[ { "title": "Probe Substrate Dependencies in CYP3A4 Allosteric Inhibition: A Novel Molecular Mechanism Involving F-F' Loop Perturbations.", "journal": "Journal of chemical information and modeling", "date": "2024-03-25", "authors": "Wei Wan, Tang Lloyd Wei Tat, Verma Ravi Kumar, Fan Hao, Chan Eric Chun Yong", "reference": { "type": "PubMed", "id": "38457234", "url": "https://pubmed.ncbi.nlm.nih.gov/38457234" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38457234", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polymorphism of CYP3A4*18 is associated with anti-tuberculosis drug-induced hepatotoxicity.", "journal": "Pharmacogenomics", "date": "2024", "authors": "Lee Shih-Wei, Chen Pei-Tzu, Liu Chi-Wei, Li Yuan-Hsu, Wu Lawrence Shih-Hsin", "reference": { "type": "PubMed", "id": "38884784", "url": "https://pubmed.ncbi.nlm.nih.gov/38884784" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38884784", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of an inducible form of cytochrome P-450 in human liver.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1985", "authors": "Watkins P B, Wrighton S A, Maurel P, Schuetz E G, Mendez-Picon G, Parker G A, Guzelian P S", "reference": { "type": "PubMed", "id": "3898085", "url": "https://pubmed.ncbi.nlm.nih.gov/3898085" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3898085", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effects of CYP3A4 genetic polymorphisms on the pharmacokinetics and efficacy of perampanel in Chinese pediatric patients with epilepsy.", "journal": "Seizure", "date": "2024-08", "authors": "Zhao Ting, Li Hong-Jian, Zhang Hui-Lan, Feng Ji-Rong, Yu Jing, Sun Ke-Fang, Feng Jie, Sun Yan, Yu Lu-Hai", "reference": { "type": "PubMed", "id": "38996572", "url": "https://pubmed.ncbi.nlm.nih.gov/38996572" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38996572", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic variation present in the CYP3A4 gene in Ni-Vanuatu and Kenyan populations in malaria endemicity.", "journal": "Drug metabolism and pharmacokinetics", "date": "2024-08", "authors": "Musyoka Kelvin, Chan Chim W, Guti\u00e9rrez Rico Evelyn Marie, Omondi Protus, Kijogi Caroline, Okai Takatsugu, Kongere James, Ngara Mtakai, Kagaya Wataru, Kanoi Bernard N, Hiratsuka Masahiro, Kido Yasutoshi, Gitaka Jesse, Kaneko Akira", "reference": { "type": "PubMed", "id": "39079373", "url": "https://pubmed.ncbi.nlm.nih.gov/39079373" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39079373", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CYP3A gene expression in human gut epithelium.", "journal": "Pharmacogenetics", "date": "1994", "authors": "Kolars J C, Lown K S, Schmiedlin-Ren P, Ghosh M, Fang C, Wrighton S A, Merion R M, Watkins P B", "reference": { "type": "PubMed", "id": "7894497", "url": "https://pubmed.ncbi.nlm.nih.gov/7894497" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7894497", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interindividual variations in human liver cytochrome P-450 enzymes involved in the oxidation of drugs, carcinogens and toxic chemicals: studies with liver microsomes of 30 Japanese and 30 Caucasians.", "journal": "J. Pharmacol. Exp. Ther.", "date": "1994", "authors": "Shimada T, Yamazaki H, Mimura M, Inui Y, Guengerich F P", "reference": { "type": "PubMed", "id": "8035341", "url": "https://pubmed.ncbi.nlm.nih.gov/8035341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8035341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of human cytochrome P450 isoforms involved in the 3-hydroxylation of quinine by human live microsomes and nine recombinant human cytochromes P450.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1996-12", "authors": "Zhao X J, Yokoyama H, Chiba K, Wanwimolruk S, Ishizaki T", "reference": { "type": "PubMed", "id": "8968357", "url": "https://pubmed.ncbi.nlm.nih.gov/8968357" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8968357", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human liver paraoxonase (PON1): subcellular distribution and characterization.", "journal": "Journal of biochemical and molecular toxicology", "date": "1998", "authors": "Gonzalvo MC, Gil F, Hernandez AF, Rodrigo L, Villanueva E, Pla A", "reference": { "type": "PubMed", "id": "9414488", "url": "https://pubmed.ncbi.nlm.nih.gov/9414488" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15166-1", "protein_name": "Serum paraoxonase/lactonase 3", "gene_name": "PON3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPD5-1", "protein_name": "Solute carrier organic anion transporter family member 1B3", "gene_name": "SLCO1B3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6L6-1", "protein_name": "Solute carrier organic anion transporter family member 1B1", "gene_name": "SLCO1B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08183-1", "protein_name": "ATP-dependent translocase ABCB1", "gene_name": "ABCB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27169-1", "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35503-1", "protein_name": "UDP-glucuronosyltransferase 1A3", "gene_name": "UGT1A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92887-1", "protein_name": "ATP-binding cassette sub-family C member 2", "gene_name": "ABCC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9414488", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytochromes P450 with bisallylic hydroxylation activity on arachidonic and linoleic acids studied with human recombinant enzymes and with human and rat liver microsomes.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1998", "authors": "Bylund J, Kunz T, Valmsen K, Oliw EH", "reference": { "type": "PubMed", "id": "9435160", "url": "https://pubmed.ncbi.nlm.nih.gov/9435160" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08684-1", "protein_name": "Cytochrome P450 3A4", "gene_name": "CYP3A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05177-1", "protein_name": "Cytochrome P450 1A2", "gene_name": "CYP1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16678-1", "protein_name": "Cytochrome P450 1B1", "gene_name": "CYP1B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33261-1", "protein_name": "Cytochrome P450 2C19", "gene_name": "CYP2C19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10632-1", "protein_name": "Cytochrome P450 2C8", "gene_name": "CYP2C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11712-1", "protein_name": "Cytochrome P450 2C9", "gene_name": "CYP2C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z449-1", "protein_name": "Cytochrome P450 2U1", "gene_name": "CYP2U1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04798-1", "protein_name": "Cytochrome P450 1A1", "gene_name": "CYP1A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P08684", "url": "https://www.uniprot.org/uniprotkb/P08684" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9435160", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An Integrative Pan-Cancer Analysis of the Oncogenic Role of COPB2 in Human Tumors.", "journal": "BioMed research international", "date": "2021", "authors": "Wu B, Wu Y, Guo X, Yue Y, Li Y, He X, Chen Y, Zhao W, Liu J, Wu X, Shen A, Zhang S", "reference": { "type": "PubMed", "id": "34676262", "url": "https://pubmed.ncbi.nlm.nih.gov/34676262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35606", "url": "https://www.uniprot.org/uniprotkb/P35606" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34676262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comprehensive analysis reveals COPB2 and RYK associated with tumor stages of larynx squamous cell carcinoma.", "journal": "BMC cancer", "date": "2022", "authors": "Zhou G, Zhang S, Jin M, Hu S", "reference": { "type": "PubMed", "id": "35715770", "url": "https://pubmed.ncbi.nlm.nih.gov/35715770" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34925-1", "protein_name": "Inactive tyrosine-protein kinase RYK", "gene_name": "RYK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35606", "url": "https://www.uniprot.org/uniprotkb/P35606" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35715770", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A 102 kDa subunit of a Golgi-associated particle has homology to beta subunits of trimeric G proteins.", "journal": "EMBO J.", "date": "1993", "authors": "Harrison-Lavoie K J, Lewis V A, Hynes G M, Collison K S, Nutland E, Willison K R", "reference": { "type": "PubMed", "id": "8335000", "url": "https://pubmed.ncbi.nlm.nih.gov/8335000" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35606", "url": "https://www.uniprot.org/uniprotkb/P35606" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8335000", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CHES1/FOXN3 interacts with Ski-interacting protein and acts as a transcriptional repressor.", "journal": "Gene", "date": "2005", "authors": "Scott KL, Plon SE", "reference": { "type": "PubMed", "id": "16102918", "url": "https://pubmed.ncbi.nlm.nih.gov/16102918" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00409-1", "protein_name": "Forkhead box protein N3", "gene_name": "FOXN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13573-1", "protein_name": "SNW domain-containing protein 1", "gene_name": "SNW1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00409", "url": "https://www.uniprot.org/uniprotkb/O00409" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16102918", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FOXN3 suppresses the growth and invasion of papillary thyroid cancer through the inactivation of Wnt/beta-catenin pathway.", "journal": "Molecular and cellular endocrinology", "date": "2020", "authors": "Zhao C, Mo L, Li C, Han S, Zhao W, Liu L", "reference": { "type": "PubMed", "id": "32619584", "url": "https://pubmed.ncbi.nlm.nih.gov/32619584" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00409-1", "protein_name": "Forkhead box protein N3", "gene_name": "FOXN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00409", "url": "https://www.uniprot.org/uniprotkb/O00409" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32619584", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miR-574-5p Targets FOXN3 to Regulate the Invasion of Nasopharyngeal Carcinoma Cells via Wnt/beta-Catenin Pathway.", "journal": "Technology in cancer research & treatment", "date": "2020", "authors": "Lin Z, Chen M, Wan Y, Lei L, Ruan H", "reference": { "type": "PubMed", "id": "33317407", "url": "https://pubmed.ncbi.nlm.nih.gov/33317407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00409-1", "protein_name": "Forkhead box protein N3", "gene_name": "FOXN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00409", "url": "https://www.uniprot.org/uniprotkb/O00409" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33317407", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FOXN3 inhibits cell proliferation and invasion via modulating the AKT/MDM2/p53 axis in human glioma.", "journal": "Aging", "date": "2021", "authors": "Wang C, Tu H, Yang L, Ma C, Hu J, Luo J, Wang H", "reference": { "type": "PubMed", "id": "34511432", "url": "https://pubmed.ncbi.nlm.nih.gov/34511432" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00409-1", "protein_name": "Forkhead box protein N3", "gene_name": "FOXN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00409", "url": "https://www.uniprot.org/uniprotkb/O00409" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34511432", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CHES1 modulated tumorigenesis and senescence of pancreas cancer cells through repressing AKR1B10.", "journal": "Biochimica et biophysica acta. Molecular basis of disease", "date": "2024-08", "authors": "Kong Demin, Wu Yingying, Tong Binghua, Liang Yonghui, Xu Fuyi, Chi Xiaodong, Ni Lei, Tian Geng, Zhang Guilong, Xu Zhaowei", "reference": { "type": "PubMed", "id": "38718846", "url": "https://pubmed.ncbi.nlm.nih.gov/38718846" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00409-1", "protein_name": "Forkhead box protein N3", "gene_name": "FOXN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60218-1", "protein_name": "Aldo-keto reductase family 1 member B10", "gene_name": "AKR1B10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00409", "url": "https://www.uniprot.org/uniprotkb/O00409" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38718846", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reconstitution of a MEC1-independent checkpoint in yeast by expression of a novel human fork head cDNA.", "journal": "Mol. Cell. Biol.", "date": "1997", "authors": "Pati D, Keller C, Groudine M, Plon S E", "reference": { "type": "PubMed", "id": "9154802", "url": "https://pubmed.ncbi.nlm.nih.gov/9154802" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00409-1", "protein_name": "Forkhead box protein N3", "gene_name": "FOXN3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00409", "url": "https://www.uniprot.org/uniprotkb/O00409" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9154802", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of eight genes encoding chemokine-like factor superfamily members 1-8 (CKLFSF1-8) by in silico cloning and experimental validation.", "journal": "Genomics", "date": "2003", "authors": "Han W, Ding P, Xu M, Wang L, Rui M, Shi S, Liu Y, Zheng Y, Chen Y, Yang T, Ma D", "reference": { "type": "PubMed", "id": "12782130", "url": "https://pubmed.ncbi.nlm.nih.gov/12782130" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MX0-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 3", "gene_name": "CMTM3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZV2-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 8", "gene_name": "CMTM8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NX76-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 6", "gene_name": "CMTM6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FZ5-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 7", "gene_name": "CMTM7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZR5-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 4", "gene_name": "CMTM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZ96-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 1", "gene_name": "CMTM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAZ6-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 2", "gene_name": "CMTM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96DZ9-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 5", "gene_name": "CMTM5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MX0", "url": "https://www.uniprot.org/uniprotkb/Q96MX0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12782130", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization and expression profile of CMTM3/CKLFSF3.", "journal": "Journal of biochemistry and molecular biology", "date": "2006", "authors": "Zhong J, Wang Y, Qiu X, Mo X, Liu Y, Li T, Song Q, Ma D, Han W", "reference": { "type": "PubMed", "id": "17002874", "url": "https://pubmed.ncbi.nlm.nih.gov/17002874" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MX0-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 3", "gene_name": "CMTM3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MX0", "url": "https://www.uniprot.org/uniprotkb/Q96MX0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17002874", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CMTM3 can affect the transcription activity of androgen receptor and inhibit the expression level of PSA in LNCaP cells.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Wang Y, Li T, Qiu X, Mo X, Zhang Y, Song Q, Ma D, Han W", "reference": { "type": "PubMed", "id": "18402773", "url": "https://pubmed.ncbi.nlm.nih.gov/18402773" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MX0-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 3", "gene_name": "CMTM3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MX0", "url": "https://www.uniprot.org/uniprotkb/Q96MX0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18402773", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA methylation of CMTM3, SSTR2, and MDFI genes in colorectal cancer.", "journal": "Gene", "date": "2017", "authors": "Li J, Chen C, Bi X, Zhou C, Huang T, Ni C, Yang P, Chen S, Ye M, Duan S", "reference": { "type": "PubMed", "id": "28782576", "url": "https://pubmed.ncbi.nlm.nih.gov/28782576" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MX0-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 3", "gene_name": "CMTM3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MX0", "url": "https://www.uniprot.org/uniprotkb/Q96MX0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28782576", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miR-135b-5p promotes gastric cancer progression by targeting CMTM3.", "journal": "International journal of oncology", "date": "2018", "authors": "Lu M, Huang Y, Sun W, Li P, Li L, Li L", "reference": { "type": "PubMed", "id": "29345297", "url": "https://pubmed.ncbi.nlm.nih.gov/29345297" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MX0-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 3", "gene_name": "CMTM3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MX0", "url": "https://www.uniprot.org/uniprotkb/Q96MX0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29345297", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Familial hypereosinophilia associated with eosinophilic gastrointestinal symptoms in individuals with a missense mutation in CKLF-like MARVEL transmembrane domain containing 3.", "journal": "Clinical and experimental allergy : journal of the British Society for Allergy and Clinical Immunology", "date": "2021", "authors": "Wardlaw AJ, Barwell J, Hitchman C, Shrine N, Bennett N, Adewoye A, Ozturk H, Ntereke T, Wurm P, Tobin M, Gooptu B, Hollox E, Wain LV", "reference": { "type": "PubMed", "id": "34048099", "url": "https://pubmed.ncbi.nlm.nih.gov/34048099" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MX0-1", "protein_name": "CKLF-like MARVEL transmembrane domain-containing protein 3", "gene_name": "CMTM3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MX0", "url": "https://www.uniprot.org/uniprotkb/Q96MX0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34048099", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Orthologues of the Caenorhabditis elegans longevity gene clk-1 in mouse and human.", "journal": "Genomics", "date": "1999", "authors": "Asaumi S, Kuroyanagi H, Seki N, Shirasawa T", "reference": { "type": "PubMed", "id": "10373327", "url": "https://pubmed.ncbi.nlm.nih.gov/10373327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97478-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "Coq7", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10373327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conservation of the Caenorhabditis elegans timing gene clk-1 from yeast to human: a gene required for ubiquinone biosynthesis with potential implications for aging.", "journal": "Mamm. Genome", "date": "1999", "authors": "Vajo Z, King LM, Jonassen T, Wilkin DJ, Ho N, Munnich A, Clarke CF, Francomano CA", "reference": { "type": "PubMed", "id": "10501970", "url": "https://pubmed.ncbi.nlm.nih.gov/10501970" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97478-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "Coq7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10501970", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and functional expression of human COQ3, a gene encoding a methyltransferase required for ubiquinone biosynthesis.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Jonassen T, Clarke CF", "reference": { "type": "PubMed", "id": "10777520", "url": "https://pubmed.ncbi.nlm.nih.gov/10777520" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10777520", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Saccharomyces cerevisiae COQ6 gene encodes a mitochondrial flavin-dependent monooxygenase required for coenzyme Q biosynthesis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Gin P, Hsu AY, Rothman SC, Jonassen T, Lee PT, Tzagoloff A, Clarke CF", "reference": { "type": "PubMed", "id": "12721307", "url": "https://pubmed.ncbi.nlm.nih.gov/12721307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53318-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12721307", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and functional expression of human COQ2, a gene encoding a polyprenyl transferase involved in the synthesis of CoQ.", "journal": "The Biochemical journal", "date": "2004", "authors": "Forsgren M, Attersand A, Lake S, Grunler J, Swiezewska E, Dallner G, Climent I", "reference": { "type": "PubMed", "id": "15153069", "url": "https://pubmed.ncbi.nlm.nih.gov/15153069" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15153069", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of solanesyl and decaprenyl diphosphate synthases in mice and humans.", "journal": "The FEBS journal", "date": "2005", "authors": "Saiki R, Nagata A, Kainou T, Matsuda H, Kawamukai M", "reference": { "type": "PubMed", "id": "16262699", "url": "https://pubmed.ncbi.nlm.nih.gov/16262699" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BH69-1", "protein_name": "Selenide, water dikinase 1", "gene_name": "Sephs1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q33DR2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "Pdss1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q33DR3-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "Pdss2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16262699", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complementation of Saccharomyces cerevisiae coq7 mutants by mitochondrial targeting of the Escherichia coli UbiF polypeptide: two functions of yeast Coq7 polypeptide in coenzyme Q biosynthesis.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Tran UC, Marbois B, Gin P, Gulmezian M, Jonassen T, Clarke CF", "reference": { "type": "PubMed", "id": "16624818", "url": "https://pubmed.ncbi.nlm.nih.gov/16624818" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41735-1", "protein_name": "5-demethoxyubiquinone hydroxylase, mitochondrial", "gene_name": "CAT5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O13525-1", "protein_name": "Ubiquinone biosynthesis protein COQ4, mitochondrial", "gene_name": "COQ4", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 194, "end_pos": 194, "sequence_org": "E", "sequence_mut": "K", "comment": "Lacks ubiquinone and accumulates the intermediate DMQH2, causing respiratory deficiency.", "evidence": [ { "database": "UniProtKB", "id": "P41735", "url": "https://www.uniprot.org/uniprotkb/P41735" }, { "database": "PubMed", "id": "16624818", "url": "https://pubmed.ncbi.nlm.nih.gov/16624818" } ], "uniprot_canonical_ac": "P41735-1" } ], "record_id": "pubmed.16624818", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Missense mutation of the COQ2 gene causes defects of bioenergetics and de novo pyrimidine synthesis.", "journal": "Human molecular genetics", "date": "2007", "authors": "Lopez-Martin JM, Salviati L, Trevisson E, Montini G, DiMauro S, Quinzii C, Hirano M, Rodriguez-Hernandez A, Cordero MD, Sanchez-Alcazar JA, Santos-Ocana C, Navas P", "reference": { "type": "PubMed", "id": "17374725", "url": "https://pubmed.ncbi.nlm.nih.gov/17374725" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17374725", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Investigation of coenzyme Q biosynthesis in human fibroblast and HepG2 cells.", "journal": "Journal of biochemical and biophysical methods", "date": "2008", "authors": "Tekle M, Turunen M, Dallner G, Chojnacki T, Swiezewska E", "reference": { "type": "PubMed", "id": "17916383", "url": "https://pubmed.ncbi.nlm.nih.gov/17916383" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17916383", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coenzyme Q biosynthesis: Coq6 is required for the C5-hydroxylation reaction and substrate analogs rescue Coq6 deficiency.", "journal": "Chemistry & biology", "date": "2011", "authors": "Ozeir M, Muhlenhoff U, Webert H, Lill R, Fontecave M, Pierrel F", "reference": { "type": "PubMed", "id": "21944752", "url": "https://pubmed.ncbi.nlm.nih.gov/21944752" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48360-1", "protein_name": "Probable NADPH:adrenodoxin oxidoreductase, mitochondrial", "gene_name": "ARH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12184-1", "protein_name": "Adrenodoxin homolog, mitochondrial", "gene_name": "YAH1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53318-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 202, "end_pos": 202, "sequence_org": "G", "sequence_mut": "A", "comment": "Accumulates ubiquinone biosynthesis intermediates lacking the C5-ring hydroxyl.", "evidence": [ { "database": "UniProtKB", "id": "P53318", "url": "https://www.uniprot.org/uniprotkb/P53318" }, { "database": "PubMed", "id": "21944752", "url": "https://pubmed.ncbi.nlm.nih.gov/21944752" } ], "uniprot_canonical_ac": "P53318-1" }, { "start_pos": 386, "end_pos": 386, "sequence_org": "G", "sequence_mut": "A", "comment": "Accumulates ubiquinone biosynthesis intermediates lacking the C5-ring hydroxyl; when associated with D-388.", "evidence": [ { "database": "UniProtKB", "id": "P53318", "url": "https://www.uniprot.org/uniprotkb/P53318" }, { "database": "PubMed", "id": "21944752", "url": "https://pubmed.ncbi.nlm.nih.gov/21944752" } ], "uniprot_canonical_ac": "P53318-1" }, { "start_pos": 388, "end_pos": 388, "sequence_org": "N", "sequence_mut": "D", "comment": "Accumulates ubiquinone biosynthesis intermediates lacking the C5-ring hydroxyl; when associated with A-386.", "evidence": [ { "database": "UniProtKB", "id": "P53318", "url": "https://www.uniprot.org/uniprotkb/P53318" }, { "database": "PubMed", "id": "21944752", "url": "https://pubmed.ncbi.nlm.nih.gov/21944752" } ], "uniprot_canonical_ac": "P53318-1" } ], "record_id": "pubmed.21944752", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Detection of suppressed maturation of the human COQ5 protein in the mitochondria following mitochondrial uncoupling by an antibody recognizing both precursor and mature forms of COQ5.", "journal": "Mitochondrion", "date": "2013", "authors": "Chen SW, Liu CC, Yen HC", "reference": { "type": "PubMed", "id": "23354120", "url": "https://pubmed.ncbi.nlm.nih.gov/23354120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23354120", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aging-associated enzyme human clock-1: substrate-mediated reduction of the diiron center for 5-demethoxyubiquinone hydroxylation.", "journal": "Biochemistry", "date": "2013-04-02", "authors": "Lu Tsai-Te, Lee Seung Jae, Apfel Ulf-Peter, Lippard Stephen J", "reference": { "type": "PubMed", "id": "23445365", "url": "https://pubmed.ncbi.nlm.nih.gov/23445365" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23445365", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ADCK4 mutations promote steroid-resistant nephrotic syndrome through CoQ10 biosynthesis disruption.", "journal": "J. Clin. Invest.", "date": "2013", "authors": "Ashraf S, Gee HY, Woerner S, Xie LX, Vega-Warner V, Lovric S, Fang H, Song X, Cattran DC, Avila-Casado C, Paterson AD, Nitschke P, Bole-Feysot C, Cochat P, Esteve-Rudd J, Haberberger B, Allen SJ, Zhou W, Airik R, Otto EA, Barua M, Al-Hamed MH, Kari JA, Evans J, Bierzynska A, Saleem MA, Bockenhauer D, Kleta R, El Desoky S, Hacihamdioglu DO, Gok F, Washburn J, Wiggins RC, Choi M, Lifton RP, Levy S, Han Z, Salviati L, Prokisch H, Williams DS, Pollak M, Clarke CF, Pei Y, Antignac C, Hildebrandt F", "reference": { "type": "PubMed", "id": "24270420", "url": "https://pubmed.ncbi.nlm.nih.gov/24270420" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "A3QJU3-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "coq8b", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6AY19-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "Coq8b", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24270420", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of the human COQ5 C-methyltransferase in coenzyme Q10 biosynthesis.", "journal": "Biochimica et biophysica acta", "date": "2014-11", "authors": "Nguyen Theresa P T, Casarin Alberto, Desbats Maria Andrea, Doimo Mara, Trevisson Eva, Santos-Oca\u00f1a Carlos, Navas Placido, Clarke Catherine F, Salviati Leonardo", "reference": { "type": "PubMed", "id": "25152161", "url": "https://pubmed.ncbi.nlm.nih.gov/25152161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25152161", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitochondrial COQ9 is a lipid-binding protein that associates with COQ7 to enable coenzyme Q biosynthesis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2014", "authors": "Lohman DC, Forouhar F, Beebe ET, Stefely MS, Minogue CE, Ulbrich A, Stefely JA, Sukumar S, Luna-Sanchez M, Jochem A, Lew S, Seetharaman J, Xiao R, Wang H, Westphall MS, Wrobel RL, Everett JK, Mitchell JC, Lopez LC, Coon JJ, Tong L, Pagliarini DJ", "reference": { "type": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05779-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K1Z0-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "Coq9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 135, "end_pos": 135, "sequence_org": "L", "sequence_mut": "E", "comment": "Inability to grow on nonfermentable carbon sources.", "evidence": [ { "database": "UniProtKB", "id": "Q05779", "url": "https://www.uniprot.org/uniprotkb/Q05779" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "Q05779-1" }, { "start_pos": 135, "end_pos": 135, "sequence_org": "L", "sequence_mut": "K", "comment": "Inability to grow on nonfermentable carbon sources.", "evidence": [ { "database": "UniProtKB", "id": "Q05779", "url": "https://www.uniprot.org/uniprotkb/Q05779" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "Q05779-1" }, { "start_pos": 174, "end_pos": 174, "sequence_org": "M", "sequence_mut": "E", "comment": "Impaired ability to grow on nonfermentable carbon sources.", "evidence": [ { "database": "UniProtKB", "id": "Q05779", "url": "https://www.uniprot.org/uniprotkb/Q05779" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "Q05779-1" }, { "start_pos": 185, "end_pos": 185, "sequence_org": "D", "sequence_mut": "K", "comment": "Inability to grow on nonfermentable carbon sources.", "evidence": [ { "database": "UniProtKB", "id": "Q05779", "url": "https://www.uniprot.org/uniprotkb/Q05779" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "Q05779-1" }, { "start_pos": 188, "end_pos": 188, "sequence_org": "W", "sequence_mut": "K", "comment": "Inability to grow on nonfermentable carbon sources.", "evidence": [ { "database": "UniProtKB", "id": "Q05779", "url": "https://www.uniprot.org/uniprotkb/Q05779" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "Q05779-1" }, { "start_pos": 189, "end_pos": 189, "sequence_org": "Y", "sequence_mut": "D", "comment": "Impaired ability to grow on nonfermentable carbon sources.", "evidence": [ { "database": "UniProtKB", "id": "Q05779", "url": "https://www.uniprot.org/uniprotkb/Q05779" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "Q05779-1" }, { "start_pos": 189, "end_pos": 189, "sequence_org": "Y", "sequence_mut": "K", "comment": "Impaired ability to grow on nonfermentable carbon sources.", "evidence": [ { "database": "UniProtKB", "id": "Q05779", "url": "https://www.uniprot.org/uniprotkb/Q05779" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "Q05779-1" }, { "start_pos": 204, "end_pos": 204, "sequence_org": "L", "sequence_mut": "K", "comment": "Impaired ability to grow on nonfermentable carbon sources.", "evidence": [ { "database": "UniProtKB", "id": "Q05779", "url": "https://www.uniprot.org/uniprotkb/Q05779" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "Q05779-1" }, { "start_pos": 239, "end_pos": 313, "sequence_org": "RAVLAGIYNTTELVMMQDSSPDFEDTWRFLENRINDAMNMGHTAKQVKSTGEALVQGLMGAAVTLKNLTGLNQRR", "sequence_mut": "", "comment": "Severely reduces COQ7 protein expression. Severely reduces NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase activity of COQ7. Mutant mice exhibit encephalomyopathy due to a widespread coenzyme Q deficiency and accumulation of demethoxyubiquinone. Lethality between 3 and 6 months of age due to neuronal death and demyelinization with severe vacuolization and astrogliosis in the brain.", "evidence": [ { "database": "UniProtKB", "id": "Q8K1Z0", "url": "https://www.uniprot.org/uniprotkb/Q8K1Z0" }, { "database": "PubMed", "id": "23255162", "url": "https://pubmed.ncbi.nlm.nih.gov/23255162" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "Q8K1Z0-1" }, { "start_pos": 190, "end_pos": 190, "sequence_org": "L", "sequence_mut": "E", "comment": "Impairs interaction with COQ7.", "evidence": [ { "database": "UniProtKB", "id": "O75208", "url": "https://www.uniprot.org/uniprotkb/O75208" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "O75208-1" }, { "start_pos": 227, "end_pos": 227, "sequence_org": "M", "sequence_mut": "E", "comment": "Impairs interaction with COQ7.", "evidence": [ { "database": "UniProtKB", "id": "O75208", "url": "https://www.uniprot.org/uniprotkb/O75208" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "O75208-1" }, { "start_pos": 237, "end_pos": 237, "sequence_org": "D", "sequence_mut": "K", "comment": "Impairs interaction with COQ7.", "evidence": [ { "database": "UniProtKB", "id": "O75208", "url": "https://www.uniprot.org/uniprotkb/O75208" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "O75208-1" }, { "start_pos": 240, "end_pos": 240, "sequence_org": "W", "sequence_mut": "D", "comment": "Abolishes interaction with COQ7.", "evidence": [ { "database": "UniProtKB", "id": "O75208", "url": "https://www.uniprot.org/uniprotkb/O75208" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "O75208-1" }, { "start_pos": 240, "end_pos": 240, "sequence_org": "W", "sequence_mut": "K", "comment": "Abolishes interaction with COQ7.", "evidence": [ { "database": "UniProtKB", "id": "O75208", "url": "https://www.uniprot.org/uniprotkb/O75208" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "O75208-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "Y", "sequence_mut": "D", "comment": "Abolishes interaction with COQ7.", "evidence": [ { "database": "UniProtKB", "id": "O75208", "url": "https://www.uniprot.org/uniprotkb/O75208" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "O75208-1" }, { "start_pos": 241, "end_pos": 241, "sequence_org": "Y", "sequence_mut": "K", "comment": "Abolishes interaction with COQ7.", "evidence": [ { "database": "UniProtKB", "id": "O75208", "url": "https://www.uniprot.org/uniprotkb/O75208" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "O75208-1" }, { "start_pos": 256, "end_pos": 256, "sequence_org": "L", "sequence_mut": "K", "comment": "Impairs interaction with COQ7.", "evidence": [ { "database": "UniProtKB", "id": "O75208", "url": "https://www.uniprot.org/uniprotkb/O75208" }, { "database": "PubMed", "id": "25339443", "url": "https://pubmed.ncbi.nlm.nih.gov/25339443" } ], "uniprot_canonical_ac": "O75208-1" } ], "record_id": "pubmed.25339443", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A nuclear role for the respiratory enzyme CLK-1 in regulating mitochondrial stress responses and longevity.", "journal": "Nature cell biology", "date": "2015", "authors": "Monaghan RM, Barnes RG, Fisher K, Andreou T, Rooney N, Poulin GB, Whitmarsh AJ", "reference": { "type": "PubMed", "id": "25961505", "url": "https://pubmed.ncbi.nlm.nih.gov/25961505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 28, "end_pos": 28, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduces nuclear localization. Increases level of reactive oxygen species (ROS).", "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" }, { "database": "PubMed", "id": "25961505", "url": "https://pubmed.ncbi.nlm.nih.gov/25961505" } ], "uniprot_canonical_ac": "Q99807-1" } ], "record_id": "pubmed.25961505", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rescue of primary ubiquinone deficiency due to a novel COQ7 defect using 2,4-dihydroxybensoic acid.", "journal": "Journal of medical genetics", "date": "2015", "authors": "Freyer C, Stranneheim H, Naess K, Mourier A, Felser A, Maffezzini C, Lesko N, Bruhn H, Engvall M, Wibom R, Barbaro M, Hinze Y, Magnusson M, Andeer R, Zetterstrom RH, von Dobeln U, Wredenberg A, Wedell A", "reference": { "type": "PubMed", "id": "26084283", "url": "https://pubmed.ncbi.nlm.nih.gov/26084283" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26084283", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of the human COQ5-containing protein complex is associated with diminished coenzyme Q10 levels under two different conditions of mitochondrial energy deficiency.", "journal": "Biochimica et biophysica acta", "date": "2016", "authors": "Yen HC, Liu YC, Kan CC, Wei HJ, Lee SH, Wei YH, Feng YH, Chen CW, Huang CC", "reference": { "type": "PubMed", "id": "27155576", "url": "https://pubmed.ncbi.nlm.nih.gov/27155576" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27155576", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pathogenicity of two COQ7 mutations and responses to 2,4-dihydroxybenzoate bypass treatment.", "journal": "Journal of cellular and molecular medicine", "date": "2017", "authors": "Wang Y, Smith C, Parboosingh JS, Khan A, Innes M, Hekimi S", "reference": { "type": "PubMed", "id": "28409910", "url": "https://pubmed.ncbi.nlm.nih.gov/28409910" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97478-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "Coq7", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 178, "end_pos": 178, "sequence_org": "E", "sequence_mut": "K", "comment": "No detectable ubiquinone is produced.", "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" }, { "database": "PubMed", "id": "28409910", "url": "https://pubmed.ncbi.nlm.nih.gov/28409910" } ], "uniprot_canonical_ac": "Q99807-1" }, { "start_pos": 178, "end_pos": 178, "sequence_org": "E", "sequence_mut": "K", "comment": "No detectable ubiquinone is produced.", "evidence": [ { "database": "UniProtKB", "id": "P97478", "url": "https://www.uniprot.org/uniprotkb/P97478" }, { "database": "PubMed", "id": "28409910", "url": "https://pubmed.ncbi.nlm.nih.gov/28409910" } ], "uniprot_canonical_ac": "P97478-1" } ], "record_id": "pubmed.28409910", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A fatal case of COQ7-associated primary coenzyme Q10 deficiency.", "journal": "JIMD reports", "date": "2019-05", "authors": "Kwong Anna K-Y, Chiu Annie T-G, Tsang Mandy H-Y, Lun Kin-Shing, Rodenburg Richard J T, Smeitink Jan, Chung Brian H-Y, Fung Cheuk-Wing", "reference": { "type": "PubMed", "id": "31240163", "url": "https://pubmed.ncbi.nlm.nih.gov/31240163" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31240163", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bi-allelic HPDL Variants Cause a Neurodegenerative Disease Ranging from Neonatal Encephalopathy to Adolescent-Onset Spastic Paraplegia.", "journal": "American journal of human genetics", "date": "2020", "authors": "Husain RA, Grimmel M, Wagner M, Hennings JC, Marx C, Feichtinger RG, Saadi A, Rostasy K, Radelfahr F, Bevot A, Dobler-Neumann M, Hartmann H, Colleaux L, Cordts I, Kobeleva X, Darvish H, Bakhtiari S, Kruer MC, Besse A, Ng AC, Chiang D, Bolduc F, Tafakhori A, Mane S, Ghasemi Firouzabadi S, Huebner AK, Buchert R, Beck-Woedl S, Muller AJ, Laugwitz L, Nagele T, Wang ZQ, Strom TM, Sturm M, Meitinger T, Klockgether T, Riess O, Klopstock T, Brandl U, Hubner CA, Deschauer M, Mayr JA, Bonnen PE, Krageloh-Mann I, Wortmann SB, Haack TB", "reference": { "type": "PubMed", "id": "32707086", "url": "https://pubmed.ncbi.nlm.nih.gov/32707086" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32707086", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinical spectrum in multiple families with primary COQ10 deficiency.", "journal": "American journal of medical genetics. Part A", "date": "2021", "authors": "Hashemi SS, Zare-Abdollahi D, Bakhshandeh MK, Vafaee A, Abolhasani S, Inanloo Rahatloo K, DanaeeFard F, Farboodi N, Rohani M, Alavi A", "reference": { "type": "PubMed", "id": "33215859", "url": "https://pubmed.ncbi.nlm.nih.gov/33215859" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33215859", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The polar oxy-metabolome reveals the 4-hydroxymandelate CoQ10 synthesis pathway.", "journal": "Nature", "date": "2021", "authors": "Banh RS, Kim ES, Spillier Q, Biancur DE, Yamamoto K, Sohn ASW, Shi G, Jones DR, Kimmelman AC, Pacold ME", "reference": { "type": "PubMed", "id": "34471290", "url": "https://pubmed.ncbi.nlm.nih.gov/34471290" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32754-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase", "gene_name": "HPD", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 258, "end_pos": 258, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of 4-HPPA dioxygenase activity. Impaired cell 3D growth.", "evidence": [ { "database": "UniProtKB", "id": "Q96IR7", "url": "https://www.uniprot.org/uniprotkb/Q96IR7" }, { "database": "PubMed", "id": "34471290", "url": "https://pubmed.ncbi.nlm.nih.gov/34471290" } ], "uniprot_canonical_ac": "Q96IR7-1" } ], "record_id": "pubmed.34471290", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel COQ7 mutation causing primarily neuromuscular pathology and its treatment options.", "journal": "Molecular genetics and metabolism reports", "date": "2022-06", "authors": "Wang Ying, Gumus Evren, Hekimi Siegfried", "reference": { "type": "PubMed", "id": "35782625", "url": "https://pubmed.ncbi.nlm.nih.gov/35782625" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35782625", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and functionality of a multimeric human COQ7:COQ9 complex.", "journal": "Molecular cell", "date": "2022-11-17", "authors": "Manicki Mateusz, Aydin Halil, Abriata Luciano A, Overmyer Katherine A, Guerra Rachel M, Coon Joshua J, Dal Peraro Matteo, Frost Adam, Pagliarini David J", "reference": { "type": "PubMed", "id": "36306796", "url": "https://pubmed.ncbi.nlm.nih.gov/36306796" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 208, "end_pos": 208, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of function activity; when associated with A-51; A-212 and A-216.", "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" }, { "database": "PubMed", "id": "36306796", "url": "https://pubmed.ncbi.nlm.nih.gov/36306796" } ], "uniprot_canonical_ac": "Q99807-1" }, { "start_pos": 212, "end_pos": 212, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of function activity; when associated with A-51; A-208 and A-216.", "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" }, { "database": "PubMed", "id": "36306796", "url": "https://pubmed.ncbi.nlm.nih.gov/36306796" } ], "uniprot_canonical_ac": "Q99807-1" }, { "start_pos": 216, "end_pos": 216, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of function activity; when associated with A-51; A-208 and A-212.", "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" }, { "database": "PubMed", "id": "36306796", "url": "https://pubmed.ncbi.nlm.nih.gov/36306796" } ], "uniprot_canonical_ac": "Q99807-1" }, { "start_pos": 51, "end_pos": 51, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of function activity; when associated with A-208; A-212 and A-216.", "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" }, { "database": "PubMed", "id": "36306796", "url": "https://pubmed.ncbi.nlm.nih.gov/36306796" } ], "uniprot_canonical_ac": "Q99807-1" }, { "start_pos": 240, "end_pos": 240, "sequence_org": "W", "sequence_mut": "K", "comment": "Disrupts the octameric COQ7:COQ9 complex.", "evidence": [ { "database": "UniProtKB", "id": "O75208", "url": "https://www.uniprot.org/uniprotkb/O75208" }, { "database": "PubMed", "id": "36306796", "url": "https://pubmed.ncbi.nlm.nih.gov/36306796" } ], "uniprot_canonical_ac": "O75208-1" } ], "record_id": "pubmed.36306796", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biallelic variants in the COQ7 gene cause distal hereditary motor neuropathy in two Chinese families.", "journal": "Brain : a journal of neurology", "date": "2023-05-02", "authors": "Liu Xiao-Xuan, Wang Ning, Chen Yi-Kun, Lv Wen-Qi, Hong Jing-Mei, Xu Guo-Rong, Zhou Lin-Ying, Chen Wan-Jin, Fan Dong-Sheng, He Jin", "reference": { "type": "PubMed", "id": "36758993", "url": "https://pubmed.ncbi.nlm.nih.gov/36758993" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36758993", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biallelic variants in COQ7 cause distal hereditary motor neuropathy with upper motor neuron signs.", "journal": "Brain : a journal of neurology", "date": "2023-10-03", "authors": "Rebelo Adriana P, Tomaselli Pedro J, Medina Jessica, Wang Ying, Dohrn Maike F, Nyvltova Eva, Danzi Matt C, Garrett Mark, Smith Sean E, Pestronk Alan, Li Chengcheng, Ruiz Ariel, Jacobs Elizabeth, Feely Shawna M E, Fran\u00e7a Marcondes C, Gomes Marcus V, Santos Diogo F, Kumar Surinder, Lombard David B, Saporta Mario, Hekimi Siegfried, Barrientos Antoni, Weihl Conrad, Shy Michael E, Marques Wilson, Zuchner Stephan", "reference": { "type": "PubMed", "id": "37170631", "url": "https://pubmed.ncbi.nlm.nih.gov/37170631" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37170631", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phenotypic, molecular, and functional characterization of COQ7-related primary CoQ10 deficiency: Hypomorphic variants and two distinct disease entities.", "journal": "Molecular genetics and metabolism", "date": "2023-08", "authors": "Wongkittichote Parith, Duque Lasio Maria Laura, Magistrati Martina, Pathak Sheel, Sample Brooke, Carvalho Daniel Rocha, Ortega Adriana Banzzatto, Castro Matheus Augusto Ara\u00fajo, de Gusmao Claudio M, Toler Tomi L, Bellacchio Emanuele, Dallabona Cristina, Shinawi Marwan", "reference": { "type": "PubMed", "id": "37392700", "url": "https://pubmed.ncbi.nlm.nih.gov/37392700" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37392700", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COQ7 defect causes prenatal onset of mitochondrial CoQ10 deficiency with cardiomyopathy and gastrointestinal obstruction.", "journal": "European journal of human genetics : EJHG", "date": "2024-08", "authors": "Pettenuzzo Ilaria, Carli Sara, S\u00e1nchez-Cuesta Ana, Isidori Federica, Montanari Francesca, Grippa Mina, Lanzoni Giulia, Ambrosetti Irene, Di Pisa Veronica, Cordelli Duccio Maria, Mondardini Maria Cristina, Pippucci Tommaso, Ragni Luca, Cenacchi Giovanna, Costa Roberta, Lima Mario, Capristo Maria Antonietta, Tropeano Concetta Valentina, Caporali Leonardo, Carelli Valerio, Brunelli Elena, Maffei Monica, Ahmed Sheikhmaye Hodman, Fetta Anna, Brea-Calvo Gloria, Garone Caterina", "reference": { "type": "PubMed", "id": "38702428", "url": "https://pubmed.ncbi.nlm.nih.gov/38702428" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38702428", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The COQ7 gene encodes a protein in saccharomyces cerevisiae necessary for ubiquinone biosynthesis.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Marbois BN, Clarke CF", "reference": { "type": "PubMed", "id": "8621692", "url": "https://pubmed.ncbi.nlm.nih.gov/8621692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41735-1", "protein_name": "5-demethoxyubiquinone hydroxylase, mitochondrial", "gene_name": "CAT5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8621692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and functional conservation of the Caenorhabditis elegans timing gene clk-1.", "journal": "Science", "date": "1997", "authors": "Ewbank J J, Barnes T M, Lakowski B, Lussier M, Bussey H, Hekimi S", "reference": { "type": "PubMed", "id": "9020081", "url": "https://pubmed.ncbi.nlm.nih.gov/9020081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P97478-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "Coq7", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9020081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the COQ5 gene from Saccharomyces cerevisiae. Evidence for a C-methyltransferase in ubiquinone biosynthesis.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Barkovich RJ, Shtanko A, Shepherd JA, Lee PT, Myles DC, Tzagoloff A, Clarke CF", "reference": { "type": "PubMed", "id": "9083049", "url": "https://pubmed.ncbi.nlm.nih.gov/9083049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99807-1", "protein_name": "NADPH-dependent 3-demethoxyubiquinone 3-hydroxylase, mitochondrial", "gene_name": "COQ7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96D53-1", "protein_name": "Atypical kinase COQ8B, mitochondrial", "gene_name": "COQ8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z9-1", "protein_name": "Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial", "gene_name": "COQ6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49017-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q86YH6-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS2", "gene_name": "PDSS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IR7-1", "protein_name": "4-hydroxyphenylpyruvate dioxygenase-like protein", "gene_name": "HPDL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI60-1", "protein_name": "Atypical kinase COQ8A, mitochondrial", "gene_name": "COQ8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75208-1", "protein_name": "Ubiquinone biosynthesis protein COQ9, mitochondrial", "gene_name": "COQ9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A0-1", "protein_name": "Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial", "gene_name": "COQ4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK3-1", "protein_name": "2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial", "gene_name": "COQ5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96H96-1", "protein_name": "4-hydroxybenzoate polyprenyltransferase, mitochondrial", "gene_name": "COQ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZJ6-1", "protein_name": "Ubiquinone biosynthesis O-methyltransferase, mitochondrial", "gene_name": "COQ3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T2R2-1", "protein_name": "All trans-polyprenyl-diphosphate synthase PDSS1", "gene_name": "PDSS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99807", "url": "https://www.uniprot.org/uniprotkb/Q99807" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9083049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NOPCHAP1 is a PAQosome cofactor that helps loading NOP58 on RUVBL1/2 during box C/D snoRNP biogenesis.", "journal": "Nucleic acids research", "date": "2021", "authors": "Abel Y, Paiva ACF, Bizarro J, Chagot ME, Santo PE, Robert MC, Quinternet M, Vandermoere F, Sousa PMF, Fort P, Charpentier B, Manival X, Bandeiras TM, Bertrand E, Verheggen C", "reference": { "type": "PubMed", "id": "33367824", "url": "https://pubmed.ncbi.nlm.nih.gov/33367824" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N5I9-1", "protein_name": "NOP protein chaperone 1", "gene_name": "NOPCHAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y265-1", "protein_name": "RuvB-like 1", "gene_name": "RUVBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2X3-1", "protein_name": "Nucleolar protein 58", "gene_name": "NOP58", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y230-1", "protein_name": "RuvB-like 2", "gene_name": "RUVBL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N5I9", "url": "https://www.uniprot.org/uniprotkb/Q8N5I9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 303, "end_pos": 303, "sequence_org": "E", "sequence_mut": "Q", "comment": "Reduces ATPase activity. Decreases interaction with NOPCHAP1. No effect on formation of RUVBL1-RUVBL2 heteromeric complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y265", "url": "https://www.uniprot.org/uniprotkb/Q9Y265" }, { "database": "PubMed", "id": "33367824", "url": "https://pubmed.ncbi.nlm.nih.gov/33367824" }, { "database": "PubMed", "id": "33205750", "url": "https://pubmed.ncbi.nlm.nih.gov/33205750" } ], "uniprot_canonical_ac": "Q9Y265-1" }, { "start_pos": 76, "end_pos": 76, "sequence_org": "K", "sequence_mut": "M", "comment": "No effect on interaction with NOPCHAP1.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y265", "url": "https://www.uniprot.org/uniprotkb/Q9Y265" }, { "database": "PubMed", "id": "33367824", "url": "https://pubmed.ncbi.nlm.nih.gov/33367824" } ], "uniprot_canonical_ac": "Q9Y265-1" }, { "start_pos": 283, "end_pos": 283, "sequence_org": "A", "sequence_mut": "P", "comment": "Restricted to nucleoplasm. Abolishes interaction with NOPCHAP1.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2X3", "url": "https://www.uniprot.org/uniprotkb/Q9Y2X3" }, { "database": "PubMed", "id": "33367824", "url": "https://pubmed.ncbi.nlm.nih.gov/33367824" } ], "uniprot_canonical_ac": "Q9Y2X3-1" }, { "start_pos": 310, "end_pos": 313, "sequence_org": "KHAA", "sequence_mut": "AHAR", "comment": "Restricted to nucleoplasm. Decreases interaction with NOPCHAP1.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y2X3", "url": "https://www.uniprot.org/uniprotkb/Q9Y2X3" }, { "database": "PubMed", "id": "33367824", "url": "https://pubmed.ncbi.nlm.nih.gov/33367824" } ], "uniprot_canonical_ac": "Q9Y2X3-1" }, { "start_pos": 300, "end_pos": 300, "sequence_org": "E", "sequence_mut": "Q", "comment": "Reduces ATPase activity. Decreases interaction with NOPCHAP1. No effect on formation of RUVBL1-RUVBL2 heteromeric complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y230", "url": "https://www.uniprot.org/uniprotkb/Q9Y230" }, { "database": "PubMed", "id": "33367824", "url": "https://pubmed.ncbi.nlm.nih.gov/33367824" }, { "database": "PubMed", "id": "33205750", "url": "https://pubmed.ncbi.nlm.nih.gov/33205750" } ], "uniprot_canonical_ac": "Q9Y230-1" }, { "start_pos": 83, "end_pos": 83, "sequence_org": "K", "sequence_mut": "M", "comment": "No effect on interaction with NOPCHAP1.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y230", "url": "https://www.uniprot.org/uniprotkb/Q9Y230" }, { "database": "PubMed", "id": "33367824", "url": "https://pubmed.ncbi.nlm.nih.gov/33367824" } ], "uniprot_canonical_ac": "Q9Y230-1" } ], "record_id": "pubmed.33367824", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of DDSR1 Long Non-Coding RNA and Genes Involved in the DNA Damage Response in Sperm with DNA Fragmentation.", "journal": "Reproductive sciences (Thousand Oaks, Calif.)", "date": "2024-10", "authors": "Moayeri Mina, Irani Shiva, Novin Marefat Ghaffari, Salahshourifar Iman, Salehi Mohammad", "reference": { "type": "PubMed", "id": "39014289", "url": "https://pubmed.ncbi.nlm.nih.gov/39014289" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N5I9-1", "protein_name": "NOP protein chaperone 1", "gene_name": "NOPCHAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N5I9", "url": "https://www.uniprot.org/uniprotkb/Q8N5I9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39014289", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "hRAD17, a structural homolog of the Schizosaccharomyces pombe RAD17 cell cycle checkpoint gene, stimulates p53 accumulation.", "journal": "Oncogene", "date": "1999-03-04", "authors": "Li L, Peterson C A, Kanter-Smoler G, Wei Y F, Ramagli L S, Sunnerhagen P, Siciliano M J, Legerski R J", "reference": { "type": "PubMed", "id": "10208430", "url": "https://pubmed.ncbi.nlm.nih.gov/10208430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10208430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HRad17, a human homologue of the Schizosaccharomyces pombe checkpoint gene rad17, is overexpressed in colon carcinoma.", "journal": "Cancer Res.", "date": "1999", "authors": "Bao S, Chang M S, Auclair D, Sun Y, Wang Y, Wong W K, Zhang J, Liu Y, Qian X, Sutherland R, Magi-Galluzi C, Weisberg E, Cheng E Y, Hao L, Sasaki H, Campbell M S, Kraeft S K, Loda M, Lo K M, Chen L B", "reference": { "type": "PubMed", "id": "10232579", "url": "https://pubmed.ncbi.nlm.nih.gov/10232579" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NXW6-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "Rad17", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10232579", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human and mouse RAD17 genes: identification, localization, genomic structure and histological expression pattern in normal testis and seminoma.", "journal": "Hum. Genet.", "date": "1999", "authors": "von Deimling F, Scharf J M, Liehr T, Rothe M, Kelter A R, Albers P, Dietrich W F, Kunkel L M, Wernert N, Wirth B", "reference": { "type": "PubMed", "id": "10480350", "url": "https://pubmed.ncbi.nlm.nih.gov/10480350" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NXW6-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "Rad17", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10480350", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human checkpoint protein hRad17 interacts with the PCNA-like proteins hRad1, hHus1, and hRad9.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Rauen M, Burtelow MA, Dufault VM, Karnitz LM", "reference": { "type": "PubMed", "id": "10884395", "url": "https://pubmed.ncbi.nlm.nih.gov/10884395" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60921-1", "protein_name": "Checkpoint protein HUS1", "gene_name": "HUS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60671-1", "protein_name": "Cell cycle checkpoint protein RAD1", "gene_name": "RAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99638-1", "protein_name": "Cell cycle checkpoint control protein RAD9A", "gene_name": "RAD9A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 143, "end_pos": 143, "sequence_org": "K", "sequence_mut": "E", "comment": "Impairs phosphorylation on S-656. Abolishes interaction with the RAD1-RAD9-HUS1 complex; does not affect interaction with RFC3.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11799063", "url": "https://pubmed.ncbi.nlm.nih.gov/11799063" }, { "database": "PubMed", "id": "10884395", "url": "https://pubmed.ncbi.nlm.nih.gov/10884395" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 143, "end_pos": 143, "sequence_org": "K", "sequence_mut": "G", "comment": "Impairs phosphorylation. Impairs interaction with DNA and the RAD1-RAD9-HUS1 complex; does not affect interaction with RFC3.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11799063", "url": "https://pubmed.ncbi.nlm.nih.gov/11799063" }, { "database": "PubMed", "id": "10884395", "url": "https://pubmed.ncbi.nlm.nih.gov/10884395" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 226, "end_pos": 233, "sequence_org": "SLLKPSTK", "sequence_mut": "AAAAAAAA", "comment": "Abolishes association of the 9-1-1 complex with RAD17.", "evidence": [ { "database": "UniProtKB", "id": "O60671", "url": "https://www.uniprot.org/uniprotkb/O60671" }, { "database": "PubMed", "id": "10884395", "url": "https://pubmed.ncbi.nlm.nih.gov/10884395" } ], "uniprot_canonical_ac": "O60671-1" } ], "record_id": "pubmed.10884395", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ATR/ATM-mediated phosphorylation of human Rad17 is required for genotoxic stress responses.", "journal": "Nature", "date": "2001", "authors": "Bao S, Tibbetts RS, Brumbaugh KM, Fang Y, Richardson DA, Ali A, Chen SM, Abraham RT, Wang XF", "reference": { "type": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13535-1", "protein_name": "Serine/threonine-protein kinase ATR", "gene_name": "ATR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 646, "end_pos": 646, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-656.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with RAD1; when associated with D-656.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-646.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with RAD1; when associated with D-646.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" } ], "phosphorylation": [ { "start_pos": 646, "end_pos": 646, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "10608806", "url": "https://pubmed.ncbi.nlm.nih.gov/10608806" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser646", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "kinase_uniprot_canonical_ac": "Q13535-1", "kinase_gene_name": "ATR", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "10608806", "url": "https://pubmed.ncbi.nlm.nih.gov/10608806" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" } ], "site_lbl": "Ser646", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR and ATM", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "14871926", "url": "https://pubmed.ncbi.nlm.nih.gov/14871926" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser646", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "10608806", "url": "https://pubmed.ncbi.nlm.nih.gov/10608806" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser656", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "kinase_uniprot_canonical_ac": "Q13535-1", "kinase_gene_name": "ATR", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "10608806", "url": "https://pubmed.ncbi.nlm.nih.gov/10608806" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" } ], "site_lbl": "Ser656", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR and ATM", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser656", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 480, "end_pos": 480, "kinase_uniprot_canonical_ac": "O75943-1", "kinase_gene_name": "RAD17", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13535", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13535" }, { "database": "PubMed", "id": "10608806", "url": "https://pubmed.ncbi.nlm.nih.gov/10608806" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser480", "uniprot_canonical_ac": "Q13535-1" }, { "start_pos": 549, "end_pos": 549, "kinase_uniprot_canonical_ac": "O75943-1", "kinase_gene_name": "RAD17", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13535", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13535" }, { "database": "PubMed", "id": "10608806", "url": "https://pubmed.ncbi.nlm.nih.gov/10608806" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser549", "uniprot_canonical_ac": "Q13535-1" } ], "record_id": "pubmed.11418864", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and characterization of human DNA damage checkpoint Rad complexes.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2001", "authors": "Lindsey-Boltz L A, Bermudez V P, Hurwitz J, Sancar A", "reference": { "type": "PubMed", "id": "11572977", "url": "https://pubmed.ncbi.nlm.nih.gov/11572977" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11572977", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple alternative splicing forms of human RAD17 and their differential response to ionizing radiation.", "journal": "Gene", "date": "2001", "authors": "Chen M S, Higashikubo R, Laszlo A, Roti Roti J", "reference": { "type": "PubMed", "id": "11602352", "url": "https://pubmed.ncbi.nlm.nih.gov/11602352" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11602352", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of serines 635 and 645 of human Rad17 is cell cycle regulated and is required for G(1)/S checkpoint activation in response to DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Post S, Weng YC, Cimprich K, Chen LB, Xu Y, Lee EY", "reference": { "type": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NXW6-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "Rad17", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 191, "end_pos": 191, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on phosphorylation by ATR.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-656.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with RAD1; when associated with D-656.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-646.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with RAD1; when associated with D-646.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" } ], "phosphorylation": [ { "start_pos": 646, "end_pos": 646, "kinase_uniprot_canonical_ac": "Q13535-1", "kinase_gene_name": "ATR", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "10608806", "url": "https://pubmed.ncbi.nlm.nih.gov/10608806" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" } ], "site_lbl": "Ser646", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR and ATM", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "14871926", "url": "https://pubmed.ncbi.nlm.nih.gov/14871926" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser646", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "kinase_uniprot_canonical_ac": "Q13535-1", "kinase_gene_name": "ATR", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "10608806", "url": "https://pubmed.ncbi.nlm.nih.gov/10608806" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" } ], "site_lbl": "Ser656", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR and ATM", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser656", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 647, "end_pos": 647, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR", "evidence": [ { "database": "UniProtKB", "id": "Q6NXW6", "url": "https://www.uniprot.org/uniprotkb/Q6NXW6" }, { "database": "iPTMnet", "id": "Q6NXW6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6NXW6" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "17376776", "url": "https://pubmed.ncbi.nlm.nih.gov/17376776" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" } ], "site_lbl": "Ser647", "uniprot_canonical_ac": "Q6NXW6-1" }, { "start_pos": 657, "end_pos": 657, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR", "evidence": [ { "database": "UniProtKB", "id": "Q6NXW6", "url": "https://www.uniprot.org/uniprotkb/Q6NXW6" }, { "database": "iPTMnet", "id": "Q6NXW6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6NXW6" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" } ], "site_lbl": "Ser657", "uniprot_canonical_ac": "Q6NXW6-1" } ], "record_id": "pubmed.11687627", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human hR24L gene is involved in DNA excision repair and recombination repair.", "journal": "Zhonghua Yi Xue Za Zhi", "date": "1999", "authors": "Han Y, Zhu Y", "reference": { "type": "PubMed", "id": "11715513", "url": "https://pubmed.ncbi.nlm.nih.gov/11715513" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11715513", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of ATR substrate selection by Rad17-dependent loading of Rad9 complexes onto chromatin.", "journal": "Genes & development", "date": "2002", "authors": "Zou L, Cortez D, Elledge SJ", "reference": { "type": "PubMed", "id": "11799063", "url": "https://pubmed.ncbi.nlm.nih.gov/11799063" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 143, "end_pos": 143, "sequence_org": "K", "sequence_mut": "E", "comment": "Impairs phosphorylation on S-656. Abolishes interaction with the RAD1-RAD9-HUS1 complex; does not affect interaction with RFC3.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11799063", "url": "https://pubmed.ncbi.nlm.nih.gov/11799063" }, { "database": "PubMed", "id": "10884395", "url": "https://pubmed.ncbi.nlm.nih.gov/10884395" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 143, "end_pos": 143, "sequence_org": "K", "sequence_mut": "G", "comment": "Impairs phosphorylation. Impairs interaction with DNA and the RAD1-RAD9-HUS1 complex; does not affect interaction with RFC3.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11799063", "url": "https://pubmed.ncbi.nlm.nih.gov/11799063" }, { "database": "PubMed", "id": "10884395", "url": "https://pubmed.ncbi.nlm.nih.gov/10884395" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" } ], "record_id": "pubmed.11799063", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Colocalization of human Rad17 and PCNA in late S phase of the cell cycle upon replication block.", "journal": "Oncogene", "date": "2002", "authors": "Dahm Kirsten, H\u00fcbscher Ulrich", "reference": { "type": "PubMed", "id": "12400013", "url": "https://pubmed.ncbi.nlm.nih.gov/12400013" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12400013", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic instability and endoreduplication triggered by RAD17 deletion.", "journal": "Genes & development", "date": "2003-04-15", "authors": "Wang Xin, Zou Lee, Zheng Huyong, Wei Qingyi, Elledge Stephen J, Li Lei", "reference": { "type": "PubMed", "id": "12672690", "url": "https://pubmed.ncbi.nlm.nih.gov/12672690" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12672690", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human checkpoint Rad protein Rad17 is chromatin-associated throughout the cell cycle, localizes to DNA replication sites, and interacts with DNA polymerase epsilon.", "journal": "Nucleic acids research", "date": "2003", "authors": "Post SM, Tomkinson AE, Lee EY", "reference": { "type": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07864-1", "protein_name": "DNA polymerase epsilon catalytic subunit A", "gene_name": "POLE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NXW6-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "Rad17", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 646, "end_pos": 646, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-656.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with RAD1; when associated with D-656.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-646.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with RAD1; when associated with D-646.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" } ], "phosphorylation": [ { "start_pos": 646, "end_pos": 646, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR and ATM", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "14871926", "url": "https://pubmed.ncbi.nlm.nih.gov/14871926" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser646", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR and ATM", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser656", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 647, "end_pos": 647, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR", "evidence": [ { "database": "UniProtKB", "id": "Q6NXW6", "url": "https://www.uniprot.org/uniprotkb/Q6NXW6" }, { "database": "iPTMnet", "id": "Q6NXW6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6NXW6" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "17376776", "url": "https://pubmed.ncbi.nlm.nih.gov/17376776" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" } ], "site_lbl": "Ser647", "uniprot_canonical_ac": "Q6NXW6-1" }, { "start_pos": 657, "end_pos": 657, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR", "evidence": [ { "database": "UniProtKB", "id": "Q6NXW6", "url": "https://www.uniprot.org/uniprotkb/Q6NXW6" }, { "database": "iPTMnet", "id": "Q6NXW6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6NXW6" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" } ], "site_lbl": "Ser657", "uniprot_canonical_ac": "Q6NXW6-1" } ], "record_id": "pubmed.14500819", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of RAD9B, a paralog of the RAD9 checkpoint gene.", "journal": "Genomics", "date": "2003", "authors": "Dufault VM, Oestreich AJ, Vroman BT, Karnitz LM", "reference": { "type": "PubMed", "id": "14611806", "url": "https://pubmed.ncbi.nlm.nih.gov/14611806" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6WBX8-5", "protein_name": "Cell cycle checkpoint control protein RAD9B", "gene_name": "RAD9B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60921-1", "protein_name": "Checkpoint protein HUS1", "gene_name": "HUS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60671-1", "protein_name": "Cell cycle checkpoint protein RAD1", "gene_name": "RAD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14611806", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Requirement of protein phosphatase 5 in DNA-damage-induced ATM activation.", "journal": "Genes & development", "date": "2004", "authors": "Ali A, Zhang J, Bao S, Liu I, Otterness D, Dean NM, Abraham RT, Wang XF", "reference": { "type": "PubMed", "id": "14871926", "url": "https://pubmed.ncbi.nlm.nih.gov/14871926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53041-1", "protein_name": "Serine/threonine-protein phosphatase 5", "gene_name": "PPP5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 646, "end_pos": 646, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATR and ATM", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "14871926", "url": "https://pubmed.ncbi.nlm.nih.gov/14871926" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" } ], "site_lbl": "Ser646", "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 1981, "end_pos": 1981, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q13315", "url": "https://www.uniprot.org/uniprotkb/Q13315" }, { "database": "IntAct", "id": "Q13315", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13315*" }, { "database": "iPTMnet", "id": "Q13315", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13315" }, { "database": "PubMed", "id": "19851285", "url": "https://pubmed.ncbi.nlm.nih.gov/19851285" }, { "database": "PubMed", "id": "16858402", "url": "https://pubmed.ncbi.nlm.nih.gov/16858402" }, { "database": "PRO", "id": "Q13315", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q13315" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "12556884", "url": "https://pubmed.ncbi.nlm.nih.gov/12556884" }, { "database": "PubMed", "id": "14695167", "url": "https://pubmed.ncbi.nlm.nih.gov/14695167" }, { "database": "PubMed", "id": "14871926", "url": "https://pubmed.ncbi.nlm.nih.gov/14871926" }, { "database": "PubMed", "id": "15048089", "url": "https://pubmed.ncbi.nlm.nih.gov/15048089" }, { "database": "PubMed", "id": "15140942", "url": "https://pubmed.ncbi.nlm.nih.gov/15140942" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15177184", "url": "https://pubmed.ncbi.nlm.nih.gov/15177184" }, { "database": "PubMed", "id": "15269203", "url": "https://pubmed.ncbi.nlm.nih.gov/15269203" }, { "database": "PubMed", "id": "15313175", "url": "https://pubmed.ncbi.nlm.nih.gov/15313175" }, { "database": "PubMed", "id": "15314656", "url": "https://pubmed.ncbi.nlm.nih.gov/15314656" }, { "database": "PubMed", "id": "15489221", "url": "https://pubmed.ncbi.nlm.nih.gov/15489221" }, { "database": "PubMed", "id": "15510216", "url": "https://pubmed.ncbi.nlm.nih.gov/15510216" }, { "database": "PubMed", "id": "15846060", "url": "https://pubmed.ncbi.nlm.nih.gov/15846060" }, { "database": "PubMed", "id": "16293623", "url": "https://pubmed.ncbi.nlm.nih.gov/16293623" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16452482", "url": "https://pubmed.ncbi.nlm.nih.gov/16452482" }, { "database": "PubMed", "id": "16528719", "url": "https://pubmed.ncbi.nlm.nih.gov/16528719" }, { "database": "PubMed", "id": "16533058", "url": "https://pubmed.ncbi.nlm.nih.gov/16533058" }, { "database": "PubMed", "id": "16556909", "url": "https://pubmed.ncbi.nlm.nih.gov/16556909" }, { "database": "PubMed", "id": "16628011", "url": "https://pubmed.ncbi.nlm.nih.gov/16628011" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16861926", "url": "https://pubmed.ncbi.nlm.nih.gov/16861926" }, { "database": "PubMed", "id": "16906133", "url": "https://pubmed.ncbi.nlm.nih.gov/16906133" }, { "database": "PubMed", "id": "16940754", "url": "https://pubmed.ncbi.nlm.nih.gov/16940754" }, { "database": "PubMed", "id": "16997395", "url": "https://pubmed.ncbi.nlm.nih.gov/16997395" }, { "database": "PubMed", "id": "17016017", "url": "https://pubmed.ncbi.nlm.nih.gov/17016017" }, { "database": "PubMed", "id": "17124492", "url": "https://pubmed.ncbi.nlm.nih.gov/17124492" }, { "database": "PubMed", "id": "17406032", "url": "https://pubmed.ncbi.nlm.nih.gov/17406032" }, { "database": "PubMed", "id": "17486112", "url": "https://pubmed.ncbi.nlm.nih.gov/17486112" }, { "database": "PubMed", "id": "17638905", "url": "https://pubmed.ncbi.nlm.nih.gov/17638905" }, { "database": "PubMed", "id": "17700524", "url": "https://pubmed.ncbi.nlm.nih.gov/17700524" }, { "database": "PubMed", "id": "18048416", "url": "https://pubmed.ncbi.nlm.nih.gov/18048416" }, { "database": "PubMed", "id": "18059176", "url": "https://pubmed.ncbi.nlm.nih.gov/18059176" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18344987", "url": "https://pubmed.ncbi.nlm.nih.gov/18344987" }, { "database": "PubMed", "id": "18431490", "url": "https://pubmed.ncbi.nlm.nih.gov/18431490" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18571408", "url": "https://pubmed.ncbi.nlm.nih.gov/18571408" }, { "database": "PubMed", "id": "18593910", "url": "https://pubmed.ncbi.nlm.nih.gov/18593910" }, { "database": "PubMed", "id": "18596698", "url": "https://pubmed.ncbi.nlm.nih.gov/18596698" }, { "database": "PubMed", "id": "18619531", "url": "https://pubmed.ncbi.nlm.nih.gov/18619531" }, { "database": "PubMed", "id": "18663430", "url": "https://pubmed.ncbi.nlm.nih.gov/18663430" }, { "database": "PubMed", "id": "18762365", "url": "https://pubmed.ncbi.nlm.nih.gov/18762365" }, { "database": "PubMed", "id": "18959818", "url": "https://pubmed.ncbi.nlm.nih.gov/18959818" }, { "database": "PubMed", "id": "18985806", "url": "https://pubmed.ncbi.nlm.nih.gov/18985806" }, { "database": "PubMed", "id": "19401701", "url": "https://pubmed.ncbi.nlm.nih.gov/19401701" }, { "database": "PubMed", "id": "19411853", "url": "https://pubmed.ncbi.nlm.nih.gov/19411853" }, { "database": "PubMed", "id": "19451263", "url": "https://pubmed.ncbi.nlm.nih.gov/19451263" }, { "database": "PubMed", "id": "19605351", "url": "https://pubmed.ncbi.nlm.nih.gov/19605351" }, { "database": "PubMed", "id": "19621083", "url": "https://pubmed.ncbi.nlm.nih.gov/19621083" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19671522", "url": "https://pubmed.ncbi.nlm.nih.gov/19671522" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19798429", "url": "https://pubmed.ncbi.nlm.nih.gov/19798429" }, { "database": "PubMed", "id": "20014310", "url": "https://pubmed.ncbi.nlm.nih.gov/20014310" }, { "database": "PubMed", "id": "20126263", "url": "https://pubmed.ncbi.nlm.nih.gov/20126263" }, { "database": "PubMed", "id": "20205745", "url": "https://pubmed.ncbi.nlm.nih.gov/20205745" }, { "database": "PubMed", "id": "20660628", "url": "https://pubmed.ncbi.nlm.nih.gov/20660628" }, { "database": "PubMed", "id": "20678255", "url": "https://pubmed.ncbi.nlm.nih.gov/20678255" }, { "database": "PubMed", "id": "20700484", "url": "https://pubmed.ncbi.nlm.nih.gov/20700484" }, { "database": "PubMed", "id": "20711462", "url": "https://pubmed.ncbi.nlm.nih.gov/20711462" }, { "database": "PubMed", "id": "20959117", "url": "https://pubmed.ncbi.nlm.nih.gov/20959117" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "20978201", "url": "https://pubmed.ncbi.nlm.nih.gov/20978201" }, { "database": "PubMed", "id": "21078189", "url": "https://pubmed.ncbi.nlm.nih.gov/21078189" }, { "database": "PubMed", "id": "21157431", "url": "https://pubmed.ncbi.nlm.nih.gov/21157431" }, { "database": "PubMed", "id": "21219611", "url": "https://pubmed.ncbi.nlm.nih.gov/21219611" }, { "database": "PubMed", "id": "21292467", "url": "https://pubmed.ncbi.nlm.nih.gov/21292467" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21824286", "url": "https://pubmed.ncbi.nlm.nih.gov/21824286" }, { "database": "PubMed", "id": "21997193", "url": "https://pubmed.ncbi.nlm.nih.gov/21997193" }, { "database": "PubMed", "id": "22323184", "url": "https://pubmed.ncbi.nlm.nih.gov/22323184" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22493319", "url": "https://pubmed.ncbi.nlm.nih.gov/22493319" }, { "database": "PubMed", "id": "22498490", "url": "https://pubmed.ncbi.nlm.nih.gov/22498490" }, { "database": "PubMed", "id": "22655027", "url": "https://pubmed.ncbi.nlm.nih.gov/22655027" }, { "database": "PubMed", "id": "22739265", "url": "https://pubmed.ncbi.nlm.nih.gov/22739265" }, { "database": "PubMed", "id": "22761798", "url": "https://pubmed.ncbi.nlm.nih.gov/22761798" }, { "database": "PubMed", "id": "22837425", "url": "https://pubmed.ncbi.nlm.nih.gov/22837425" }, { "database": "PubMed", "id": "22841545", "url": "https://pubmed.ncbi.nlm.nih.gov/22841545" }, { "database": "PubMed", "id": "22952040", "url": "https://pubmed.ncbi.nlm.nih.gov/22952040" }, { "database": "PubMed", "id": "23146902", "url": "https://pubmed.ncbi.nlm.nih.gov/23146902" }, { "database": "PubMed", "id": "23166842", "url": "https://pubmed.ncbi.nlm.nih.gov/23166842" }, { "database": "PubMed", "id": "23185347", "url": "https://pubmed.ncbi.nlm.nih.gov/23185347" }, { "database": "PubMed", "id": "23193277", "url": "https://pubmed.ncbi.nlm.nih.gov/23193277" }, { "database": "PubMed", "id": "23365634", "url": "https://pubmed.ncbi.nlm.nih.gov/23365634" }, { "database": "PubMed", "id": "23383259", "url": "https://pubmed.ncbi.nlm.nih.gov/23383259" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23552604", "url": "https://pubmed.ncbi.nlm.nih.gov/23552604" }, { "database": "PubMed", "id": "23620287", "url": "https://pubmed.ncbi.nlm.nih.gov/23620287" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23900392", "url": "https://pubmed.ncbi.nlm.nih.gov/23900392" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24113180", "url": "https://pubmed.ncbi.nlm.nih.gov/24113180" }, { "database": "PubMed", "id": "24268576", "url": "https://pubmed.ncbi.nlm.nih.gov/24268576" }, { "database": "PubMed", "id": "24280901", "url": "https://pubmed.ncbi.nlm.nih.gov/24280901" }, { "database": "PubMed", "id": "24505404", "url": "https://pubmed.ncbi.nlm.nih.gov/24505404" }, { "database": "PubMed", "id": "24763056", "url": "https://pubmed.ncbi.nlm.nih.gov/24763056" }, { "database": "PubMed", "id": "24812435", "url": "https://pubmed.ncbi.nlm.nih.gov/24812435" }, { "database": "PubMed", "id": "24933654", "url": "https://pubmed.ncbi.nlm.nih.gov/24933654" }, { "database": "PubMed", "id": "24988892", "url": "https://pubmed.ncbi.nlm.nih.gov/24988892" }, { "database": "PubMed", "id": "25003995", "url": "https://pubmed.ncbi.nlm.nih.gov/25003995" }, { "database": "PubMed", "id": "25077176", "url": "https://pubmed.ncbi.nlm.nih.gov/25077176" }, { "database": "PubMed", "id": "25088203", "url": "https://pubmed.ncbi.nlm.nih.gov/25088203" }, { "database": "PubMed", "id": "25111195", "url": "https://pubmed.ncbi.nlm.nih.gov/25111195" }, { "database": "PubMed", "id": "25240135", "url": "https://pubmed.ncbi.nlm.nih.gov/25240135" }, { "database": "PubMed", "id": "25527123", "url": "https://pubmed.ncbi.nlm.nih.gov/25527123" }, { "database": "PubMed", "id": "25611382", "url": "https://pubmed.ncbi.nlm.nih.gov/25611382" }, { "database": "PubMed", "id": "25821946", "url": "https://pubmed.ncbi.nlm.nih.gov/25821946" }, { "database": "PubMed", "id": "25826455", "url": "https://pubmed.ncbi.nlm.nih.gov/25826455" }, { "database": "PubMed", "id": "25865756", "url": "https://pubmed.ncbi.nlm.nih.gov/25865756" }, { "database": "PubMed", "id": "25904696", "url": "https://pubmed.ncbi.nlm.nih.gov/25904696" }, { "database": "PubMed", "id": "25923214", "url": "https://pubmed.ncbi.nlm.nih.gov/25923214" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "26158765", "url": "https://pubmed.ncbi.nlm.nih.gov/26158765" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" }, { "database": "PubMed", "id": "26275218", "url": "https://pubmed.ncbi.nlm.nih.gov/26275218" }, { "database": "PubMed", "id": "26416514", "url": "https://pubmed.ncbi.nlm.nih.gov/26416514" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26438152", "url": "https://pubmed.ncbi.nlm.nih.gov/26438152" }, { "database": "PubMed", "id": "26517194", "url": "https://pubmed.ncbi.nlm.nih.gov/26517194" }, { "database": "PubMed", "id": "26517239", "url": "https://pubmed.ncbi.nlm.nih.gov/26517239" }, { "database": "PubMed", "id": "26556501", "url": "https://pubmed.ncbi.nlm.nih.gov/26556501" }, { "database": "PubMed", "id": "26677768", "url": "https://pubmed.ncbi.nlm.nih.gov/26677768" }, { "database": "PubMed", "id": "26683224", "url": "https://pubmed.ncbi.nlm.nih.gov/26683224" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26860083", "url": "https://pubmed.ncbi.nlm.nih.gov/26860083" }, { "database": "PubMed", "id": "26875667", "url": "https://pubmed.ncbi.nlm.nih.gov/26875667" }, { "database": "PubMed", "id": "26919204", "url": "https://pubmed.ncbi.nlm.nih.gov/26919204" }, { "database": "PubMed", "id": "27029031", "url": "https://pubmed.ncbi.nlm.nih.gov/27029031" }, { "database": "PubMed", "id": "27089984", "url": "https://pubmed.ncbi.nlm.nih.gov/27089984" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27258787", "url": "https://pubmed.ncbi.nlm.nih.gov/27258787" }, { "database": "PubMed", "id": "27259260", "url": "https://pubmed.ncbi.nlm.nih.gov/27259260" }, { "database": "PubMed", "id": "27273218", "url": "https://pubmed.ncbi.nlm.nih.gov/27273218" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27462418", "url": "https://pubmed.ncbi.nlm.nih.gov/27462418" }, { "database": "PubMed", "id": "27468685", "url": "https://pubmed.ncbi.nlm.nih.gov/27468685" }, { "database": "PubMed", "id": "27524627", "url": "https://pubmed.ncbi.nlm.nih.gov/27524627" }, { "database": "PubMed", "id": "27602502", "url": "https://pubmed.ncbi.nlm.nih.gov/27602502" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27613518", "url": "https://pubmed.ncbi.nlm.nih.gov/27613518" }, { "database": "PubMed", "id": "27705915", "url": "https://pubmed.ncbi.nlm.nih.gov/27705915" }, { "database": "PubMed", "id": "27907109", "url": "https://pubmed.ncbi.nlm.nih.gov/27907109" }, { "database": "PubMed", "id": "27959319", "url": "https://pubmed.ncbi.nlm.nih.gov/27959319" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28202068", "url": "https://pubmed.ncbi.nlm.nih.gov/28202068" }, { "database": "PubMed", "id": "28250390", "url": "https://pubmed.ncbi.nlm.nih.gov/28250390" }, { "database": "PubMed", "id": "28259977", "url": "https://pubmed.ncbi.nlm.nih.gov/28259977" }, { "database": "PubMed", "id": "28387728", "url": "https://pubmed.ncbi.nlm.nih.gov/28387728" }, { "database": "PubMed", "id": "28412751", "url": "https://pubmed.ncbi.nlm.nih.gov/28412751" }, { "database": "PubMed", "id": "28477111", "url": "https://pubmed.ncbi.nlm.nih.gov/28477111" }, { "database": "PubMed", "id": "28477132", "url": "https://pubmed.ncbi.nlm.nih.gov/28477132" }, { "database": "PubMed", "id": "28648892", "url": "https://pubmed.ncbi.nlm.nih.gov/28648892" }, { "database": "PubMed", "id": "28881600", "url": "https://pubmed.ncbi.nlm.nih.gov/28881600" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29088817", "url": "https://pubmed.ncbi.nlm.nih.gov/29088817" }, { "database": "PubMed", "id": "29147215", "url": "https://pubmed.ncbi.nlm.nih.gov/29147215" }, { "database": "PubMed", "id": "29294106", "url": "https://pubmed.ncbi.nlm.nih.gov/29294106" }, { "database": "PubMed", "id": "29399146", "url": "https://pubmed.ncbi.nlm.nih.gov/29399146" }, { "database": "PubMed", "id": "29540829", "url": "https://pubmed.ncbi.nlm.nih.gov/29540829" }, { "database": "PubMed", "id": "29615613", "url": "https://pubmed.ncbi.nlm.nih.gov/29615613" }, { "database": "PubMed", "id": "30088201", "url": "https://pubmed.ncbi.nlm.nih.gov/30088201" }, { "database": "PubMed", "id": "30237520", "url": "https://pubmed.ncbi.nlm.nih.gov/30237520" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30258062", "url": "https://pubmed.ncbi.nlm.nih.gov/30258062" }, { "database": "PubMed", "id": "30297868", "url": "https://pubmed.ncbi.nlm.nih.gov/30297868" }, { "database": "PubMed", "id": "30473536", "url": "https://pubmed.ncbi.nlm.nih.gov/30473536" }, { "database": "PubMed", "id": "30565836", "url": "https://pubmed.ncbi.nlm.nih.gov/30565836" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30679601", "url": "https://pubmed.ncbi.nlm.nih.gov/30679601" }, { "database": "PubMed", "id": "30783677", "url": "https://pubmed.ncbi.nlm.nih.gov/30783677" }, { "database": "PubMed", "id": "30886146", "url": "https://pubmed.ncbi.nlm.nih.gov/30886146" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30967632", "url": "https://pubmed.ncbi.nlm.nih.gov/30967632" }, { "database": "PubMed", "id": "31114877", "url": "https://pubmed.ncbi.nlm.nih.gov/31114877" }, { "database": "PubMed", "id": "31164689", "url": "https://pubmed.ncbi.nlm.nih.gov/31164689" }, { "database": "PubMed", "id": "31307507", "url": "https://pubmed.ncbi.nlm.nih.gov/31307507" }, { "database": "PubMed", "id": "31372798", "url": "https://pubmed.ncbi.nlm.nih.gov/31372798" }, { "database": "PubMed", "id": "31481733", "url": "https://pubmed.ncbi.nlm.nih.gov/31481733" }, { "database": "PubMed", "id": "31759252", "url": "https://pubmed.ncbi.nlm.nih.gov/31759252" }, { "database": "PubMed", "id": "31805725", "url": "https://pubmed.ncbi.nlm.nih.gov/31805725" }, { "database": "PubMed", "id": "31827702", "url": "https://pubmed.ncbi.nlm.nih.gov/31827702" }, { "database": "PubMed", "id": "31857852", "url": "https://pubmed.ncbi.nlm.nih.gov/31857852" }, { "database": "PubMed", "id": "32015321", "url": "https://pubmed.ncbi.nlm.nih.gov/32015321" }, { "database": "PubMed", "id": "32059363", "url": "https://pubmed.ncbi.nlm.nih.gov/32059363" }, { "database": "PubMed", "id": "32203529", "url": "https://pubmed.ncbi.nlm.nih.gov/32203529" }, { "database": "PubMed", "id": "32226530", "url": "https://pubmed.ncbi.nlm.nih.gov/32226530" }, { "database": "PubMed", "id": "32377397", "url": "https://pubmed.ncbi.nlm.nih.gov/32377397" }, { "database": "PubMed", "id": "32444694", "url": "https://pubmed.ncbi.nlm.nih.gov/32444694" }, { "database": "PubMed", "id": "32479542", "url": "https://pubmed.ncbi.nlm.nih.gov/32479542" }, { "database": "PubMed", "id": "32665601", "url": "https://pubmed.ncbi.nlm.nih.gov/32665601" }, { "database": "PubMed", "id": "32752095", "url": "https://pubmed.ncbi.nlm.nih.gov/32752095" }, { "database": "PubMed", "id": "32879366", "url": "https://pubmed.ncbi.nlm.nih.gov/32879366" }, { "database": "PubMed", "id": "33024871", "url": "https://pubmed.ncbi.nlm.nih.gov/33024871" }, { "database": "PubMed", "id": "33039867", "url": "https://pubmed.ncbi.nlm.nih.gov/33039867" }, { "database": "PubMed", "id": "33096336", "url": "https://pubmed.ncbi.nlm.nih.gov/33096336" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33437944", "url": "https://pubmed.ncbi.nlm.nih.gov/33437944" }, { "database": "PubMed", "id": "33628174", "url": "https://pubmed.ncbi.nlm.nih.gov/33628174" }, { "database": "PubMed", "id": "33802884", "url": "https://pubmed.ncbi.nlm.nih.gov/33802884" }, { "database": "PubMed", "id": "16141325", "url": "https://pubmed.ncbi.nlm.nih.gov/16141325" }, { "database": "PubMed", "id": "17525332", "url": "https://pubmed.ncbi.nlm.nih.gov/17525332" }, { "database": "PubMed", "id": "21144835", "url": "https://pubmed.ncbi.nlm.nih.gov/21144835" }, { "database": "PubMed", "id": "30944854", "url": "https://pubmed.ncbi.nlm.nih.gov/30944854" } ], "site_lbl": "Ser1981", "uniprot_canonical_ac": "Q13315-1" } ], "record_id": "pubmed.14871926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chromatin association of rad17 is required for an ataxia telangiectasia and rad-related kinase-mediated S-phase checkpoint in response to low-dose ultraviolet radiation.", "journal": "Molecular cancer research : MCR", "date": "2004", "authors": "Garg R, Callens S, Lim DS, Canman CE, Kastan MB, Xu B", "reference": { "type": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 143, "end_pos": 143, "sequence_org": "K", "sequence_mut": "E", "comment": "Impairs phosphorylation on S-656. Abolishes interaction with the RAD1-RAD9-HUS1 complex; does not affect interaction with RFC3.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11799063", "url": "https://pubmed.ncbi.nlm.nih.gov/11799063" }, { "database": "PubMed", "id": "10884395", "url": "https://pubmed.ncbi.nlm.nih.gov/10884395" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 143, "end_pos": 143, "sequence_org": "K", "sequence_mut": "G", "comment": "Impairs phosphorylation. Impairs interaction with DNA and the RAD1-RAD9-HUS1 complex; does not affect interaction with RFC3.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11799063", "url": "https://pubmed.ncbi.nlm.nih.gov/11799063" }, { "database": "PubMed", "id": "10884395", "url": "https://pubmed.ncbi.nlm.nih.gov/10884395" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-656.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with RAD1; when associated with D-656.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-646.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "D", "comment": "Abolishes interaction with RAD1; when associated with D-646.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" } ], "record_id": "pubmed.15235112", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction between human MCM7 and Rad17 proteins is required for replication checkpoint signaling.", "journal": "The EMBO journal", "date": "2004-11-24", "authors": "Tsao Cheng-Chung, Geisen Christoph, Abraham Robert T", "reference": { "type": "PubMed", "id": "15538388", "url": "https://pubmed.ncbi.nlm.nih.gov/15538388" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33993-1", "protein_name": "DNA replication licensing factor MCM7", "gene_name": "MCM7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15538388", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rad17 recruits the MRE11-RAD50-NBS1 complex to regulate the cellular response to DNA double-strand breaks.", "journal": "The EMBO journal", "date": "2014-04-16", "authors": "Wang Qinhong, Goldstein Michael, Alexander Peter, Wakeman Timothy P, Sun Tao, Feng Junjie, Lou Zhenkun, Kastan Michael B, Wang Xiao-Fan", "reference": { "type": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60934-1", "protein_name": "Nibrin", "gene_name": "NBN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 633, "end_pos": 633, "sequence_org": "T", "sequence_mut": "A", "comment": "Impaired phosphorylation by ATM and interaction with NBN.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 646, "end_pos": 646, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-656.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" }, { "start_pos": 656, "end_pos": 656, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces by 50% phosphorylation by ATR, and abolishes interaction with RAD1. Abolishes phosphorylation by ATR and checkpoint activation without affecting interaction with RAD17, RFC3, RFC4, ATM or ATR; when associated with A-646.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "11687627", "url": "https://pubmed.ncbi.nlm.nih.gov/11687627" }, { "database": "PubMed", "id": "14500819", "url": "https://pubmed.ncbi.nlm.nih.gov/14500819" }, { "database": "PubMed", "id": "11418864", "url": "https://pubmed.ncbi.nlm.nih.gov/11418864" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" }, { "database": "PubMed", "id": "15235112", "url": "https://pubmed.ncbi.nlm.nih.gov/15235112" } ], "uniprot_canonical_ac": "O75943-1" } ], "phosphorylation": [ { "start_pos": 633, "end_pos": 633, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by ATM", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "IntAct", "id": "O75943", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75943*" }, { "database": "iPTMnet", "id": "O75943", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75943" }, { "database": "PubMed", "id": "24534091", "url": "https://pubmed.ncbi.nlm.nih.gov/24534091" } ], "site_lbl": "Thr633", "uniprot_canonical_ac": "O75943-1" } ], "record_id": "pubmed.24534091", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic polymorphism at codon 546 of the human RAD17 contributes to the risk for esophageal squamous cell carcinoma.", "journal": "International journal of molecular epidemiology and genetics", "date": "2016", "authors": "Yasuda Y, Sakai A, Ito S, Mita Y, Sonoyama T, Tanabe S, Shirakawa Y, Naomoto Y, Katayama H, Shimizu K", "reference": { "type": "PubMed", "id": "27186329", "url": "https://pubmed.ncbi.nlm.nih.gov/27186329" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27186329", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human RAD 17 Polymorphism at Codon 546 Is Associated with the Risk of Colorectal Cancer.", "journal": "Acta medica Okayama", "date": "2017", "authors": "Yasuda Y, Sakai A, Ito S, Sasai K, Yamamoto H, Matsubara N, Ouchida M, Katayama H, Shimizu K", "reference": { "type": "PubMed", "id": "28238011", "url": "https://pubmed.ncbi.nlm.nih.gov/28238011" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28238011", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear translocation promotes proteasomal degradation of human Rad17 protein through the N-terminal destruction boxes.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Fukumoto Y, Ikeuchi M, Qu L, Hoshino T, Yamaguchi N, Nakayama Y, Ogra Y", "reference": { "type": "PubMed", "id": "34174284", "url": "https://pubmed.ncbi.nlm.nih.gov/34174284" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34174284", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Cell Cycle Checkpoint Gene, RAD17 rs1045051, Is Associated with Prostate Cancer Risk.", "journal": "Acta medica Okayama", "date": "2021", "authors": "Sun J, Lin W, Wang Q, Sakai A, Xue R, Watanabe M, Liu C, Sadahira T, Nasu Y, Xu A, Huang P", "reference": { "type": "PubMed", "id": "34511607", "url": "https://pubmed.ncbi.nlm.nih.gov/34511607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34511607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 9-1-1 DNA clamp subunit RAD1 forms specific interactions with clamp loader RAD17, revealing functional implications for binding-protein RHINO.", "journal": "The Journal of biological chemistry", "date": "2023-02-24", "authors": "Hara Kodai, Hishiki Asami, Hoshino Takako, Nagata Kiho, Iida Nao, Sawada Yukimasa, Ohashi Eiji, Hashimoto Hiroshi", "reference": { "type": "PubMed", "id": "36841485", "url": "https://pubmed.ncbi.nlm.nih.gov/36841485" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60921-1", "protein_name": "Checkpoint protein HUS1", "gene_name": "HUS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60671-1", "protein_name": "Cell cycle checkpoint protein RAD1", "gene_name": "RAD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99638-1", "protein_name": "Cell cycle checkpoint control protein RAD9A", "gene_name": "RAD9A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 18, "end_pos": 23, "sequence_org": "WVDPSF", "sequence_mut": "AADPSA", "comment": "Strongly reduced interaction with RAD1.", "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" }, { "database": "PubMed", "id": "36841485", "url": "https://pubmed.ncbi.nlm.nih.gov/36841485" } ], "uniprot_canonical_ac": "O75943-1" } ], "record_id": "pubmed.36841485", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The C-terminal tail of Rad17, iVERGE, binds the 9\u20121\u20121 complex independently of AAA+ ATPase domains to provide another clamp-loader interface.", "journal": "DNA repair", "date": "2023-10", "authors": "Fukumoto Yasunori, Hoshino Tyuji, Nakayama Yuji, Ogra Yasumitsu", "reference": { "type": "PubMed", "id": "37713925", "url": "https://pubmed.ncbi.nlm.nih.gov/37713925" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37713925", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of RAD17 as a candidate cancer predisposition gene in families with histories of pancreatic and breast cancers.", "journal": "BMC cancer", "date": "2024-06-13", "authors": "Joris Sofie, Giron Philippe, Olsen Catharina, Seneca Sara, Gheldof Alexander, Staessens Shula, Shahi Rajendra Bahadur, De Brakeleer Sylvia, Teugels Erik, De Gr\u00e8ve Jacques, Hes Frederik J", "reference": { "type": "PubMed", "id": "38872153", "url": "https://pubmed.ncbi.nlm.nih.gov/38872153" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38872153", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a human homologue of the Schizosaccharomyces pombe rad17+ checkpoint gene.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Parker A E, Van de Weyer I, Laus M C, Verhasselt P, Luyten W H", "reference": { "type": "PubMed", "id": "9660800", "url": "https://pubmed.ncbi.nlm.nih.gov/9660800" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9660800", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human and mouse homologs of the Schizosaccharomyces pombe rad17+ cell cycle checkpoint control gene.", "journal": "Genomics", "date": "1999", "authors": "Bluyssen H A, Naus N C, van Os R I, Jaspers I, Hoeijmakers J H, de Klein A", "reference": { "type": "PubMed", "id": "9933569", "url": "https://pubmed.ncbi.nlm.nih.gov/9933569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75943-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "RAD17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NXW6-1", "protein_name": "Cell cycle checkpoint protein RAD17", "gene_name": "Rad17", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75943", "url": "https://www.uniprot.org/uniprotkb/O75943" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9933569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation screening and association study of the TSSK4 Gene in Chinese infertile men with impaired spermatogenesis.", "journal": "Journal of andrology", "date": "2008", "authors": "Su D, Zhang W, Yang Y, Deng Y, Ma Y, Song H, Zhang S", "reference": { "type": "PubMed", "id": "18390560", "url": "https://pubmed.ncbi.nlm.nih.gov/18390560" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6SA08-1", "protein_name": "Testis-specific serine/threonine-protein kinase 4", "gene_name": "TSSK4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6SA08", "url": "https://www.uniprot.org/uniprotkb/Q6SA08" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18390560", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.", "journal": "Human reproduction (Oxford, England)", "date": "2010", "authors": "Aston KI, Krausz C, Laface I, Ruiz-Castane E, Carrell DT", "reference": { "type": "PubMed", "id": "20378615", "url": "https://pubmed.ncbi.nlm.nih.gov/20378615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6SA08-1", "protein_name": "Testis-specific serine/threonine-protein kinase 4", "gene_name": "TSSK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHS9-1", "protein_name": "Spermatogenesis-associated protein 22", "gene_name": "SPATA22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYF3-1", "protein_name": "Testis-expressed protein 11", "gene_name": "TEX11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BX26-1", "protein_name": "Synaptonemal complex protein 2", "gene_name": "SYCP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHL0-1", "protein_name": "ATP-dependent RNA helicase DDX25", "gene_name": "DDX25", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6SA08", "url": "https://www.uniprot.org/uniprotkb/Q6SA08" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20378615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Testis specific serine/threonine kinase 4 (Tssk4) maintains its kinase activity by phosphorylating itself at Thr-197.", "journal": "Molecular biology reports", "date": "2013", "authors": "Wei Y, Wang X, Fu G, Yu L", "reference": { "type": "PubMed", "id": "23054012", "url": "https://pubmed.ncbi.nlm.nih.gov/23054012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6SA08-1", "protein_name": "Testis-specific serine/threonine-protein kinase 4", "gene_name": "TSSK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9D411-1", "protein_name": "Testis-specific serine/threonine-protein kinase 4", "gene_name": "Tssk4", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6SA08", "url": "https://www.uniprot.org/uniprotkb/Q6SA08" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 197, "end_pos": 197, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q6SA08", "url": "https://www.uniprot.org/uniprotkb/Q6SA08" }, { "database": "iPTMnet", "id": "Q6SA08", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6SA08" }, { "database": "PubMed", "id": "23054012", "url": "https://pubmed.ncbi.nlm.nih.gov/23054012" } ], "site_lbl": "Thr197", "uniprot_canonical_ac": "Q6SA08-1" }, { "start_pos": 197, "end_pos": 197, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "Q9D411", "url": "https://www.uniprot.org/uniprotkb/Q9D411" }, { "database": "PubMed", "id": "26940607", "url": "https://pubmed.ncbi.nlm.nih.gov/26940607" }, { "database": "PubMed", "id": "23054012", "url": "https://pubmed.ncbi.nlm.nih.gov/23054012" }, { "database": "iPTMnet", "id": "Q9D411", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9D411" }, { "database": "PubMed", "id": "26961893", "url": "https://pubmed.ncbi.nlm.nih.gov/26961893" } ], "site_lbl": "Thr197", "uniprot_canonical_ac": "Q9D411-1" } ], "record_id": "pubmed.23054012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Testis specific serine/threonine protein kinase 4 (TSSK4) leads to cell apoptosis relying on its kinase activity.", "journal": "Journal of Huazhong University of Science and Technology. Medical sciences = Hua zhong ke ji da xue xue bao. Yi xue Ying De wen ban = Huazhong keji daxue xuebao. Yixue Yingdewen ban", "date": "2015", "authors": "Wang XL, Wei YH, Fu GL, Yu L", "reference": { "type": "PubMed", "id": "25877358", "url": "https://pubmed.ncbi.nlm.nih.gov/25877358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6SA08-1", "protein_name": "Testis-specific serine/threonine-protein kinase 4", "gene_name": "TSSK4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6SA08", "url": "https://www.uniprot.org/uniprotkb/Q6SA08" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25877358", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular identification of high and low affinity receptors for nicotinic acid.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wise A, Foord SM, Fraser NJ, Barnes AA, Elshourbagy N, Eilert M, Ignar DM, Murdock PR, Steplewski K, Green A, Brown AJ, Dowell SJ, Szekeres PG, Hassall DG, Marshall FH, Wilson S, Pike NB", "reference": { "type": "PubMed", "id": "12522134", "url": "https://pubmed.ncbi.nlm.nih.gov/12522134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80Z39-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "Hcar2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49019-1", "protein_name": "Hydroxycarboxylic acid receptor 3", "gene_name": "HCAR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12522134", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A G protein-coupled receptor responsive to bile acids.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kawamata Y, Fujii R, Hosoya M, Harada M, Yoshida H, Miwa M, Fukusumi S, Habata Y, Itoh T, Shintani Y, Hinuma S, Fujisawa Y, Fujino M", "reference": { "type": "PubMed", "id": "12524422", "url": "https://pubmed.ncbi.nlm.nih.gov/12524422" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80T02-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "Gpbar1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q862A9-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80SS6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "Gpbar1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12524422", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proton-sensing G-protein-coupled receptors.", "journal": "Nature", "date": "2003", "authors": "Ludwig MG, Vanek M, Guerini D, Gasser JA, Jones CE, Junker U, Hofstetter H, Wolf RM, Seuwen K", "reference": { "type": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 159, "end_pos": 159, "sequence_org": "H", "sequence_mut": "A", "comment": "No effect on pH-sensing activity.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 159, "end_pos": 159, "sequence_org": "H", "sequence_mut": "F", "comment": "No effect on pH-sensing activity.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 169, "end_pos": 169, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreased but not abolished proton-induced G protein-coupled receptor signaling. Failed to stimulate IP formation at pH 6.8, activity is restored at more acid pH. Abolished response to shear stress.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "29677517", "url": "https://pubmed.ncbi.nlm.nih.gov/29677517" }, { "database": "PubMed", "id": "32865988", "url": "https://pubmed.ncbi.nlm.nih.gov/32865988" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 169, "end_pos": 169, "sequence_org": "H", "sequence_mut": "F", "comment": "Decreased but not abolished proton-induced G protein-coupled receptor signaling. Failed to stimulate IP formation at pH 6.8, activity is restored at more acid pH. Abolished response to shear stress.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "29677517", "url": "https://pubmed.ncbi.nlm.nih.gov/29677517" }, { "database": "PubMed", "id": "32865988", "url": "https://pubmed.ncbi.nlm.nih.gov/32865988" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 175, "end_pos": 175, "sequence_org": "H", "sequence_mut": "A", "comment": "No effect on pH-sensing activity.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 175, "end_pos": 175, "sequence_org": "H", "sequence_mut": "F", "comment": "No effect on pH-sensing activity.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 17, "end_pos": 17, "sequence_org": "H", "sequence_mut": "F", "comment": "Decreased but not abolished proton-induced G protein-coupled receptor signaling. Failed to stimulate IP formation at pH 6.8, activity is restored at more acid pH. Abolished response to shear stress.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "29677517", "url": "https://pubmed.ncbi.nlm.nih.gov/29677517" }, { "database": "PubMed", "id": "32865988", "url": "https://pubmed.ncbi.nlm.nih.gov/32865988" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 20, "end_pos": 20, "sequence_org": "H", "sequence_mut": "F", "comment": "Failed to stimulate IP formation at pH 6.8, activity is restored at more acid pH.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 245, "end_pos": 245, "sequence_org": "H", "sequence_mut": "F", "comment": "Decreased but not abolished proton-induced G protein-coupled receptor signaling. Severe loss pH-sensing activity.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "32865988", "url": "https://pubmed.ncbi.nlm.nih.gov/32865988" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 269, "end_pos": 269, "sequence_org": "H", "sequence_mut": "F", "comment": "Decreased but not abolished proton-induced G protein-coupled receptor signaling. Failed to stimulate IP formation at pH 6.8, activity is restored at more acid pH.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "32865988", "url": "https://pubmed.ncbi.nlm.nih.gov/32865988" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "H", "sequence_mut": "F", "comment": "Decreased but not abolished proton-induced G protein-coupled receptor signaling. Failed to stimulate IP formation at pH 6.8, activity is restored at more acid pH. Abolished response to shear stress.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "29677517", "url": "https://pubmed.ncbi.nlm.nih.gov/29677517" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" }, { "database": "PubMed", "id": "32865988", "url": "https://pubmed.ncbi.nlm.nih.gov/32865988" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 89, "end_pos": 89, "sequence_org": "H", "sequence_mut": "A", "comment": "No effect on pH-sensing activity.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" } ], "uniprot_canonical_ac": "Q15743-1" }, { "start_pos": 89, "end_pos": 89, "sequence_org": "H", "sequence_mut": "F", "comment": "No effect on pH-sensing activity.", "evidence": [ { "database": "UniProtKB", "id": "Q15743", "url": "https://www.uniprot.org/uniprotkb/Q15743" }, { "database": "PubMed", "id": "12955148", "url": "https://pubmed.ncbi.nlm.nih.gov/12955148" }, { "database": "PubMed", "id": "40215959", "url": "https://pubmed.ncbi.nlm.nih.gov/40215959" } ], "uniprot_canonical_ac": "Q15743-1" } ], "record_id": "pubmed.12955148", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Specific recruitment of antigen-presenting cells by chemerin, a novel processed ligand from human inflammatory fluids.", "journal": "J. Exp. Med.", "date": "2003", "authors": "Wittamer Val\u00e9rie, Franssen Jean-Denis, Vulcano Marisa, Mirjolet Jean-Fran\u00e7ois, Le Poul Emmanuel, Migeotte Isabelle, Br\u00e9zillon St\u00e9phane, Tyldesley Richard, Blanpain C\u00e9dric, Detheux Michel, Mantovani Alberto, Sozzani Silvano, Vassart Gilbert, Parmentier Marc, Communi David", "reference": { "type": "PubMed", "id": "14530373", "url": "https://pubmed.ncbi.nlm.nih.gov/14530373" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14530373", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of platelet-activating factor receptor-coupled G alpha q leads to stimulation of Src and focal adhesion kinase via two separate pathways in human umbilical vein endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Deo DD, Bazan NG, Hunt JD", "reference": { "type": "PubMed", "id": "14617636", "url": "https://pubmed.ncbi.nlm.nih.gov/14617636" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14617636", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of human circulating TIG2 as a ligand for the orphan receptor ChemR23.", "journal": "FEBS Lett.", "date": "2003", "authors": "Meder W, Wendland M, Busmann A, Kutzleb C, Spodsberg N, John H, Richter R, Schleuder D, Meyer M, Forssmann WG", "reference": { "type": "PubMed", "id": "14675762", "url": "https://pubmed.ncbi.nlm.nih.gov/14675762" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14675762", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Citric acid cycle intermediates as ligands for orphan G-protein-coupled receptors.", "journal": "Nature", "date": "2004", "authors": "He W, Miao FJ, Lin DC, Schwandner RT, Wang Z, Gao J, Chen JL, Tian H, Ling L", "reference": { "type": "PubMed", "id": "15141213", "url": "https://pubmed.ncbi.nlm.nih.gov/15141213" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IYF9-1", "protein_name": "Succinate receptor 1", "gene_name": "Sucnr1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IYF8-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "Oxgr1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99MT6-1", "protein_name": "Succinate receptor 1", "gene_name": "Sucnr1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 103, "end_pos": 103, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolishes activation by succinate.", "evidence": [ { "database": "UniProtKB", "id": "Q9BXA5", "url": "https://www.uniprot.org/uniprotkb/Q9BXA5" }, { "database": "PubMed", "id": "15141213", "url": "https://pubmed.ncbi.nlm.nih.gov/15141213" } ], "uniprot_canonical_ac": "Q9BXA5-1" }, { "start_pos": 107, "end_pos": 107, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on receptor function.", "evidence": [ { "database": "UniProtKB", "id": "Q9BXA5", "url": "https://www.uniprot.org/uniprotkb/Q9BXA5" }, { "database": "PubMed", "id": "15141213", "url": "https://pubmed.ncbi.nlm.nih.gov/15141213" } ], "uniprot_canonical_ac": "Q9BXA5-1" }, { "start_pos": 249, "end_pos": 249, "sequence_org": "H", "sequence_mut": "A", "comment": "No effect on receptor function.", "evidence": [ { "database": "UniProtKB", "id": "Q9BXA5", "url": "https://www.uniprot.org/uniprotkb/Q9BXA5" }, { "database": "PubMed", "id": "15141213", "url": "https://pubmed.ncbi.nlm.nih.gov/15141213" } ], "uniprot_canonical_ac": "Q9BXA5-1" }, { "start_pos": 252, "end_pos": 252, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes activation by succinate.", "evidence": [ { "database": "UniProtKB", "id": "Q9BXA5", "url": "https://www.uniprot.org/uniprotkb/Q9BXA5" }, { "database": "PubMed", "id": "15141213", "url": "https://pubmed.ncbi.nlm.nih.gov/15141213" } ], "uniprot_canonical_ac": "Q9BXA5-1" }, { "start_pos": 255, "end_pos": 255, "sequence_org": "R", "sequence_mut": "A", "comment": "No effect on receptor function.", "evidence": [ { "database": "UniProtKB", "id": "Q9BXA5", "url": "https://www.uniprot.org/uniprotkb/Q9BXA5" }, { "database": "PubMed", "id": "15141213", "url": "https://pubmed.ncbi.nlm.nih.gov/15141213" } ], "uniprot_canonical_ac": "Q9BXA5-1" }, { "start_pos": 281, "end_pos": 281, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes activation by succinate.", "evidence": [ { "database": "UniProtKB", "id": "Q9BXA5", "url": "https://www.uniprot.org/uniprotkb/Q9BXA5" }, { "database": "PubMed", "id": "15141213", "url": "https://pubmed.ncbi.nlm.nih.gov/15141213" } ], "uniprot_canonical_ac": "Q9BXA5-1" }, { "start_pos": 99, "end_pos": 99, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolishes activation by succinate.", "evidence": [ { "database": "UniProtKB", "id": "Q9BXA5", "url": "https://www.uniprot.org/uniprotkb/Q9BXA5" }, { "database": "PubMed", "id": "15141213", "url": "https://pubmed.ncbi.nlm.nih.gov/15141213" } ], "uniprot_canonical_ac": "Q9BXA5-1" } ], "record_id": "pubmed.15141213", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 22 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G2A is a proton-sensing G-protein-coupled receptor antagonized by lysophosphatidylcholine.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Murakami N, Yokomizo T, Okuno T, Shimizu T", "reference": { "type": "PubMed", "id": "15280385", "url": "https://pubmed.ncbi.nlm.nih.gov/15280385" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15280385", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of ChemR23 in directing the migration of myeloid and plasmacytoid dendritic cells to lymphoid organs and inflamed skin.", "journal": "The Journal of experimental medicine", "date": "2005-02-21", "authors": "Vermi William, Riboldi Elena, Wittamer Valerie, Gentili Francesca, Luini Walter, Marrelli Simona, Vecchi Annunciata, Franssen Jean-Denis, Communi David, Massardi Luisa, Sironi Marina, Mantovani Alberto, Parmentier Marc, Facchetti Fabio, Sozzani Silvano", "reference": { "type": "PubMed", "id": "15728234", "url": "https://pubmed.ncbi.nlm.nih.gov/15728234" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15728234", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "(D)-beta-Hydroxybutyrate inhibits adipocyte lipolysis via the nicotinic acid receptor PUMA-G.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Taggart AK, Kero J, Gan X, Cai TQ, Cheng K, Ippolito M, Ren N, Kaplan R, Wu K, Wu TJ, Jin L, Liaw C, Chen R, Richman J, Connolly D, Offermanns S, Wright SD, Waters MG", "reference": { "type": "PubMed", "id": "15929991", "url": "https://pubmed.ncbi.nlm.nih.gov/15929991" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99788-1", "protein_name": "Chemerin-like receptor 1", "gene_name": "CMKLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14330-1", "protein_name": "N-arachidonyl glycine receptor", "gene_name": "GPR18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46093-1", "protein_name": "G protein-coupled receptor 4", "gene_name": "GPR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32249-1", "protein_name": "G protein-coupled receptor 183", "gene_name": "GPR183", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15743-1", "protein_name": "G protein-coupled receptor 68", "gene_name": "GPR68", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXA5-1", "protein_name": "Succinate receptor 1", "gene_name": "SUCNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34972-1", "protein_name": "Cannabinoid receptor 2", "gene_name": "CNR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49286-1", "protein_name": "Melatonin receptor type 1B", "gene_name": "MTNR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48039-1", "protein_name": "Melatonin receptor type 1A", "gene_name": "MTNR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDU6-1", "protein_name": "G protein-coupled bile acid receptor 1", "gene_name": "GPBAR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21554-1", "protein_name": "Cannabinoid receptor 1", "gene_name": "CNR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9EP66-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "Hcar2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9UNW8-1", "protein_name": "Probable G protein-coupled receptor 132", "gene_name": "GPR132", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2T6-1", "protein_name": "G protein-coupled receptor 55", "gene_name": "GPR55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HC97-1", "protein_name": "G protein-coupled receptor 35", "gene_name": "GPR35", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDS4-1", "protein_name": "Hydroxycarboxylic acid receptor 2", "gene_name": "HCAR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96P68-1", "protein_name": "2-oxoglutarate receptor 1", "gene_name": "OXGR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYL9-1", "protein_name": "G protein-coupled receptor 65", "gene_name": "GPR65", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43194-1", "protein_name": "G protein-coupled receptor 39", "gene_name": "GPR39", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99788", "url": "https://www.uniprot.org/uniprotkb/Q99788" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15929991", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]