "count": 13 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 13 }, { "field": "n_linked_sites", "count": 13 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 13 }, { "field": "exact_n_linked_sites", "count": 13 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of two isoforms of a receptor for the human hematopoietic cytokine interleukin-11.", "journal": "Blood", "date": "1995", "authors": "Cherel M, Sorel M, Lebeau B, Dubois S, Moreau JF, Bataille R, Minvielle S, Jacques Y", "reference": { "type": "PubMed", "id": "7670098", "url": "https://pubmed.ncbi.nlm.nih.gov/7670098" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7670098", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cardiotrophin-1. Biological activities and binding to the leukemia inhibitory factor receptor/gp130 signaling complex.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Pennica D, Shaw KJ, Swanson TA, Moore MW, Shelton DL, Zioncheck KA, Rosenthal A, Taga T, Paoni NF, Wood WI", "reference": { "type": "PubMed", "id": "7738033", "url": "https://pubmed.ncbi.nlm.nih.gov/7738033" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60753-1", "protein_name": "Cardiotrophin-1", "gene_name": "Ctf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7738033", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The tripartite CNTF receptor complex: activation and signaling involves components shared with other cytokines.", "journal": "Journal of neurobiology", "date": "1994", "authors": "Stahl N, Yancopoulos GD", "reference": { "type": "PubMed", "id": "7852997", "url": "https://pubmed.ncbi.nlm.nih.gov/7852997" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7852997", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression cloning of cardiotrophin 1, a cytokine that induces cardiac myocyte hypertrophy.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Pennica D, King KL, Shaw KJ, Luis E, Rullamas J, Luoh SM, Darbonne WC, Knutzon DS, Yen R, Chien KR, et al.", "reference": { "type": "PubMed", "id": "7862649", "url": "https://pubmed.ncbi.nlm.nih.gov/7862649" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60753-1", "protein_name": "Cardiotrophin-1", "gene_name": "Ctf1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7862649", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of a murine IL-11 receptor alpha-chain; requirement for gp130 for high affinity binding and signal transduction.", "journal": "The EMBO journal", "date": "1994", "authors": "Hilton DJ, Hilton AA, Raicevic A, Rakar S, Harrison-Smith M, Gough NM, Begley CG, Metcalf D, Nicola NA, Willson TA", "reference": { "type": "PubMed", "id": "7957045", "url": "https://pubmed.ncbi.nlm.nih.gov/7957045" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q64385-1", "protein_name": "Interleukin-11 receptor subunit alpha-1", "gene_name": "Il11ra1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7957045", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oncostatin M and leukemia inhibitory factor trigger overlapping and different signals through partially shared receptor complexes.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Thoma B, Bird TA, Friend DJ, Gearing DP, Dower SK", "reference": { "type": "PubMed", "id": "8119965", "url": "https://pubmed.ncbi.nlm.nih.gov/8119965" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8119965", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association and activation of Jak-Tyk kinases by CNTF-LIF-OSM-IL-6 beta receptor components.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Stahl N, Boulton TG, Farruggella T, Ip NY, Davis S, Witthuhn BA, Quelle FW, Silvennoinen O, Barbieri G, Pellegrini S, et al.", "reference": { "type": "PubMed", "id": "8272873", "url": "https://pubmed.ncbi.nlm.nih.gov/8272873" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08887-1", "protein_name": "Interleukin-6 receptor subunit alpha", "gene_name": "IL6R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05231-1", "protein_name": "Interleukin-6", "gene_name": "IL6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62120-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "Jak2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14543-1", "protein_name": "Suppressor of cytokine signaling 3", "gene_name": "SOCS3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52332-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "Jak1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22681-1", "protein_name": "E3 ubiquitin-protein ligase CBL", "gene_name": "CBL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8272873", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LIFR beta and gp130 as heterodimerizing signal transducers of the tripartite CNTF receptor.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Davis S, Aldrich TH, Stahl N, Pan L, Taga T, Kishimoto T, Ip NY, Yancopoulos GD", "reference": { "type": "PubMed", "id": "8390097", "url": "https://pubmed.ncbi.nlm.nih.gov/8390097" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8390097", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding interactions of leukemia inhibitory factor and ciliary neurotrophic factor with the different subunits of their high affinity receptors.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Robledo O, Auguste P, Coupey L, Praloran V, Chevalier S, Pouplard A, Gascan H", "reference": { "type": "PubMed", "id": "8627290", "url": "https://pubmed.ncbi.nlm.nih.gov/8627290" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8627290", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human IL-11 receptor requires gp130 for signalling: demonstration by molecular cloning of the receptor.", "journal": "Oncogene", "date": "1996", "authors": "Nandurkar HH, Hilton DJ, Nathan P, Willson T, Nicola N, Begley CG", "reference": { "type": "PubMed", "id": "8637716", "url": "https://pubmed.ncbi.nlm.nih.gov/8637716" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8637716", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of leukaemia inhibitory factor receptor subunits LIFR beta and gp130 in human oocytes and preimplantation embryos.", "journal": "Molecular human reproduction", "date": "1996", "authors": "van Eijk MJ, Mandelbaum J, Salat-Baroux J, Belaisch-Allart J, Plachot M, Junca AM, Mummery CL", "reference": { "type": "PubMed", "id": "9238703", "url": "https://pubmed.ncbi.nlm.nih.gov/9238703" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UBD9-1", "protein_name": "Cardiotrophin-like cytokine factor 1", "gene_name": "CLCF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6EBC2-1", "protein_name": "Interleukin-31", "gene_name": "IL31", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42702-1", "protein_name": "Leukemia inhibitory factor receptor", "gene_name": "LIFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26992-1", "protein_name": "Ciliary neurotrophic factor receptor subunit alpha", "gene_name": "CNTFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99650-1", "protein_name": "Oncostatin-M-specific receptor subunit beta", "gene_name": "OSMR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13725-1", "protein_name": "Oncostatin-M", "gene_name": "OSM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15018-1", "protein_name": "Leukemia inhibitory factor", "gene_name": "LIF", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16619-1", "protein_name": "Cardiotrophin-1", "gene_name": "CTF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20809-1", "protein_name": "Interleukin-11", "gene_name": "IL11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI17-1", "protein_name": "Interleukin-31 receptor subunit alpha", "gene_name": "IL31RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14626-1", "protein_name": "Interleukin-11 receptor subunit alpha", "gene_name": "IL11RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UBD9", "url": "https://www.uniprot.org/uniprotkb/Q9UBD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9238703", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular and functional characterization of IRp60, a member of the immunoglobulin superfamily that functions as an inhibitory receptor in human NK cells.", "journal": "European journal of immunology", "date": "1999", "authors": "Cantoni C, Bottino C, Augugliaro R, Morelli L, Marcenaro E, Castriconi R, Vitale M, Pende D, Sivori S, Millo R, Biassoni R, Moretta L, Moretta A", "reference": { "type": "PubMed", "id": "10540326", "url": "https://pubmed.ncbi.nlm.nih.gov/10540326" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGN4-1", "protein_name": "CMRF35-like molecule 8", "gene_name": "CD300A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGN4", "url": "https://www.uniprot.org/uniprotkb/Q9UGN4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10540326", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CMRF-35A, CMRF-35H: potential new CD.", "journal": "Journal of biological regulators and homeostatic agents", "date": "2002", "authors": "Clark GJ, Fitzpatrick S, Kuo B, Modra C, Jamriska L, Hart DN", "reference": { "type": "PubMed", "id": "12456026", "url": "https://pubmed.ncbi.nlm.nih.gov/12456026" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGN4-1", "protein_name": "CMRF35-like molecule 8", "gene_name": "CD300A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08708-1", "protein_name": "CMRF35-like molecule 6", "gene_name": "CD300C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7TSN2-1", "protein_name": "CMRF-35-like molecule 4", "gene_name": "Cd300c2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGN4", "url": "https://www.uniprot.org/uniprotkb/Q9UGN4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12456026", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD300a and CD300f differentially regulate the MyD88 and TRIF-mediated TLR signalling pathways through activation of SHP-1 and/or SHP-2 in human monocytic cell lines.", "journal": "Immunology", "date": "2012-03", "authors": "Kim Eun-Ju, Lee Sang-Min, Suk Kyoungho, Lee Won-Ha", "reference": { "type": "PubMed", "id": "22043923", "url": "https://pubmed.ncbi.nlm.nih.gov/22043923" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGN4-1", "protein_name": "CMRF35-like molecule 8", "gene_name": "CD300A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDQ1-1", "protein_name": "CMRF35-like molecule 1", "gene_name": "CD300LF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGN4", "url": "https://www.uniprot.org/uniprotkb/Q9UGN4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22043923", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD300 receptor family in viral infections.", "journal": "European journal of immunology", "date": "2019", "authors": "Vitalle J, Terren I, Orrantia A, Zenarruzabeitia O, Borrego F", "reference": { "type": "PubMed", "id": "30485414", "url": "https://pubmed.ncbi.nlm.nih.gov/30485414" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGN4-1", "protein_name": "CMRF35-like molecule 8", "gene_name": "CD300A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGN4", "url": "https://www.uniprot.org/uniprotkb/Q9UGN4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30485414", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CD300a and CD300f molecules regulate the function of leukocytes.", "journal": "International immunopharmacology", "date": "2021", "authors": "Cao Y, Ao T, Wang X, Wei W, Fan J, Tian X", "reference": { "type": "PubMed", "id": "33548578", "url": "https://pubmed.ncbi.nlm.nih.gov/33548578" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGN4-1", "protein_name": "CMRF35-like molecule 8", "gene_name": "CD300A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDQ1-1", "protein_name": "CMRF35-like molecule 1", "gene_name": "CD300LF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGN4", "url": "https://www.uniprot.org/uniprotkb/Q9UGN4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33548578", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The CMRF-35 mAb recognizes a second leukocyte membrane molecule with a domain similar to the poly Ig receptor.", "journal": "International immunology", "date": "1998", "authors": "Green BJ, Clark GJ, Hart DN", "reference": { "type": "PubMed", "id": "9701027", "url": "https://pubmed.ncbi.nlm.nih.gov/9701027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGN4-1", "protein_name": "CMRF35-like molecule 8", "gene_name": "CD300A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGN4", "url": "https://www.uniprot.org/uniprotkb/Q9UGN4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9701027", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alu-mediated inactivation of the human CMP- N-acetylneuraminic acid hydroxylase gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Hayakawa T, Satta Y, Gagneux P, Varki A, Takahata N", "reference": { "type": "PubMed", "id": "11562455", "url": "https://pubmed.ncbi.nlm.nih.gov/11562455" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y471-1", "protein_name": "Inactive cytidine monophosphate-N-acetylneuraminic acid hydroxylase", "gene_name": "CMAHP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y471", "url": "https://www.uniprot.org/uniprotkb/Q9Y471" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11562455", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivation of CMP-N-acetylneuraminic acid hydroxylase occurred prior to brain expansion during human evolution.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002-09-03", "authors": "Chou Hsun-Hua, Hayakawa Toshiyuki, Diaz Sandra, Krings Matthias, Indriati Etty, Leakey Meave, Paabo Svante, Satta Yoko, Takahata Naoyuki, Varki Ajit", "reference": { "type": "PubMed", "id": "12192086", "url": "https://pubmed.ncbi.nlm.nih.gov/12192086" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y471-1", "protein_name": "Inactive cytidine monophosphate-N-acetylneuraminic acid hydroxylase", "gene_name": "CMAHP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y471", "url": "https://www.uniprot.org/uniprotkb/Q9Y471" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12192086", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human CMP-N-acetylneuraminic acid hydroxylase is a novel stem cell marker linked to stem cell-specific mechanisms.", "journal": "Stem cells (Dayton, Ohio)", "date": "2010-02", "authors": "Nystedt Johanna, Anderson Heidi, Hirvonen Tia, Impola Ulla, Jaatinen Taina, Heiskanen Annamari, Blomqvist Maria, Satomaa Tero, Natunen Jari, Saarinen Juhani, Lehenkari Petri, Valmu Leena, Laine Jarmo", "reference": { "type": "PubMed", "id": "19890979", "url": "https://pubmed.ncbi.nlm.nih.gov/19890979" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y471-1", "protein_name": "Inactive cytidine monophosphate-N-acetylneuraminic acid hydroxylase", "gene_name": "CMAHP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y471", "url": "https://www.uniprot.org/uniprotkb/Q9Y471" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19890979", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The molecular basis for the absence of N-glycolylneuraminic acid in humans.", "journal": "The Journal of biological chemistry", "date": "1998-06-19", "authors": "Irie A, Koyama S, Kozutsumi Y, Kawasaki T, Suzuki A", "reference": { "type": "PubMed", "id": "9624188", "url": "https://pubmed.ncbi.nlm.nih.gov/9624188" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y471-1", "protein_name": "Inactive cytidine monophosphate-N-acetylneuraminic acid hydroxylase", "gene_name": "CMAHP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y471", "url": "https://www.uniprot.org/uniprotkb/Q9Y471" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9624188", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mutation in human CMP-sialic acid hydroxylase occurred after the Homo-Pan divergence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998-09-29", "authors": "Chou H H, Takematsu H, Diaz S, Iber J, Nickerson E, Wright K L, Muchmore E A, Nelson D L, Warren S T, Varki A", "reference": { "type": "PubMed", "id": "9751737", "url": "https://pubmed.ncbi.nlm.nih.gov/9751737" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y471-1", "protein_name": "Inactive cytidine monophosphate-N-acetylneuraminic acid hydroxylase", "gene_name": "CMAHP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y471", "url": "https://www.uniprot.org/uniprotkb/Q9Y471" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9751737", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Physical interaction and functional coupling between ACDP4 and the intracellular ion chaperone COX11, an implication of the role of ACDP4 in essential metal ion transport and homeostasis.", "journal": "Mol. Pain", "date": "2005", "authors": "Guo D, Ling J, Wang MH, She JX, Gu J, Wang CY", "reference": { "type": "PubMed", "id": "15840172", "url": "https://pubmed.ncbi.nlm.nih.gov/15840172" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6N1-1", "protein_name": "Cytochrome c oxidase assembly protein COX11, mitochondrial", "gene_name": "COX11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C588-1", "protein_name": "Metal transporter CNNM4", "gene_name": "Cnnm4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q6P4Q7-1", "protein_name": "Metal transporter CNNM4", "gene_name": "CNNM4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6N1", "url": "https://www.uniprot.org/uniprotkb/Q9Y6N1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15840172", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RANBP2 mutation causing autosomal dominant acute necrotizing encephalopathy attenuates its interaction with COX11.", "journal": "Neurosci. Lett.", "date": "2021", "authors": "Shibata A, Kasai M, Hoshino A, Tanaka T, Mizuguchi M", "reference": { "type": "PubMed", "id": "34400285", "url": "https://pubmed.ncbi.nlm.nih.gov/34400285" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6N1-1", "protein_name": "Cytochrome c oxidase assembly protein COX11, mitochondrial", "gene_name": "COX11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49792-1", "protein_name": "E3 SUMO-protein ligase RanBP2", "gene_name": "RANBP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6N1", "url": "https://www.uniprot.org/uniprotkb/Q9Y6N1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34400285", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Germline allelic expression of genes at 17q22 locus associates with risk of breast cancer.", "journal": "European journal of cancer (Oxford, England : 1990)", "date": "2022", "authors": "Esteves F, Xavier JM, Ford AM, Rocha C, Pharoah PDP, Caldas C, Chin SF, Maia AT", "reference": { "type": "PubMed", "id": "35772352", "url": "https://pubmed.ncbi.nlm.nih.gov/35772352" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6N1-1", "protein_name": "Cytochrome c oxidase assembly protein COX11, mitochondrial", "gene_name": "COX11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZWJ1-1", "protein_name": "Syntaxin-binding protein 4", "gene_name": "STXBP4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6N1", "url": "https://www.uniprot.org/uniprotkb/Q9Y6N1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35772352", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biallelic pathogenic variants in COX11 are associated with an infantile-onset mitochondrial encephalopathy.", "journal": "Human mutation", "date": "2022-12", "authors": "Rius Rocio, Bennett Neal K, Bhattacharya Kaustuv, Riley Lisa G, Y\u00fcksel Zafer, Formosa Luke E, Compton Alison G, Dale Russell C, Cowley Mark J, Gayevskiy Velimir, Al Tala Saeed M, Almehery Abdulrahman A, Ryan Michael T, Thorburn David R, Nakamura Ken, Christodoulou John", "reference": { "type": "PubMed", "id": "36030551", "url": "https://pubmed.ncbi.nlm.nih.gov/36030551" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6N1-1", "protein_name": "Cytochrome c oxidase assembly protein COX11, mitochondrial", "gene_name": "COX11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6N1", "url": "https://www.uniprot.org/uniprotkb/Q9Y6N1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36030551", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel COX11 Mutations Associated with Mitochondrial Disorder: Functional Characterization in Patient Fibroblasts and Saccharomyces cerevisiae.", "journal": "International journal of molecular sciences", "date": "2023-11-23", "authors": "Caron-Godon Chenelle A, Della Vecchia Stefania, Romano Alessandro, Doccini Stefano, Dal Canto Flavio, Pasquariello Rosa, Rubegni Anna, Battini Roberta, Santorelli Filippo Maria, Glerum D Moira, Nesti Claudia", "reference": { "type": "PubMed", "id": "38068960", "url": "https://pubmed.ncbi.nlm.nih.gov/38068960" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6N1-1", "protein_name": "Cytochrome c oxidase assembly protein COX11, mitochondrial", "gene_name": "COX11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19516-1", "protein_name": "Cytochrome c oxidase assembly protein COX11, mitochondrial", "gene_name": "COX11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6N1", "url": "https://www.uniprot.org/uniprotkb/Q9Y6N1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 238, "end_pos": 238, "sequence_org": "P", "sequence_mut": "T", "comment": "Cytochrome c oxidase activity, hydrogen peroxide sensitivity and growth on non-fermentable carbon sources appears normal.", "evidence": [ { "database": "UniProtKB", "id": "P19516", "url": "https://www.uniprot.org/uniprotkb/P19516" }, { "database": "PubMed", "id": "38068960", "url": "https://pubmed.ncbi.nlm.nih.gov/38068960" } ], "uniprot_canonical_ac": "P19516-1" }, { "start_pos": 250, "end_pos": 300, "sequence_org": "YTFFRAHYGDGTAVSDSKKEPEMNADEKAASLANAAILSPEVIDTRKDNSN", "sequence_mut": "", "comment": "Disrupts cytochrome c oxidase activity and leads to hydrogen peroxide sensitivity. Abolishes growth on non-fermentable carbon sources.", "evidence": [ { "database": "UniProtKB", "id": "P19516", "url": "https://www.uniprot.org/uniprotkb/P19516" }, { "database": "PubMed", "id": "38068960", "url": "https://pubmed.ncbi.nlm.nih.gov/38068960" } ], "uniprot_canonical_ac": "P19516-1" } ], "record_id": "pubmed.38068960", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LncRNA FGD5-AS1 Alleviates Inflammation in Allergic Rhinitis through the miR-223-3p/COX11 Axis.", "journal": "International archives of allergy and immunology", "date": "2024", "authors": "Li Binbin, Yu Xiaoping, Pang Fuzhen", "reference": { "type": "PubMed", "id": "38071964", "url": "https://pubmed.ncbi.nlm.nih.gov/38071964" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6N1-1", "protein_name": "Cytochrome c oxidase assembly protein COX11, mitochondrial", "gene_name": "COX11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6N1", "url": "https://www.uniprot.org/uniprotkb/Q9Y6N1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38071964", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of human cDNAs specific to BCS1, PET112, SCO1, COX15, and COX11, five genes involved in the formation and function of the mitochondrial respiratory chain.", "journal": "Genomics", "date": "1998", "authors": "Petruzzella V, Tiranti V, Fernandez P, Ianna P, Carrozzo R, Zeviani M", "reference": { "type": "PubMed", "id": "9878253", "url": "https://pubmed.ncbi.nlm.nih.gov/9878253" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6N1-1", "protein_name": "Cytochrome c oxidase assembly protein COX11, mitochondrial", "gene_name": "COX11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75879-1", "protein_name": "Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial", "gene_name": "GATB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50336-1", "protein_name": "Protoporphyrinogen oxidase", "gene_name": "PPOX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06132-1", "protein_name": "Uroporphyrinogen decarboxylase", "gene_name": "UROD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7KZN9-1", "protein_name": "Heme A synthase COX15", "gene_name": "COX15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10746-1", "protein_name": "Uroporphyrinogen-III synthase", "gene_name": "UROS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02768-1", "protein_name": "Albumin", "gene_name": "ALB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12887-1", "protein_name": "Protoheme IX farnesyltransferase, mitochondrial", "gene_name": "COX10", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75880-1", "protein_name": "Cytochrome c oxidase assembly factor SCO1", "gene_name": "SCO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22557-1", "protein_name": "5-aminolevulinate synthase, erythroid-specific, mitochondrial", "gene_name": "ALAS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y276-1", "protein_name": "Mitochondrial chaperone BCS1", "gene_name": "BCS1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13196-1", "protein_name": "5-aminolevulinate synthase, non-specific, mitochondrial", "gene_name": "ALAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22830-1", "protein_name": "Ferrochelatase, mitochondrial", "gene_name": "FECH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36551-1", "protein_name": "Oxygen-dependent coproporphyrinogen-III oxidase, mitochondrial", "gene_name": "CPOX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08397-1", "protein_name": "Porphobilinogen deaminase", "gene_name": "HMBS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13716-1", "protein_name": "Delta-aminolevulinic acid dehydratase", "gene_name": "ALAD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNQ0-1", "protein_name": "Broad substrate specificity ATP-binding cassette transporter ABCG2", "gene_name": "ABCG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6N1", "url": "https://www.uniprot.org/uniprotkb/Q9Y6N1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9878253", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Shotgun identification of protein modifications from protein complexes and lens tissue.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "MacCoss MJ, McDonald WH, Saraf A, Sadygov R, Clark JM, Tasto JJ, Gould KL, Wolters D, Washburn M, Weiss A, Clark JI, Yates JR 3rd", "reference": { "type": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P26998-1", "protein_name": "Beta-crystallin B3", "gene_name": "CRYBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07316-1", "protein_name": "Gamma-crystallin B", "gene_name": "CRYGB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02511-1", "protein_name": "Alpha-crystallin B chain", "gene_name": "CRYAB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02489-1", "protein_name": "Alpha-crystallin A chain", "gene_name": "CRYAA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07315-1", "protein_name": "Gamma-crystallin C", "gene_name": "CRYGC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43320-1", "protein_name": "Beta-crystallin B2", "gene_name": "CRYBB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53673-1", "protein_name": "Beta-crystallin A4", "gene_name": "CRYBA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05813-1", "protein_name": "Beta-crystallin A3", "gene_name": "CRYBA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P26998", "url": "https://www.uniprot.org/uniprotkb/P26998" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P26998", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P26998" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Tyr29", "uniprot_canonical_ac": "P26998-1" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07316", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07316" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Tyr63", "uniprot_canonical_ac": "P07316-1" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07316", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07316" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Tyr66", "uniprot_canonical_ac": "P07316-1" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02511", "url": "https://www.uniprot.org/uniprotkb/P02511" }, { "database": "PubMed", "id": "8175657", "url": "https://pubmed.ncbi.nlm.nih.gov/8175657" }, { "database": "iPTMnet", "id": "P02511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02511" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" }, { "database": "PubMed", "id": "23950959", "url": "https://pubmed.ncbi.nlm.nih.gov/23950959" }, { "database": "PubMed", "id": "27641668", "url": "https://pubmed.ncbi.nlm.nih.gov/27641668" }, { "database": "PubMed", "id": "30014472", "url": "https://pubmed.ncbi.nlm.nih.gov/30014472" }, { "database": "PubMed", "id": "31729431", "url": "https://pubmed.ncbi.nlm.nih.gov/31729431" }, { "database": "PubMed", "id": "32650630", "url": "https://pubmed.ncbi.nlm.nih.gov/32650630" } ], "site_lbl": "Ser19", "uniprot_canonical_ac": "P02511-1" }, { "start_pos": 21, "end_pos": 21, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02511" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Ser21", "uniprot_canonical_ac": "P02511-1" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02511" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Ser43", "uniprot_canonical_ac": "P02511-1" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02511", "url": "https://www.uniprot.org/uniprotkb/P02511" }, { "database": "PubMed", "id": "11158243", "url": "https://pubmed.ncbi.nlm.nih.gov/11158243" }, { "database": "PubMed", "id": "8175657", "url": "https://pubmed.ncbi.nlm.nih.gov/8175657" }, { "database": "iPTMnet", "id": "P02511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02511" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" }, { "database": "PubMed", "id": "11549345", "url": "https://pubmed.ncbi.nlm.nih.gov/11549345" }, { "database": "PubMed", "id": "20535031", "url": "https://pubmed.ncbi.nlm.nih.gov/20535031" }, { "database": "PubMed", "id": "23950959", "url": "https://pubmed.ncbi.nlm.nih.gov/23950959" }, { "database": "PubMed", "id": "27641668", "url": "https://pubmed.ncbi.nlm.nih.gov/27641668" }, { "database": "PubMed", "id": "30014472", "url": "https://pubmed.ncbi.nlm.nih.gov/30014472" }, { "database": "PubMed", "id": "31729431", "url": "https://pubmed.ncbi.nlm.nih.gov/31729431" }, { "database": "PubMed", "id": "32650630", "url": "https://pubmed.ncbi.nlm.nih.gov/32650630" } ], "site_lbl": "Ser45", "uniprot_canonical_ac": "P02511-1" }, { "start_pos": 53, "end_pos": 53, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02511" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Ser53", "uniprot_canonical_ac": "P02511-1" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02511", "url": "https://www.uniprot.org/uniprotkb/P02511" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "8175657", "url": "https://pubmed.ncbi.nlm.nih.gov/8175657" }, { "database": "PubMed", "id": "11158243", "url": "https://pubmed.ncbi.nlm.nih.gov/11158243" }, { "database": "iPTMnet", "id": "P02511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02511" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "20535031", "url": "https://pubmed.ncbi.nlm.nih.gov/20535031" }, { "database": "PubMed", "id": "23559016", "url": "https://pubmed.ncbi.nlm.nih.gov/23559016" }, { "database": "PubMed", "id": "23950959", "url": "https://pubmed.ncbi.nlm.nih.gov/23950959" }, { "database": "PubMed", "id": "26620801", "url": "https://pubmed.ncbi.nlm.nih.gov/26620801" }, { "database": "PubMed", "id": "27641668", "url": "https://pubmed.ncbi.nlm.nih.gov/27641668" }, { "database": "PubMed", "id": "30014472", "url": "https://pubmed.ncbi.nlm.nih.gov/30014472" }, { "database": "PubMed", "id": "30920888", "url": "https://pubmed.ncbi.nlm.nih.gov/30920888" }, { "database": "PubMed", "id": "31729431", "url": "https://pubmed.ncbi.nlm.nih.gov/31729431" }, { "database": "PubMed", "id": "32650630", "url": "https://pubmed.ncbi.nlm.nih.gov/32650630" } ], "site_lbl": "Ser59", "uniprot_canonical_ac": "P02511-1" }, { "start_pos": 76, "end_pos": 76, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02511", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02511" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Ser76", "uniprot_canonical_ac": "P02511-1" }, { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02489", "url": "https://www.uniprot.org/uniprotkb/P02489" }, { "database": "PubMed", "id": "8759518", "url": "https://pubmed.ncbi.nlm.nih.gov/8759518" }, { "database": "PubMed", "id": "9068373", "url": "https://pubmed.ncbi.nlm.nih.gov/9068373" }, { "database": "PubMed", "id": "8175657", "url": "https://pubmed.ncbi.nlm.nih.gov/8175657" }, { "database": "iPTMnet", "id": "P02489", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02489" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Ser122", "uniprot_canonical_ac": "P02489-1" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02489", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02489" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Thr13", "uniprot_canonical_ac": "P02489-1" }, { "start_pos": 140, "end_pos": 140, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P02489", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02489" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Thr140", "uniprot_canonical_ac": "P02489-1" }, { "start_pos": 45, "end_pos": 45, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P02489", "url": "https://www.uniprot.org/uniprotkb/P02489" }, { "database": "PubMed", "id": "9068373", "url": "https://pubmed.ncbi.nlm.nih.gov/9068373" }, { "database": "iPTMnet", "id": "P02489", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02489" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Ser45", "uniprot_canonical_ac": "P02489-1" }, { "start_pos": 63, "end_pos": 63, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07315", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07315" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Tyr63", "uniprot_canonical_ac": "P07315-1" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07315", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07315" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Tyr66", "uniprot_canonical_ac": "P07315-1" }, { "start_pos": 118, "end_pos": 118, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P43320", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P43320" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Thr118", "uniprot_canonical_ac": "P43320-1" }, { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53673" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Ser35", "uniprot_canonical_ac": "P53673-1" }, { "start_pos": 43, "end_pos": 43, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P53673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P53673" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Thr43", "uniprot_canonical_ac": "P53673-1" }, { "start_pos": 127, "end_pos": 127, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05813", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05813" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Thr127", "uniprot_canonical_ac": "P05813-1" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P05813", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05813" }, { "database": "PubMed", "id": "12060738", "url": "https://pubmed.ncbi.nlm.nih.gov/12060738" } ], "site_lbl": "Ser160", "uniprot_canonical_ac": "P05813-1" } ], "record_id": "pubmed.12060738", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in betaB3-crystallin associated with autosomal recessive cataract in two Pakistani families.", "journal": "Investigative ophthalmology & visual science", "date": "2005", "authors": "Riazuddin SA, Yasmeen A, Yao W, Sergeev YV, Zhang Q, Zulfiqar F, Riaz A, Riazuddin S, Hejtmancik JF", "reference": { "type": "PubMed", "id": "15914629", "url": "https://pubmed.ncbi.nlm.nih.gov/15914629" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P26998-1", "protein_name": "Beta-crystallin B3", "gene_name": "CRYBB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P26998", "url": "https://www.uniprot.org/uniprotkb/P26998" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15914629", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comprehensive mutational screening in a cohort of Danish families with hereditary congenital cataract.", "journal": "Investigative ophthalmology & visual science", "date": "2009", "authors": "Hansen L, Mikkelsen A, Nurnberg P, Nurnberg G, Anjum I, Eiberg H, Rosenberg T", "reference": { "type": "PubMed", "id": "19182255", "url": "https://pubmed.ncbi.nlm.nih.gov/19182255" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P26998-1", "protein_name": "Beta-crystallin B3", "gene_name": "CRYBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02489-1", "protein_name": "Alpha-crystallin A chain", "gene_name": "CRYAA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48165-1", "protein_name": "Gap junction alpha-8 protein", "gene_name": "GJA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6H8-1", "protein_name": "Gap junction alpha-3 protein", "gene_name": "GJA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV5-1", "protein_name": "Heat shock factor protein 4", "gene_name": "HSF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75444-2", "protein_name": "Transcription factor Maf", "gene_name": "MAF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P26998", "url": "https://www.uniprot.org/uniprotkb/P26998" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19182255", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Whole exome sequencing in dominant cataract identifies a new causative factor, CRYBA2, and a variety of novel alleles in known genes.", "journal": "Human genetics", "date": "2013", "authors": "Reis LM, Tyler RC, Muheisen S, Raggio V, Salviati L, Han DP, Costakos D, Yonath H, Hall S, Power P, Semina EV", "reference": { "type": "PubMed", "id": "23508780", "url": "https://pubmed.ncbi.nlm.nih.gov/23508780" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P26998-1", "protein_name": "Beta-crystallin B3", "gene_name": "CRYBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02489-1", "protein_name": "Alpha-crystallin A chain", "gene_name": "CRYAA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53672-1", "protein_name": "Beta-crystallin A2", "gene_name": "CRYBA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53674-1", "protein_name": "Beta-crystallin B1", "gene_name": "CRYBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48165-1", "protein_name": "Gap junction alpha-8 protein", "gene_name": "GJA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99502-1", "protein_name": "Protein phosphatase EYA1", "gene_name": "EYA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P26998", "url": "https://www.uniprot.org/uniprotkb/P26998" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23508780", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Different evolution rates within the lens-specific beta-crystallin gene family.", "journal": "J. Mol. Evol.", "date": "1989", "authors": "Aarts H J, Jacobs E H, van Willigen G, Lubsen N H, Schoenmakers J G", "reference": { "type": "PubMed", "id": "2499686", "url": "https://pubmed.ncbi.nlm.nih.gov/2499686" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P26998-1", "protein_name": "Beta-crystallin B3", "gene_name": "CRYBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14881-1", "protein_name": "Beta-crystallin A3", "gene_name": "Cryba1", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P26998", "url": "https://www.uniprot.org/uniprotkb/P26998" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2499686", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Common Ancestral Mutation in CRYBB3 Identified in Multiple Consanguineous Families with Congenital Cataracts.", "journal": "PloS one", "date": "2016", "authors": "Jiao X, Kabir F, Irum B, Khan AO, Wang Q, Li D, Khan AA, Husnain T, Akram J, Riazuddin S, Hejtmancik JF, Riazuddin SA", "reference": { "type": "PubMed", "id": "27326458", "url": "https://pubmed.ncbi.nlm.nih.gov/27326458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P26998-1", "protein_name": "Beta-crystallin B3", "gene_name": "CRYBB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P26998", "url": "https://www.uniprot.org/uniprotkb/P26998" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27326458", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence analysis of betaA3, betaB3, and betaA4 crystallins completes the identification of the major proteins in young human lens.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Lampi KJ, Ma Z, Shih M, Shearer TR, Smith JB, Smith DL, David LL", "reference": { "type": "PubMed", "id": "8999933", "url": "https://pubmed.ncbi.nlm.nih.gov/8999933" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P26998-1", "protein_name": "Beta-crystallin B3", "gene_name": "CRYBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07320-1", "protein_name": "Gamma-crystallin D", "gene_name": "CRYGD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02511-1", "protein_name": "Alpha-crystallin B chain", "gene_name": "CRYAB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02489-1", "protein_name": "Alpha-crystallin A chain", "gene_name": "CRYAA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07315-1", "protein_name": "Gamma-crystallin C", "gene_name": "CRYGC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43320-1", "protein_name": "Beta-crystallin B2", "gene_name": "CRYBB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22914-1", "protein_name": "Gamma-crystallin S", "gene_name": "CRYGS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53673-1", "protein_name": "Beta-crystallin A4", "gene_name": "CRYBA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05813-1", "protein_name": "Beta-crystallin A3", "gene_name": "CRYBA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P26998", "url": "https://www.uniprot.org/uniprotkb/P26998" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8999933", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "hCOX18 and hCOX19: two human genes involved in cytochrome c oxidase assembly.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2005", "authors": "Sacconi S, Trevisson E, Pistollato F, Baldoin MC, Rezzonico R, Bourget I, Desnuelle C, Tenconi R, Basso G, DiMauro S, Salviati L", "reference": { "type": "PubMed", "id": "16212937", "url": "https://pubmed.ncbi.nlm.nih.gov/16212937" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q49B96-1", "protein_name": "Cytochrome c oxidase assembly protein COX19", "gene_name": "COX19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N8Q8-1", "protein_name": "Cytochrome c oxidase assembly protein COX18, mitochondrial", "gene_name": "COX18", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q49B96", "url": "https://www.uniprot.org/uniprotkb/Q49B96" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16212937", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COX19 Is a New Target of MACC1 and Promotes Colorectal Cancer Progression by Regulating Copper Transport in Mitochondria.", "journal": "The Journal of nutrition", "date": "2024-02", "authors": "Gao Sheng, Zhang Hong, Zhang Xiaodong, Wang Jian, Bai Wenqi, Jiang Bo", "reference": { "type": "PubMed", "id": "38141772", "url": "https://pubmed.ncbi.nlm.nih.gov/38141772" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q49B96-1", "protein_name": "Cytochrome c oxidase assembly protein COX19", "gene_name": "COX19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZN28-1", "protein_name": "Metastasis-associated in colon cancer protein 1", "gene_name": "MACC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q49B96", "url": "https://www.uniprot.org/uniprotkb/Q49B96" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38141772", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polycystin-1 Interacting Protein-1 (CU062) Interacts with the Ectodomain of Polycystin-1 (PC1).", "journal": "Cells", "date": "2023-08-29", "authors": "Lea Wendy A, Winklhofer Thomas, Zelenchuk Lesya, Sharma Madhulika, Rossol-Allison Jessica, Fields Timothy A, Reif Gail, Calvet James P, Bakeberg Jason L, Wallace Darren P, Ward Christopher J", "reference": { "type": "PubMed", "id": "37681898", "url": "https://pubmed.ncbi.nlm.nih.gov/37681898" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NYP8-1", "protein_name": "Exosomal polycystin-1-interacting protein", "gene_name": "EPCIP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98161-1", "protein_name": "Polycystin-1", "gene_name": "PKD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NYP8", "url": "https://www.uniprot.org/uniprotkb/Q9NYP8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37681898", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of genes related to Parkinson's disease using expressed sequence tags.", "journal": "DNA Res.", "date": "2006", "authors": "Kim Jeong-Min, Lee Kyu-Hwa, Jeon Yeo-Jin, Oh Jung-Hwa, Jeong So-Young, Song In-Sung, Kim Jin-Man, Lee Dong-Seok, Kim Nam-Soon", "reference": { "type": "PubMed", "id": "17213182", "url": "https://pubmed.ncbi.nlm.nih.gov/17213182" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "J3KSC0-1", "protein_name": "Putative uncharacterized protein encoded by LINC01387", "gene_name": "LINC01387", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18859-1", "protein_name": "ATP synthase peripheral stalk subunit F6, mitochondrial", "gene_name": "ATP5PF", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "J3KSC0", "url": "https://www.uniprot.org/uniprotkb/J3KSC0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17213182", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IL-27, a heterodimeric cytokine composed of EBI3 and p28 protein, induces proliferation of naive CD4+ T cells.", "journal": "Immunity", "date": "2002", "authors": "Pflanz S, Timans JC, Cheung J, Rosales R, Kanzler H, Gilbert J, Hibbert L, Churakova T, Travis M, Vaisberg E, Blumenschein WM, Mattson JD, Wagner JL, To W, Zurawski S, McClanahan TK, Gorman DM, Bazan JF, de Waal Malefyt R, Rennick D, Kastelein RA", "reference": { "type": "PubMed", "id": "12121660", "url": "https://pubmed.ncbi.nlm.nih.gov/12121660" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14765-1", "protein_name": "Signal transducer and activator of transcription 4", "gene_name": "STAT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99665-1", "protein_name": "Interleukin-12 receptor subunit beta-2", "gene_name": "IL12RB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29459-1", "protein_name": "Interleukin-12 subunit alpha", "gene_name": "IL12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K3I6-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "Il27", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12121660", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cold-induced sweating syndrome is caused by mutations in the CRLF1 gene.", "journal": "American journal of human genetics", "date": "2003", "authors": "Knappskog PM, Majewski J, Livneh A, Nilsen PT, Bringsli JS, Ott J, Boman H", "reference": { "type": "PubMed", "id": "12509788", "url": "https://pubmed.ncbi.nlm.nih.gov/12509788" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12509788", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cutting edge: role of IL-27/WSX-1 signaling for induction of T-bet through activation of STAT1 during initial Th1 commitment.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Takeda A, Hamano S, Yamanaka A, Hanada T, Ishibashi T, Mak TW, Yoshimura A, Yoshida H", "reference": { "type": "PubMed", "id": "12734330", "url": "https://pubmed.ncbi.nlm.nih.gov/12734330" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K3I6-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "Il27", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12734330", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IL-27 and IFN-alpha signal via Stat1 and Stat3 and induce T-Bet and IL-12Rbeta2 in naive T cells.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2003", "authors": "Hibbert L, Pflanz S, De Waal Malefyt R, Kastelein RA", "reference": { "type": "PubMed", "id": "14565860", "url": "https://pubmed.ncbi.nlm.nih.gov/14565860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K3I6-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "Il27", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14565860", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "WSX-1 and glycoprotein 130 constitute a signal-transducing receptor for IL-27.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Pflanz S, Hibbert L, Mattson J, Rosales R, Vaisberg E, Bazan JF, Phillips JH, McClanahan TK, de Waal Malefyt R, Kastelein RA", "reference": { "type": "PubMed", "id": "14764690", "url": "https://pubmed.ncbi.nlm.nih.gov/14764690" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14764690", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cold-induced sweating syndrome: a report of two cases and demonstration of genetic heterogeneity.", "journal": "Journal of the neurological sciences", "date": "2006", "authors": "Hahn AF, Jones DL, Knappskog PM, Boman H, McLeod JG", "reference": { "type": "PubMed", "id": "16952376", "url": "https://pubmed.ncbi.nlm.nih.gov/16952376" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16952376", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in cytokine receptor-like factor 1 (CRLF1) account for both Crisponi and cold-induced sweating syndromes.", "journal": "American journal of human genetics", "date": "2007", "authors": "Dagoneau N, Bellais S, Blanchet P, Sarda P, Al-Gazali LI, Di Rocco M, Huber C, Djouadi F, Le Goff C, Munnich A, Cormier-Daire V", "reference": { "type": "PubMed", "id": "17436251", "url": "https://pubmed.ncbi.nlm.nih.gov/17436251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17436251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crisponi syndrome is caused by mutations in the CRLF1 gene and is allelic to cold-induced sweating syndrome type 1.", "journal": "American journal of human genetics", "date": "2007", "authors": "Crisponi L, Crisponi G, Meloni A, Toliat MR, Nurnberg G, Usala G, Uda M, Masala M, Hohne W, Becker C, Marongiu M, Chiappe F, Kleta R, Rauch A, Wollnik B, Strasser F, Reese T, Jakobs C, Kurlemann G, Cao A, Nurnberg P, Rutsch F", "reference": { "type": "PubMed", "id": "17436252", "url": "https://pubmed.ncbi.nlm.nih.gov/17436252" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17436252", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "STAT3 is indispensable to IL-27-mediated cell proliferation but not to IL-27-induced Th1 differentiation and suppression of proinflammatory cytokine production.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Owaki T, Asakawa M, Morishima N, Mizoguchi I, Fukai F, Takeda K, Mizuguchi J, Yoshimoto T", "reference": { "type": "PubMed", "id": "18292512", "url": "https://pubmed.ncbi.nlm.nih.gov/18292512" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18292512", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The IL-27 p28 subunit binds cytokine-like factor 1 to form a cytokine regulating NK and T cell activities requiring IL-6R for signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2009", "authors": "Crabe S, Guay-Giroux A, Tormo AJ, Duluc D, Lissilaa R, Guilhot F, Mavoungou-Bigouagou U, Lefouili F, Cognet I, Ferlin W, Elson G, Jeannin P, Gauchat JF", "reference": { "type": "PubMed", "id": "19933857", "url": "https://pubmed.ncbi.nlm.nih.gov/19933857" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19933857", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interleukin-27 induces a STAT1/3- and NF-kappaB-dependent proinflammatory cytokine profile in human monocytes.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Guzzo C, Che Mat NF, Gee K", "reference": { "type": "PubMed", "id": "20519510", "url": "https://pubmed.ncbi.nlm.nih.gov/20519510" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20519510", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential secretion of the mutated protein is a major component affecting phenotypic severity in CRLF1-associated disorders.", "journal": "European journal of human genetics : EJHG", "date": "2011", "authors": "Herholz J, Meloni A, Marongiu M, Chiappe F, Deiana M, Herrero CR, Zampino G, Hamamy H, Zalloum Y, Waaler PE, Crisponi G, Crisponi L, Rutsch F", "reference": { "type": "PubMed", "id": "21326283", "url": "https://pubmed.ncbi.nlm.nih.gov/21326283" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21326283", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the transmembrane and juxtamembrane domains enhance IL27R transforming activity.", "journal": "The Biochemical journal", "date": "2011", "authors": "Lambert QT, Pradhan A, Roll JD, Reuther GW", "reference": { "type": "PubMed", "id": "21631431", "url": "https://pubmed.ncbi.nlm.nih.gov/21631431" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21631431", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple small hyperintense lesions in the subcortical white matter on cranial MR images in two Turkish brothers with cold-induced sweating syndrome caused by a novel missense mutation in the CRLF1 gene.", "journal": "Brain & development", "date": "2013", "authors": "Tuysuz B, Kasapcopur O, Yalcinkaya C, Isik Hasiloglu Z, Knappskog PM, Boman H", "reference": { "type": "PubMed", "id": "23026229", "url": "https://pubmed.ncbi.nlm.nih.gov/23026229" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23026229", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expanding the mutational spectrum of CRLF1 in Crisponi/CISS1 syndrome.", "journal": "Human mutation", "date": "2014", "authors": "Piras R, Chiappe F, Torraca IL, Buers I, Usala G, Angius A, Akin MA, Basel-Vanagaite L, Benedicenti F, Chiodin E, El Assy O, Feingold-Zadok M, Guibert J, Kamien B, Kasapkara CS, Kilic E, Boduroglu K, Kurtoglu S, Manzur AY, Onal EE, Paderi E, Roche CH, Tumer L, Unal S, Utine GE, Zanda G, Zankl A, Zampino G, Crisponi G, Crisponi L, Rutsch F", "reference": { "type": "PubMed", "id": "24488861", "url": "https://pubmed.ncbi.nlm.nih.gov/24488861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24488861", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A soluble form of IL-27Ralpha is a natural IL-27 antagonist.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2014", "authors": "Dietrich C, Candon S, Ruemmele FM, Devergne O", "reference": { "type": "PubMed", "id": "24771852", "url": "https://pubmed.ncbi.nlm.nih.gov/24771852" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24771852", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Asymmetric Action of STAT Transcription Factors Drives Transcriptional Outputs and Cytokine Specificity.", "journal": "Immunity", "date": "2015", "authors": "Hirahara K, Onodera A, Villarino AV, Bonelli M, Sciume G, Laurence A, Sun HW, Brooks SR, Vahedi G, Shih HY, Gutierrez-Cruz G, Iwata S, Suzuki R, Mikami Y, Okamoto Y, Nakayama T, Holland SM, Hunter CA, Kanno Y, O'Shea JJ", "reference": { "type": "PubMed", "id": "25992861", "url": "https://pubmed.ncbi.nlm.nih.gov/25992861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25992861", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "IL-27 Promotes Proliferation of Human Leukemic Cell Lines Through the MAPK/ERK Signaling Pathway and Suppresses Sensitivity to Chemotherapeutic Drugs.", "journal": "Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research", "date": "2016", "authors": "Jia H, Dilger P, Bird C, Wadhwa M", "reference": { "type": "PubMed", "id": "27119567", "url": "https://pubmed.ncbi.nlm.nih.gov/27119567" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 202, "end_pos": 202, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAP2K1 and MAP2K2", "evidence": [ { "database": "UniProtKB", "id": "P27361", "url": "https://www.uniprot.org/uniprotkb/P27361" }, { "database": "PRO", "id": "P27361", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P27361" }, { "database": "iPTMnet", "id": "P27361", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27361" }, { "database": "PubMed", "id": "17192257", "url": "https://pubmed.ncbi.nlm.nih.gov/17192257" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "16484360", "url": "https://pubmed.ncbi.nlm.nih.gov/16484360" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "19412549", "url": "https://pubmed.ncbi.nlm.nih.gov/19412549" }, { "database": "PubMed", "id": "20226096", "url": "https://pubmed.ncbi.nlm.nih.gov/20226096" }, { "database": "PubMed", "id": "20429916", "url": "https://pubmed.ncbi.nlm.nih.gov/20429916" }, { "database": "PubMed", "id": "20485667", "url": "https://pubmed.ncbi.nlm.nih.gov/20485667" }, { "database": "PubMed", "id": "20509944", "url": "https://pubmed.ncbi.nlm.nih.gov/20509944" }, { "database": "PubMed", "id": "20957203", "url": "https://pubmed.ncbi.nlm.nih.gov/20957203" }, { "database": "PubMed", "id": "21129151", "url": "https://pubmed.ncbi.nlm.nih.gov/21129151" }, { "database": "PubMed", "id": "21187008", "url": "https://pubmed.ncbi.nlm.nih.gov/21187008" }, { "database": "PubMed", "id": "21210654", "url": "https://pubmed.ncbi.nlm.nih.gov/21210654" }, { "database": "PubMed", "id": "22031842", "url": "https://pubmed.ncbi.nlm.nih.gov/22031842" }, { "database": "PubMed", "id": "22096605", "url": "https://pubmed.ncbi.nlm.nih.gov/22096605" }, { "database": "PubMed", "id": "22347457", "url": "https://pubmed.ncbi.nlm.nih.gov/22347457" }, { "database": "PubMed", "id": "22815910", "url": "https://pubmed.ncbi.nlm.nih.gov/22815910" }, { "database": "PubMed", "id": "22909302", "url": "https://pubmed.ncbi.nlm.nih.gov/22909302" }, { "database": "PubMed", "id": "23056203", "url": "https://pubmed.ncbi.nlm.nih.gov/23056203" }, { "database": "PubMed", "id": "23086641", "url": "https://pubmed.ncbi.nlm.nih.gov/23086641" }, { "database": "PubMed", "id": "23353780", "url": "https://pubmed.ncbi.nlm.nih.gov/23353780" }, { "database": "PubMed", "id": "23620784", "url": "https://pubmed.ncbi.nlm.nih.gov/23620784" }, { "database": "PubMed", "id": "23686305", "url": "https://pubmed.ncbi.nlm.nih.gov/23686305" }, { "database": "PubMed", "id": "23727359", "url": "https://pubmed.ncbi.nlm.nih.gov/23727359" }, { "database": "PubMed", "id": "23977025", "url": "https://pubmed.ncbi.nlm.nih.gov/23977025" }, { "database": "PubMed", "id": "24065881", "url": "https://pubmed.ncbi.nlm.nih.gov/24065881" }, { "database": "PubMed", "id": "24300666", "url": "https://pubmed.ncbi.nlm.nih.gov/24300666" }, { "database": "PubMed", "id": "24376606", "url": "https://pubmed.ncbi.nlm.nih.gov/24376606" }, { "database": "PubMed", "id": "24521094", "url": "https://pubmed.ncbi.nlm.nih.gov/24521094" }, { "database": "PubMed", "id": "24810160", "url": "https://pubmed.ncbi.nlm.nih.gov/24810160" }, { "database": "PubMed", "id": "24853429", "url": "https://pubmed.ncbi.nlm.nih.gov/24853429" }, { "database": "PubMed", "id": "25179402", "url": "https://pubmed.ncbi.nlm.nih.gov/25179402" }, { "database": "PubMed", "id": "25221952", "url": "https://pubmed.ncbi.nlm.nih.gov/25221952" }, { "database": "PubMed", "id": "25261871", "url": "https://pubmed.ncbi.nlm.nih.gov/25261871" }, { "database": "PubMed", "id": "25733818", "url": "https://pubmed.ncbi.nlm.nih.gov/25733818" }, { "database": "PubMed", "id": "25849721", "url": "https://pubmed.ncbi.nlm.nih.gov/25849721" }, { "database": "PubMed", "id": "26043921", "url": "https://pubmed.ncbi.nlm.nih.gov/26043921" }, { "database": "PubMed", "id": "26046303", "url": "https://pubmed.ncbi.nlm.nih.gov/26046303" }, { "database": "PubMed", "id": "26379399", "url": "https://pubmed.ncbi.nlm.nih.gov/26379399" }, { "database": "PubMed", "id": "26400984", "url": "https://pubmed.ncbi.nlm.nih.gov/26400984" }, { "database": "PubMed", "id": "26580203", "url": "https://pubmed.ncbi.nlm.nih.gov/26580203" }, { "database": "PubMed", "id": "26716515", "url": "https://pubmed.ncbi.nlm.nih.gov/26716515" }, { "database": "PubMed", "id": "26919095", "url": "https://pubmed.ncbi.nlm.nih.gov/26919095" }, { "database": "PubMed", "id": "26945908", "url": "https://pubmed.ncbi.nlm.nih.gov/26945908" }, { "database": "PubMed", "id": "26983806", "url": "https://pubmed.ncbi.nlm.nih.gov/26983806" }, { "database": "PubMed", "id": "27054717", "url": "https://pubmed.ncbi.nlm.nih.gov/27054717" }, { "database": "PubMed", "id": "27119567", "url": "https://pubmed.ncbi.nlm.nih.gov/27119567" }, { "database": "PubMed", "id": "27134571", "url": "https://pubmed.ncbi.nlm.nih.gov/27134571" }, { "database": "PubMed", "id": "27304216", "url": "https://pubmed.ncbi.nlm.nih.gov/27304216" }, { "database": "PubMed", "id": "27533246", "url": "https://pubmed.ncbi.nlm.nih.gov/27533246" }, { "database": "PubMed", "id": "27542844", "url": "https://pubmed.ncbi.nlm.nih.gov/27542844" }, { "database": "PubMed", "id": "28387310", "url": "https://pubmed.ncbi.nlm.nih.gov/28387310" }, { "database": "PubMed", "id": "28481292", "url": "https://pubmed.ncbi.nlm.nih.gov/28481292" }, { "database": "PubMed", "id": "28598976", "url": "https://pubmed.ncbi.nlm.nih.gov/28598976" }, { "database": "PubMed", "id": "28848389", "url": "https://pubmed.ncbi.nlm.nih.gov/28848389" }, { "database": "PubMed", "id": "28915272", "url": "https://pubmed.ncbi.nlm.nih.gov/28915272" }, { "database": "PubMed", "id": "29154190", "url": "https://pubmed.ncbi.nlm.nih.gov/29154190" }, { "database": "PubMed", "id": "29368606", "url": "https://pubmed.ncbi.nlm.nih.gov/29368606" }, { "database": "PubMed", "id": "29412140", "url": "https://pubmed.ncbi.nlm.nih.gov/29412140" }, { "database": "PubMed", "id": "29435164", "url": "https://pubmed.ncbi.nlm.nih.gov/29435164" }, { "database": "PubMed", "id": "29615689", "url": "https://pubmed.ncbi.nlm.nih.gov/29615689" }, { "database": "PubMed", "id": "29766336", "url": "https://pubmed.ncbi.nlm.nih.gov/29766336" }, { "database": "PubMed", "id": "29986550", "url": "https://pubmed.ncbi.nlm.nih.gov/29986550" }, { "database": "PubMed", "id": "30015159", "url": "https://pubmed.ncbi.nlm.nih.gov/30015159" }, { "database": "PubMed", "id": "30853827", "url": "https://pubmed.ncbi.nlm.nih.gov/30853827" }, { "database": "PubMed", "id": "30853914", "url": "https://pubmed.ncbi.nlm.nih.gov/30853914" }, { "database": "PubMed", "id": "30986276", "url": "https://pubmed.ncbi.nlm.nih.gov/30986276" }, { "database": "PubMed", "id": "31116709", "url": "https://pubmed.ncbi.nlm.nih.gov/31116709" }, { "database": "PubMed", "id": "31612114", "url": "https://pubmed.ncbi.nlm.nih.gov/31612114" }, { "database": "PubMed", "id": "31910234", "url": "https://pubmed.ncbi.nlm.nih.gov/31910234" }, { "database": "PubMed", "id": "32188029", "url": "https://pubmed.ncbi.nlm.nih.gov/32188029" }, { "database": "PubMed", "id": "32316166", "url": "https://pubmed.ncbi.nlm.nih.gov/32316166" }, { "database": "PubMed", "id": "32872257", "url": "https://pubmed.ncbi.nlm.nih.gov/32872257" }, { "database": "PubMed", "id": "32998746", "url": "https://pubmed.ncbi.nlm.nih.gov/32998746" }, { "database": "PubMed", "id": "33072436", "url": "https://pubmed.ncbi.nlm.nih.gov/33072436" }, { "database": "PubMed", "id": "33101052", "url": "https://pubmed.ncbi.nlm.nih.gov/33101052" }, { "database": "PubMed", "id": "33114687", "url": "https://pubmed.ncbi.nlm.nih.gov/33114687" }, { "database": "PubMed", "id": "33171947", "url": "https://pubmed.ncbi.nlm.nih.gov/33171947" }, { "database": "PubMed", "id": "33686185", "url": "https://pubmed.ncbi.nlm.nih.gov/33686185" }, { "database": "PubMed", "id": "33828192", "url": "https://pubmed.ncbi.nlm.nih.gov/33828192" }, { "database": "PubMed", "id": "8626767", "url": "https://pubmed.ncbi.nlm.nih.gov/8626767" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" } ], "site_lbl": "Thr202", "uniprot_canonical_ac": "P27361-1" }, { "start_pos": 204, "end_pos": 204, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by MAP2K1 and MAP2K2", "evidence": [ { "database": "UniProtKB", "id": "P27361", "url": "https://www.uniprot.org/uniprotkb/P27361" }, { "database": "iPTMnet", "id": "P27361", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P27361" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "18707149", "url": "https://pubmed.ncbi.nlm.nih.gov/18707149" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PRO", "id": "P27361", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P27361" }, { "database": "PubMed", "id": "17192257", "url": "https://pubmed.ncbi.nlm.nih.gov/17192257" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "18983981", "url": "https://pubmed.ncbi.nlm.nih.gov/18983981" }, { "database": "PubMed", "id": "19412549", "url": "https://pubmed.ncbi.nlm.nih.gov/19412549" }, { "database": "PubMed", "id": "20226096", "url": "https://pubmed.ncbi.nlm.nih.gov/20226096" }, { "database": "PubMed", "id": "20429916", "url": "https://pubmed.ncbi.nlm.nih.gov/20429916" }, { "database": "PubMed", "id": "20485667", "url": "https://pubmed.ncbi.nlm.nih.gov/20485667" }, { "database": "PubMed", "id": "20509944", "url": "https://pubmed.ncbi.nlm.nih.gov/20509944" }, { "database": "PubMed", "id": "20957203", "url": "https://pubmed.ncbi.nlm.nih.gov/20957203" }, { "database": "PubMed", "id": "21129151", "url": "https://pubmed.ncbi.nlm.nih.gov/21129151" }, { "database": "PubMed", "id": "21187008", "url": "https://pubmed.ncbi.nlm.nih.gov/21187008" }, { "database": "PubMed", "id": "21210654", "url": "https://pubmed.ncbi.nlm.nih.gov/21210654" }, { "database": "PubMed", "id": "22031842", "url": "https://pubmed.ncbi.nlm.nih.gov/22031842" }, { "database": "PubMed", "id": "22096605", "url": "https://pubmed.ncbi.nlm.nih.gov/22096605" }, { "database": "PubMed", "id": "22347457", "url": "https://pubmed.ncbi.nlm.nih.gov/22347457" }, { "database": "PubMed", "id": "22815910", "url": "https://pubmed.ncbi.nlm.nih.gov/22815910" }, { "database": "PubMed", "id": "22909302", "url": "https://pubmed.ncbi.nlm.nih.gov/22909302" }, { "database": "PubMed", "id": "23056203", "url": "https://pubmed.ncbi.nlm.nih.gov/23056203" }, { "database": "PubMed", "id": "23086641", "url": "https://pubmed.ncbi.nlm.nih.gov/23086641" }, { "database": "PubMed", "id": "23353780", "url": "https://pubmed.ncbi.nlm.nih.gov/23353780" }, { "database": "PubMed", "id": "23620784", "url": "https://pubmed.ncbi.nlm.nih.gov/23620784" }, { "database": "PubMed", "id": "23686305", "url": "https://pubmed.ncbi.nlm.nih.gov/23686305" }, { "database": "PubMed", "id": "23727359", "url": "https://pubmed.ncbi.nlm.nih.gov/23727359" }, { "database": "PubMed", "id": "23977025", "url": "https://pubmed.ncbi.nlm.nih.gov/23977025" }, { "database": "PubMed", "id": "24065881", "url": "https://pubmed.ncbi.nlm.nih.gov/24065881" }, { "database": "PubMed", "id": "24300666", "url": "https://pubmed.ncbi.nlm.nih.gov/24300666" }, { "database": "PubMed", "id": "24376606", "url": "https://pubmed.ncbi.nlm.nih.gov/24376606" }, { "database": "PubMed", "id": "24521094", "url": "https://pubmed.ncbi.nlm.nih.gov/24521094" }, { "database": "PubMed", "id": "24810160", "url": "https://pubmed.ncbi.nlm.nih.gov/24810160" }, { "database": "PubMed", "id": "24853429", "url": "https://pubmed.ncbi.nlm.nih.gov/24853429" }, { "database": "PubMed", "id": "25179402", "url": "https://pubmed.ncbi.nlm.nih.gov/25179402" }, { "database": "PubMed", "id": "25221952", "url": "https://pubmed.ncbi.nlm.nih.gov/25221952" }, { "database": "PubMed", "id": "25261871", "url": "https://pubmed.ncbi.nlm.nih.gov/25261871" }, { "database": "PubMed", "id": "25733818", "url": "https://pubmed.ncbi.nlm.nih.gov/25733818" }, { "database": "PubMed", "id": "25849721", "url": "https://pubmed.ncbi.nlm.nih.gov/25849721" }, { "database": "PubMed", "id": "26046303", "url": "https://pubmed.ncbi.nlm.nih.gov/26046303" }, { "database": "PubMed", "id": "26379399", "url": "https://pubmed.ncbi.nlm.nih.gov/26379399" }, { "database": "PubMed", "id": "26400984", "url": "https://pubmed.ncbi.nlm.nih.gov/26400984" }, { "database": "PubMed", "id": "26580203", "url": "https://pubmed.ncbi.nlm.nih.gov/26580203" }, { "database": "PubMed", "id": "26716515", "url": "https://pubmed.ncbi.nlm.nih.gov/26716515" }, { "database": "PubMed", "id": "26919095", "url": "https://pubmed.ncbi.nlm.nih.gov/26919095" }, { "database": "PubMed", "id": "26945908", "url": "https://pubmed.ncbi.nlm.nih.gov/26945908" }, { "database": "PubMed", "id": "26983806", "url": "https://pubmed.ncbi.nlm.nih.gov/26983806" }, { "database": "PubMed", "id": "27054717", "url": "https://pubmed.ncbi.nlm.nih.gov/27054717" }, { "database": "PubMed", "id": "27119567", "url": "https://pubmed.ncbi.nlm.nih.gov/27119567" }, { "database": "PubMed", "id": "27134571", "url": "https://pubmed.ncbi.nlm.nih.gov/27134571" }, { "database": "PubMed", "id": "27304216", "url": "https://pubmed.ncbi.nlm.nih.gov/27304216" }, { "database": "PubMed", "id": "27533246", "url": "https://pubmed.ncbi.nlm.nih.gov/27533246" }, { "database": "PubMed", "id": "27542844", "url": "https://pubmed.ncbi.nlm.nih.gov/27542844" }, { "database": "PubMed", "id": "28387310", "url": "https://pubmed.ncbi.nlm.nih.gov/28387310" }, { "database": "PubMed", "id": "28481292", "url": "https://pubmed.ncbi.nlm.nih.gov/28481292" }, { "database": "PubMed", "id": "28598976", "url": "https://pubmed.ncbi.nlm.nih.gov/28598976" }, { "database": "PubMed", "id": "28771223", "url": "https://pubmed.ncbi.nlm.nih.gov/28771223" }, { "database": "PubMed", "id": "28848389", "url": "https://pubmed.ncbi.nlm.nih.gov/28848389" }, { "database": "PubMed", "id": "28915272", "url": "https://pubmed.ncbi.nlm.nih.gov/28915272" }, { "database": "PubMed", "id": "29154190", "url": "https://pubmed.ncbi.nlm.nih.gov/29154190" }, { "database": "PubMed", "id": "29368606", "url": "https://pubmed.ncbi.nlm.nih.gov/29368606" }, { "database": "PubMed", "id": "29412140", "url": "https://pubmed.ncbi.nlm.nih.gov/29412140" }, { "database": "PubMed", "id": "29435164", "url": "https://pubmed.ncbi.nlm.nih.gov/29435164" }, { "database": "PubMed", "id": "29615689", "url": "https://pubmed.ncbi.nlm.nih.gov/29615689" }, { "database": "PubMed", "id": "29766336", "url": "https://pubmed.ncbi.nlm.nih.gov/29766336" }, { "database": "PubMed", "id": "29986550", "url": "https://pubmed.ncbi.nlm.nih.gov/29986550" }, { "database": "PubMed", "id": "30853827", "url": "https://pubmed.ncbi.nlm.nih.gov/30853827" }, { "database": "PubMed", "id": "30853914", "url": "https://pubmed.ncbi.nlm.nih.gov/30853914" }, { "database": "PubMed", "id": "30986276", "url": "https://pubmed.ncbi.nlm.nih.gov/30986276" }, { "database": "PubMed", "id": "31116709", "url": "https://pubmed.ncbi.nlm.nih.gov/31116709" }, { "database": "PubMed", "id": "31612114", "url": "https://pubmed.ncbi.nlm.nih.gov/31612114" }, { "database": "PubMed", "id": "31910234", "url": "https://pubmed.ncbi.nlm.nih.gov/31910234" }, { "database": "PubMed", "id": "32188029", "url": "https://pubmed.ncbi.nlm.nih.gov/32188029" }, { "database": "PubMed", "id": "32316166", "url": "https://pubmed.ncbi.nlm.nih.gov/32316166" }, { "database": "PubMed", "id": "32872257", "url": "https://pubmed.ncbi.nlm.nih.gov/32872257" }, { "database": "PubMed", "id": "32998746", "url": "https://pubmed.ncbi.nlm.nih.gov/32998746" }, { "database": "PubMed", "id": "33072436", "url": "https://pubmed.ncbi.nlm.nih.gov/33072436" }, { "database": "PubMed", "id": "33101052", "url": "https://pubmed.ncbi.nlm.nih.gov/33101052" }, { "database": "PubMed", "id": "33114687", "url": "https://pubmed.ncbi.nlm.nih.gov/33114687" }, { "database": "PubMed", "id": "33171947", "url": "https://pubmed.ncbi.nlm.nih.gov/33171947" }, { "database": "PubMed", "id": "33686185", "url": "https://pubmed.ncbi.nlm.nih.gov/33686185" }, { "database": "PubMed", "id": "33828192", "url": "https://pubmed.ncbi.nlm.nih.gov/33828192" }, { "database": "PubMed", "id": "8626767", "url": "https://pubmed.ncbi.nlm.nih.gov/8626767" }, { "database": "PubMed", "id": "19494114", "url": "https://pubmed.ncbi.nlm.nih.gov/19494114" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Tyr204", "uniprot_canonical_ac": "P27361-1" } ], "record_id": "pubmed.27119567", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Long non-coding RNA MIR22HG suppresses the chondrogenic differentiation of human adipose-derived stem cells by interacting with CTCF to upregulate CRLF1.", "journal": "Functional & integrative genomics", "date": "2023-11-01", "authors": "Guo Jiajia, Ye Wang, Wu Xinglin, Huang Haifeng, Li Bo, Ren Zhijing, Yang Zhen", "reference": { "type": "PubMed", "id": "37910254", "url": "https://pubmed.ncbi.nlm.nih.gov/37910254" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37910254", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and validation of CRLF1 and NRG1 as immune-related signatures in hypertrophic scar.", "journal": "Genomics", "date": "2024-01-21", "authors": "Yu Boya, Cao Yalei, Li Shiyi, Bai Ruiqi, Zhou Guiwen, Fu Qiang, Liang Liming, Gu Weijie, Zhang Lixia, Chen Minliang", "reference": { "type": "PubMed", "id": "38262564", "url": "https://pubmed.ncbi.nlm.nih.gov/38262564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38262564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ENO1 regulates IL-1\u03b2-induced chondrocyte inflammation, apoptosis and matrix degradation possibly through the potential binding to CRLF1.", "journal": "Tissue & cell", "date": "2024-10", "authors": "Lu Zhihua, Wang Dandan, Sun Yuzhe, Dai Yan", "reference": { "type": "PubMed", "id": "39116531", "url": "https://pubmed.ncbi.nlm.nih.gov/39116531" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39116531", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CRLF1 bridges AKT and mTORC2 through SIN1 to inhibit pyroptosis and enhance chemo-resistance in ovarian cancer.", "journal": "Cell death & disease", "date": "2024-09-10", "authors": "Xiang Cong, Chen Li, Zhu Shilei, Chen Yue, Huang Haodong, Yang Chunmao, Chi Yugang, Wang Yanzhou, Lei Yunlong, Cai Xiongwei", "reference": { "type": "PubMed", "id": "39256356", "url": "https://pubmed.ncbi.nlm.nih.gov/39256356" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39256356", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epstein-Barr virus-induced gene 3 and the p35 subunit of interleukin 12 form a novel heterodimeric hematopoietin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Devergne O, Birkenbach M, Kieff E", "reference": { "type": "PubMed", "id": "9342359", "url": "https://pubmed.ncbi.nlm.nih.gov/9342359" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40189-1", "protein_name": "Interleukin-6 receptor subunit beta", "gene_name": "IL6ST", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEV9-1", "protein_name": "Interleukin-27 subunit alpha", "gene_name": "IL27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14213-1", "protein_name": "Interleukin-27 subunit beta", "gene_name": "EBI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14765-1", "protein_name": "Signal transducer and activator of transcription 4", "gene_name": "STAT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27824-1", "protein_name": "Calnexin", "gene_name": "CANX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29597-1", "protein_name": "Non-receptor tyrosine-protein kinase TYK2", "gene_name": "TYK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99665-1", "protein_name": "Interleukin-12 receptor subunit beta-2", "gene_name": "IL12RB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWB1-1", "protein_name": "Interleukin-27 receptor subunit alpha", "gene_name": "IL27RA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29459-1", "protein_name": "Interleukin-12 subunit alpha", "gene_name": "IL12A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23458-1", "protein_name": "Tyrosine-protein kinase JAK1", "gene_name": "JAK1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9342359", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytokine-like factor-1, a novel soluble protein, shares homology with members of the cytokine type I receptor family.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1998", "authors": "Elson GC, Graber P, Losberger C, Herren S, Gretener D, Menoud LN, Wells TN, Kosco-Vilbois MH, Gauchat JF", "reference": { "type": "PubMed", "id": "9686600", "url": "https://pubmed.ncbi.nlm.nih.gov/9686600" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75462-1", "protein_name": "Cytokine receptor-like factor 1", "gene_name": "CRLF1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75462", "url": "https://www.uniprot.org/uniprotkb/O75462" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9686600", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Processing of rat preprocortistatin in mouse AtT-20 cells.", "journal": "Journal of neurochemistry", "date": "1999", "authors": "Puebla L, Mouchantaf R, Sasi R, Khare S, Bennett HP, James S, Patel YC", "reference": { "type": "PubMed", "id": "10461921", "url": "https://pubmed.ncbi.nlm.nih.gov/10461921" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00230-1", "protein_name": "Cortistatin", "gene_name": "CORT", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00230", "url": "https://www.uniprot.org/uniprotkb/O00230" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10461921", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MrgX2 is a high potency cortistatin receptor expressed in dorsal root ganglion.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Robas N, Mead E, Fidock M", "reference": { "type": "PubMed", "id": "12915402", "url": "https://pubmed.ncbi.nlm.nih.gov/12915402" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00230-1", "protein_name": "Cortistatin", "gene_name": "CORT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LB1-1", "protein_name": "Mas-related G protein-coupled receptor member X2", "gene_name": "MRGPRX2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00230", "url": "https://www.uniprot.org/uniprotkb/O00230" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12915402", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure, function and pharmacology of human itch GPCRs.", "journal": "Nature", "date": "2021", "authors": "Cao C, Kang HJ, Singh I, Chen H, Zhang C, Ye W, Hayes BW, Liu J, Gumpper RH, Bender BJ, Slocum ST, Krumm BE, Lansu K, McCorvy JD, Kroeze WK, English JG, DiBerto JF, Olsen RHJ, Huang XP, Zhang S, Liu Y, Kim K, Karpiak J, Jan LY, Abraham SN, Jin J, Shoichet BK, Fay JF, Roth BL", "reference": { "type": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00230-1", "protein_name": "Cortistatin", "gene_name": "CORT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LA9-1", "protein_name": "Mas-related G protein-coupled receptor member X4", "gene_name": "MRGPRX4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LB1-1", "protein_name": "Mas-related G protein-coupled receptor member X2", "gene_name": "MRGPRX2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00230", "url": "https://www.uniprot.org/uniprotkb/O00230" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 158, "end_pos": 158, "sequence_org": "W", "sequence_mut": "A", "comment": "Decreased activation by phosphate-modified drugs, such as fospropofol. Decreased activation by agonists.", "evidence": [ { "database": "UniProtKB", "id": "Q96LA9", "url": "https://www.uniprot.org/uniprotkb/Q96LA9" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" }, { "database": "PubMed", "id": "38718132", "url": "https://pubmed.ncbi.nlm.nih.gov/38718132" } ], "uniprot_canonical_ac": "Q96LA9-1" }, { "start_pos": 240, "end_pos": 240, "sequence_org": "Y", "sequence_mut": "A", "comment": "Decreased binding to 3-sulfated bile acids. Decreased activation by agonists.", "evidence": [ { "database": "UniProtKB", "id": "Q96LA9", "url": "https://www.uniprot.org/uniprotkb/Q96LA9" }, { "database": "PubMed", "id": "39476841", "url": "https://pubmed.ncbi.nlm.nih.gov/39476841" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" } ], "uniprot_canonical_ac": "Q96LA9-1" }, { "start_pos": 82, "end_pos": 82, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreased binding to 3-sulfated bile acids. Decreased activation by phosphate-modified drugs, such as fospropofol. Decreased activation by agonists.", "evidence": [ { "database": "UniProtKB", "id": "Q96LA9", "url": "https://www.uniprot.org/uniprotkb/Q96LA9" }, { "database": "PubMed", "id": "39476841", "url": "https://pubmed.ncbi.nlm.nih.gov/39476841" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" }, { "database": "PubMed", "id": "38718132", "url": "https://pubmed.ncbi.nlm.nih.gov/38718132" } ], "uniprot_canonical_ac": "Q96LA9-1" }, { "start_pos": 95, "end_pos": 95, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreased binding to 3-sulfated bile acids. Decreased activation by phosphate-modified drugs, such as fospropofol. Decreased activation by agonists.", "evidence": [ { "database": "UniProtKB", "id": "Q96LA9", "url": "https://www.uniprot.org/uniprotkb/Q96LA9" }, { "database": "PubMed", "id": "39476841", "url": "https://pubmed.ncbi.nlm.nih.gov/39476841" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" }, { "database": "PubMed", "id": "38718132", "url": "https://pubmed.ncbi.nlm.nih.gov/38718132" } ], "uniprot_canonical_ac": "Q96LA9-1" }, { "start_pos": 96, "end_pos": 96, "sequence_org": "K", "sequence_mut": "A", "comment": "Decreased binding to 3-sulfated bile acids. Decreased activation by agonists.", "evidence": [ { "database": "UniProtKB", "id": "Q96LA9", "url": "https://www.uniprot.org/uniprotkb/Q96LA9" }, { "database": "PubMed", "id": "39476841", "url": "https://pubmed.ncbi.nlm.nih.gov/39476841" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" } ], "uniprot_canonical_ac": "Q96LA9-1" }, { "start_pos": 164, "end_pos": 164, "sequence_org": "E", "sequence_mut": "A", "comment": "Decreased G protein-coupled receptor signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q96LB1", "url": "https://www.uniprot.org/uniprotkb/Q96LB1" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" } ], "uniprot_canonical_ac": "Q96LB1-1" }, { "start_pos": 168, "end_pos": 168, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolished G protein-coupled receptor signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q96LB1", "url": "https://www.uniprot.org/uniprotkb/Q96LB1" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" }, { "database": "PubMed", "id": "34789875", "url": "https://pubmed.ncbi.nlm.nih.gov/34789875" } ], "uniprot_canonical_ac": "Q96LB1-1" }, { "start_pos": 170, "end_pos": 170, "sequence_org": "F", "sequence_mut": "A", "comment": "Decreased G protein-coupled receptor signaling in response to cortistatin-14 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q96LB1", "url": "https://www.uniprot.org/uniprotkb/Q96LB1" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" }, { "database": "PubMed", "id": "34789875", "url": "https://pubmed.ncbi.nlm.nih.gov/34789875" } ], "uniprot_canonical_ac": "Q96LB1-1" }, { "start_pos": 180, "end_pos": 180, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolished G protein-coupled receptor signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q96LB1", "url": "https://www.uniprot.org/uniprotkb/Q96LB1" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" } ], "uniprot_canonical_ac": "Q96LB1-1" }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "A", "comment": "Decreased G protein-coupled receptor signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q96LB1", "url": "https://www.uniprot.org/uniprotkb/Q96LB1" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" } ], "uniprot_canonical_ac": "Q96LB1-1" }, { "start_pos": 243, "end_pos": 243, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolished G protein-coupled receptor signaling in response to cortistatin-14 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q96LB1", "url": "https://www.uniprot.org/uniprotkb/Q96LB1" }, { "database": "PubMed", "id": "34789874", "url": "https://pubmed.ncbi.nlm.nih.gov/34789874" } ], "uniprot_canonical_ac": "Q96LB1-1" } ], "record_id": "pubmed.34789874", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Somatostatin, Cortistatin and Their Receptors Exert Antitumor Actions in Androgen-Independent Prostate Cancer Cells: Critical Role of Endogenous Cortistatin.", "journal": "International journal of molecular sciences", "date": "2022-10-27", "authors": "S\u00e1ez-Mart\u00ednez Prudencio, Porcel-Pastrana Francisco, P\u00e9rez-G\u00f3mez Jes\u00fas M, Pedraza-Ar\u00e9valo Sergio, G\u00f3mez-G\u00f3mez Enrique, Jim\u00e9nez-Vacas Juan M, Gahete Manuel D, Luque Ra\u00fal M", "reference": { "type": "PubMed", "id": "36361790", "url": "https://pubmed.ncbi.nlm.nih.gov/36361790" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00230-1", "protein_name": "Cortistatin", "gene_name": "CORT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61278-1", "protein_name": "Somatostatin", "gene_name": "SST", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00230", "url": "https://www.uniprot.org/uniprotkb/O00230" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36361790", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cortistatin deficiency reveals a dysfunctional brain endothelium with impaired gene pathways, exacerbated immune activation, and disrupted barrier integrity.", "journal": "Journal of neuroinflammation", "date": "2023-10-04", "authors": "Castillo-Gonz\u00e1lez Julia, Ruiz Jos\u00e9 Luis, Serrano-Mart\u00ednez Ignacio, Forte-Lago Irene, Ubago-Rodriguez Ana, Caro Marta, P\u00e9rez-G\u00f3mez Jes\u00fas Miguel, Ben\u00edtez-Troncoso Alejandro, Andr\u00e9s-Le\u00f3n Eduardo, S\u00e1nchez-Navarro Macarena, Luque Ra\u00fal M, Gonz\u00e1lez-Rey Elena", "reference": { "type": "PubMed", "id": "37794493", "url": "https://pubmed.ncbi.nlm.nih.gov/37794493" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00230-1", "protein_name": "Cortistatin", "gene_name": "CORT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56469-1", "protein_name": "Cortistatin", "gene_name": "Cort", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00230", "url": "https://www.uniprot.org/uniprotkb/O00230" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37794493", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]