[ { "title": "Gene expression of a novel cytochrome P450 of the CYP4F subfamily in human seminal vesicles.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1999", "authors": "Bylund J, Finnstrom N, Oliw EH", "reference": { "type": "PubMed", "id": "10405341", "url": "https://pubmed.ncbi.nlm.nih.gov/10405341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10405341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of CYP4F8 in human seminal vesicles as a prominent 19-hydroxylase of prostaglandin endoperoxides.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bylund J, Hidestrand M, Ingelman-Sundberg M, Oliw EH", "reference": { "type": "PubMed", "id": "10791960", "url": "https://pubmed.ncbi.nlm.nih.gov/10791960" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10791960", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDna cloning and expression of CYP4F12, a novel human cytochrome P450.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Bylund J, Bylund M, Oliw EH", "reference": { "type": "PubMed", "id": "11162607", "url": "https://pubmed.ncbi.nlm.nih.gov/11162607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20813-1", "protein_name": "Cytochrome P450 2B6", "gene_name": "CYP2B6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51589-1", "protein_name": "Cytochrome P450 2J2", "gene_name": "CYP2J2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10635-1", "protein_name": "Cytochrome P450 2D6", "gene_name": "CYP2D6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20853-1", "protein_name": "Cytochrome P450 2A7", "gene_name": "CYP2A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24903-1", "protein_name": "Cytochrome P450 2F1", "gene_name": "CYP2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16696-1", "protein_name": "Cytochrome P450 2A13", "gene_name": "CYP2A13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40394-1", "protein_name": "All-trans-retinol dehydrogenase [NAD(+)] ADH7", "gene_name": "ADH7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11162607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of CYP4F8 (prostaglandin H 19-hydroxylase) in human epithelia and prominent induction in epidermis of psoriatic lesions.", "journal": "Arch. Biochem. Biophys.", "date": "2003", "authors": "Stark Katarina, T\u00f6rm\u00e4 Hans, Cristea Mirela, Oliw Ernst H", "reference": { "type": "PubMed", "id": "12464258", "url": "https://pubmed.ncbi.nlm.nih.gov/12464258" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12464258", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoic acid induces corneal epithelial CYP4B1 gene expression and stimulates the synthesis of inflammatory 12-hydroxyeicosanoids.", "journal": "Journal of ocular pharmacology and therapeutics : the official journal of the Association for Ocular Pharmacology and Therapeutics", "date": "2004", "authors": "Ashkar S, Mesentsev A, Zhang WX, Mastyugin V, Dunn MW, Laniado-Schwartzman M", "reference": { "type": "PubMed", "id": "15006160", "url": "https://pubmed.ncbi.nlm.nih.gov/15006160" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20813-1", "protein_name": "Cytochrome P450 2B6", "gene_name": "CYP2B6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51589-1", "protein_name": "Cytochrome P450 2J2", "gene_name": "CYP2J2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10635-1", "protein_name": "Cytochrome P450 2D6", "gene_name": "CYP2D6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20853-1", "protein_name": "Cytochrome P450 2A7", "gene_name": "CYP2A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24903-1", "protein_name": "Cytochrome P450 2F1", "gene_name": "CYP2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16696-1", "protein_name": "Cytochrome P450 2A13", "gene_name": "CYP2A13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40394-1", "protein_name": "All-trans-retinol dehydrogenase [NAD(+)] ADH7", "gene_name": "ADH7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15006160", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "On the mechanism of biosynthesis of 19-hydroxyprostaglandins of human seminal fluid and expression of cyclooxygenase-2, PGH 19-hydroxylase (CYP4F8) and microsomal PGE synthase-1 in seminal vesicles and vas deferens.", "journal": "Prostaglandins & other lipid mediators", "date": "2005", "authors": "Stark K, Bylund J, Torma H, Sahlen G, Oliw EH", "reference": { "type": "PubMed", "id": "15789615", "url": "https://pubmed.ncbi.nlm.nih.gov/15789615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15789615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oxygenation of polyunsaturated long chain fatty acids by recombinant CYP4F8 and CYP4F12 and catalytic importance of Tyr-125 and Gly-328 of CYP4F8.", "journal": "Archives of biochemistry and biophysics", "date": "2005", "authors": "Stark K, Wongsud B, Burman R, Oliw EH", "reference": { "type": "PubMed", "id": "16112640", "url": "https://pubmed.ncbi.nlm.nih.gov/16112640" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 328, "end_pos": 328, "sequence_org": "G", "sequence_mut": "E", "comment": "No effect on U-44069 and U-51605 hydroxylation. 20:4n-6 hydroxylation shifted from C-18 to C-19.", "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" }, { "database": "PubMed", "id": "16112640", "url": "https://pubmed.ncbi.nlm.nih.gov/16112640" } ], "uniprot_canonical_ac": "P98187-1" } ], "record_id": "pubmed.16112640", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in a new cytochrome P450 gene in lamellar ichthyosis type 3.", "journal": "Human molecular genetics", "date": "2006", "authors": "Lefevre C, Bouadjar B, Ferrand V, Tadini G, Megarbane A, Lathrop M, Prud'homme JF, Fischer J", "reference": { "type": "PubMed", "id": "16436457", "url": "https://pubmed.ncbi.nlm.nih.gov/16436457" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16436457", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arachidonic acid pathway members PLA2G7, HPGD, EPHX2, and CYP4F8 identified as putative novel therapeutic targets in prostate cancer.", "journal": "The American journal of pathology", "date": "2011", "authors": "Vainio P, Gupta S, Ketola K, Mirtti T, Mpindi JP, Kohonen P, Fey V, Perala M, Smit F, Verhaegh G, Schalken J, Alanen KA, Kallioniemi O, Iljin K", "reference": { "type": "PubMed", "id": "21281786", "url": "https://pubmed.ncbi.nlm.nih.gov/21281786" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21281786", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "New Proluciferin Substrates for Human CYP4 Family Enzymes.", "journal": "Applied biochemistry and biotechnology", "date": "2021", "authors": "Liu J, Machalz D, Wolber G, Sorensen EJ, Bureik M", "reference": { "type": "PubMed", "id": "32869209", "url": "https://pubmed.ncbi.nlm.nih.gov/32869209" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86W10-1", "protein_name": "Cytochrome P450 4Z1", "gene_name": "CYP4Z1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32869209", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and expression of CYP2J2, a human cytochrome P450 arachidonic acid epoxygenase highly expressed in heart.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Wu S, Moomaw CR, Tomer KB, Falck JR, Zeldin DC", "reference": { "type": "PubMed", "id": "8631948", "url": "https://pubmed.ncbi.nlm.nih.gov/8631948" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05177-1", "protein_name": "Cytochrome P450 1A2", "gene_name": "CYP1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20813-1", "protein_name": "Cytochrome P450 2B6", "gene_name": "CYP2B6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51589-1", "protein_name": "Cytochrome P450 2J2", "gene_name": "CYP2J2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16678-1", "protein_name": "Cytochrome P450 1B1", "gene_name": "CYP1B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10635-1", "protein_name": "Cytochrome P450 2D6", "gene_name": "CYP2D6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20853-1", "protein_name": "Cytochrome P450 2A7", "gene_name": "CYP2A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33261-1", "protein_name": "Cytochrome P450 2C19", "gene_name": "CYP2C19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24903-1", "protein_name": "Cytochrome P450 2F1", "gene_name": "CYP2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10632-1", "protein_name": "Cytochrome P450 2C8", "gene_name": "CYP2C8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11712-1", "protein_name": "Cytochrome P450 2C9", "gene_name": "CYP2C9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16696-1", "protein_name": "Cytochrome P450 2A13", "gene_name": "CYP2A13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04798-1", "protein_name": "Cytochrome P450 1A1", "gene_name": "CYP1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P34913-1", "protein_name": "Bifunctional epoxide hydrolase 2", "gene_name": "EPHX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40394-1", "protein_name": "All-trans-retinol dehydrogenase [NAD(+)] ADH7", "gene_name": "ADH7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8631948", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CYP2J subfamily P450s in the lung: expression, localization, and potential functional significance.", "journal": "Molecular pharmacology", "date": "1996", "authors": "Zeldin DC, Foley J, Ma J, Boyle JE, Pascual JM, Moomaw CR, Tomer KB, Steenbergen C, Wu S", "reference": { "type": "PubMed", "id": "8913342", "url": "https://pubmed.ncbi.nlm.nih.gov/8913342" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20813-1", "protein_name": "Cytochrome P450 2B6", "gene_name": "CYP2B6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51589-1", "protein_name": "Cytochrome P450 2J2", "gene_name": "CYP2J2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10635-1", "protein_name": "Cytochrome P450 2D6", "gene_name": "CYP2D6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20853-1", "protein_name": "Cytochrome P450 2A7", "gene_name": "CYP2A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24903-1", "protein_name": "Cytochrome P450 2F1", "gene_name": "CYP2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16696-1", "protein_name": "Cytochrome P450 2A13", "gene_name": "CYP2A13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40394-1", "protein_name": "All-trans-retinol dehydrogenase [NAD(+)] ADH7", "gene_name": "ADH7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8913342", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of CYP4A11 as the major lauric acid omega-hydroxylase in human liver microsomes.", "journal": "Archives of biochemistry and biophysics", "date": "1996", "authors": "Powell PK, Wolf I, Lasker JM", "reference": { "type": "PubMed", "id": "8914854", "url": "https://pubmed.ncbi.nlm.nih.gov/8914854" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20813-1", "protein_name": "Cytochrome P450 2B6", "gene_name": "CYP2B6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51589-1", "protein_name": "Cytochrome P450 2J2", "gene_name": "CYP2J2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10635-1", "protein_name": "Cytochrome P450 2D6", "gene_name": "CYP2D6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20853-1", "protein_name": "Cytochrome P450 2A7", "gene_name": "CYP2A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24903-1", "protein_name": "Cytochrome P450 2F1", "gene_name": "CYP2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16696-1", "protein_name": "Cytochrome P450 2A13", "gene_name": "CYP2A13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40394-1", "protein_name": "All-trans-retinol dehydrogenase [NAD(+)] ADH7", "gene_name": "ADH7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8914854", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human leukotriene B4 omega-hydroxylase (CYP4F3) gene: molecular cloning and chromosomal localization.", "journal": "DNA and cell biology", "date": "1998", "authors": "Kikuta Y, Kato M, Yamashita Y, Miyauchi Y, Tanaka K, Kamada N, Kusunose M", "reference": { "type": "PubMed", "id": "9539102", "url": "https://pubmed.ncbi.nlm.nih.gov/9539102" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9539102", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoids, omega-hydroxyfatty acids and cytotoxic aldehydes as physiological substrates, and H2-receptor antagonists as pharmacological inhibitors, of human class IV alcohol dehydrogenase.", "journal": "FEBS letters", "date": "1998-04-24", "authors": "Allali-Hassani A, Peralba J M, Martras S, Farr\u00e9s J, Par\u00e9s X", "reference": { "type": "PubMed", "id": "9600267", "url": "https://pubmed.ncbi.nlm.nih.gov/9600267" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41682-1", "protein_name": "All-trans-retinol dehydrogenase [NAD(+)] ADH7", "gene_name": "Adh7", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P20813-1", "protein_name": "Cytochrome P450 2B6", "gene_name": "CYP2B6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51589-1", "protein_name": "Cytochrome P450 2J2", "gene_name": "CYP2J2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10635-1", "protein_name": "Cytochrome P450 2D6", "gene_name": "CYP2D6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20853-1", "protein_name": "Cytochrome P450 2A7", "gene_name": "CYP2A7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24903-1", "protein_name": "Cytochrome P450 2F1", "gene_name": "CYP2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16696-1", "protein_name": "Cytochrome P450 2A13", "gene_name": "CYP2A13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40394-1", "protein_name": "All-trans-retinol dehydrogenase [NAD(+)] ADH7", "gene_name": "ADH7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9600267", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of human CYP4F2 in hepatic catabolism of the proinflammatory agent leukotriene B4.", "journal": "Archives of biochemistry and biophysics", "date": "1998", "authors": "Jin R, Koop DR, Raucy JL, Lasker JM", "reference": { "type": "PubMed", "id": "9799565", "url": "https://pubmed.ncbi.nlm.nih.gov/9799565" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P98187-1", "protein_name": "Cytochrome P450 4F8", "gene_name": "CYP4F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNU6-1", "protein_name": "7-alpha-hydroxycholest-4-en-3-one 12-alpha-hydroxylase", "gene_name": "CYP8B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16647-1", "protein_name": "Prostacyclin synthase", "gene_name": "PTGIS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78329-1", "protein_name": "Cytochrome P450 4F2", "gene_name": "CYP4F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02928-1", "protein_name": "Cytochrome P450 4A11", "gene_name": "CYP4A11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13584-1", "protein_name": "Cytochrome P450 4B1", "gene_name": "CYP4B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCH4-1", "protein_name": "Cytochrome P450 4A22", "gene_name": "CYP4A22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NT55-1", "protein_name": "Ultra-long-chain fatty acid omega-hydroxylase", "gene_name": "CYP4F22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCS2-1", "protein_name": "Cytochrome P450 4F12", "gene_name": "CYP4F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08477-1", "protein_name": "Cytochrome P450 4F3", "gene_name": "CYP4F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBI6-1", "protein_name": "Cytochrome P450 4F11", "gene_name": "CYP4F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P98187", "url": "https://www.uniprot.org/uniprotkb/P98187" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9799565", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Haplotype analysis of the human alpha2-HS glycoprotein (fetuin) gene.", "journal": "Annals of human genetics", "date": "2001", "authors": "Osawa M, Yuasa I, Kitano T, Henke J, Kaneko M, Udono T, Saitou N, Umetsu K", "reference": { "type": "PubMed", "id": "11415520", "url": "https://pubmed.ncbi.nlm.nih.gov/11415520" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11415520", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of human plasma alpha2-Heremans-Schmid glycoprotein (human fetuin) in vivo.", "journal": "The Biochemical journal", "date": "2001", "authors": "Haglund AC, Ek B, Ek P", "reference": { "type": "PubMed", "id": "11439093", "url": "https://pubmed.ncbi.nlm.nih.gov/11439093" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" }, { "database": "iPTMnet", "id": "P02765", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02765" }, { "database": "PubMed", "id": "11439093", "url": "https://pubmed.ncbi.nlm.nih.gov/11439093" }, { "database": "PubMed", "id": "18088087", "url": "https://pubmed.ncbi.nlm.nih.gov/18088087" }, { "database": "PubMed", "id": "18212344", "url": "https://pubmed.ncbi.nlm.nih.gov/18212344" }, { "database": "PubMed", "id": "18491316", "url": "https://pubmed.ncbi.nlm.nih.gov/18491316" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19007248", "url": "https://pubmed.ncbi.nlm.nih.gov/19007248" }, { "database": "PubMed", "id": "19415658", "url": "https://pubmed.ncbi.nlm.nih.gov/19415658" }, { "database": "PubMed", "id": "19562805", "url": "https://pubmed.ncbi.nlm.nih.gov/19562805" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "20187088", "url": "https://pubmed.ncbi.nlm.nih.gov/20187088" }, { "database": "IEDB", "id": "P02765", "url": "https://www.iedb.org/epitope/P02765" }, { "database": "PubMed", "id": "35494241", "url": "https://pubmed.ncbi.nlm.nih.gov/35494241" }, { "database": "PubMed", "id": "18318008", "url": "https://pubmed.ncbi.nlm.nih.gov/18318008" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "26091039", "url": "https://pubmed.ncbi.nlm.nih.gov/26091039" } ], "site_lbl": "Ser138", "uniprot_canonical_ac": "P02765-1" }, { "start_pos": 330, "end_pos": 330, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by FAM20C", "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" }, { "database": "iPTMnet", "id": "P02765", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P02765" }, { "database": "PubMed", "id": "11439093", "url": "https://pubmed.ncbi.nlm.nih.gov/11439093" }, { "database": "PubMed", "id": "19562805", "url": "https://pubmed.ncbi.nlm.nih.gov/19562805" }, { "database": "PubMed", "id": "19824718", "url": "https://pubmed.ncbi.nlm.nih.gov/19824718" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "26091039", "url": "https://pubmed.ncbi.nlm.nih.gov/26091039" } ], "site_lbl": "Ser330", "uniprot_canonical_ac": "P02765-1" } ], "record_id": "pubmed.11439093", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the N- and O-glycans of the A-chain of human plasma alpha 2HS-glycoprotein as deduced from the chemical compositions of the derivatives prepared by stepwise degradation with exoglycosidases.", "journal": "Biochemistry", "date": "1992", "authors": "Watzlawick H, Walsh MT, Yoshioka Y, Schmid K, Brossmer R", "reference": { "type": "PubMed", "id": "1457416", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, "referenced_glycans": [ { "glytoucan_ac": "G65562ZE" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G84467IZ" }, { "glytoucan_ac": "G48414YA" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ASN-156 AND ASN-176", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111000.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-156, N-176, T-256, T-270, S-346", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111000.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-156, N-176, T-256, T-270, S-346", "icn3d_view": {}, "start_pos": 270, "start_aa": "Thr", "end_pos": 270, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr270", "evidence": [ { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 270, "start_aa": "Thr", "end_pos": 270, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr270", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-156, N-176, T-256, T-270, S-346", "icn3d_view": {}, "start_pos": 346, "start_aa": "Ser", "end_pos": 346, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser346", "evidence": [ { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Ser", "end_pos": 346, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser346", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001", "uniprot_canonical_ac": "P02765-1" } ], "glycan_expression": [ { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {} }, { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Thr", "start_pos": 270, "end_pos": 270 }, { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Ser", "start_pos": 346, "end_pos": 346 }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Thr", "start_pos": 270, "end_pos": 270 }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Ser", "start_pos": 346, "end_pos": 346 }, { "glytoucan_ac": "G84467IZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Gallus gallus", "taxid": 9031, "reference_species": "Gallus gallus [9031]", "common_name": "Chicken", "glygen_name": "Chicken" }, "cell_line": {} }, { "glytoucan_ac": "G84467IZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G84467IZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 } ], "record_id": "pubmed.1457416", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 2 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "exact_n_linked_glycan_sites", "count": 2 }, { "field": "exact_n_linked_glycans", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "exact_o_linked_glycan_sites", "count": 2 }, { "field": "exact_o_linked_glycans", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 2 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 4 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "exact_n_linked_glycan_sites", "count": 2 }, { "field": "exact_n_linked_glycans", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "exact_o_linked_glycan_sites", "count": 2 }, { "field": "exact_o_linked_glycans", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glycomic analysis of high density lipoprotein shows a highly sialylated particle.", "journal": "Journal of proteome research", "date": "2014", "authors": "Huang J, Lee H, Zivkovic AM, Smilowitz JT, Rivera N, German JB, Lebrilla CB", "reference": { "type": "PubMed", "id": "24417605", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, "referenced_glycans": [ { "glytoucan_ac": "G42358LZ" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G37868ZX" }, { "glytoucan_ac": "G68008QO" }, { "glytoucan_ac": "G81006GJ" }, { "glytoucan_ac": "G06356OH" }, { "glytoucan_ac": "G57818FI" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G23863VK" }, { "glytoucan_ac": "G17041QN" }, { "glytoucan_ac": "G61937QU" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02656-1", "protein_name": "Apolipoprotein C-III", "gene_name": "APOC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02749-1", "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02787-1", "protein_name": "Serotransferrin", "gene_name": "TF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01042-1", "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04217-1", "protein_name": "Alpha-1B-glycoprotein", "gene_name": "A1BG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01009-1", "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G17041QN", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 270, "start_aa": "Thr", "end_pos": 270, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr270", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111101.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G68008QO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 270, "start_aa": "Thr", "end_pos": 270, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr270", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010000000011111101.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 270, "start_aa": "Thr", "end_pos": 270, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr270", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 270, "start_aa": "Thr", "end_pos": 270, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr270", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G17041QN", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Ser", "end_pos": 346, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser346", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010100000011111101.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Ser", "end_pos": 346, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser346", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G68008QO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 94, "start_aa": "Thr", "end_pos": 94, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr94", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "58", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/58" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010000000011111101.00001.01011", "uniprot_canonical_ac": "P02656-1" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 94, "start_aa": "Thr", "end_pos": 94, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr94", "evidence": [ { "id": "208636", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/208636" }, { "id": "58", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/58" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01011", "uniprot_canonical_ac": "P02656-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "1456441", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1456441" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 542, "start_aa": "Thr", "end_pos": 542, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr542", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 246, "start_aa": "Asn", "end_pos": 246, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn246", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 24, "start_aa": "Thr", "end_pos": 24, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr24", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 363, "start_aa": "Asn", "end_pos": 363, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn363", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 363, "start_aa": "Asn", "end_pos": 363, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn363", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01009-1" } ], "glycan_expression": [ { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Thr", "start_pos": 270, "end_pos": 270 }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Ser", "start_pos": 346, "end_pos": 346 }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Thr", "start_pos": 24, "end_pos": 24 }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Thr", "start_pos": 542, "end_pos": 542 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 363, "end_pos": 363 }, { "glytoucan_ac": "G68008QO", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Thr", "start_pos": 270, "end_pos": 270 }, { "glytoucan_ac": "G68008QO", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02656-1", "residue": "Thr", "start_pos": 94, "end_pos": 94 }, { "glytoucan_ac": "G81006GJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Thr", "start_pos": 270, "end_pos": 270 }, { "glytoucan_ac": "G81006GJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02656-1", "residue": "Thr", "start_pos": 94, "end_pos": 94 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 363, "end_pos": 363 }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 246, "end_pos": 246 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 107, "end_pos": 107 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 70, "end_pos": 70 }, { "glytoucan_ac": "G17041QN", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Thr", "start_pos": 270, "end_pos": 270 }, { "glytoucan_ac": "G17041QN", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Ser", "start_pos": 346, "end_pos": 346 } ], "record_id": "pubmed.24417605", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 24 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_sites", "count": 11 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 11 }, { "field": "o_linked_glycan_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 6 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "exact_sites", "count": 16 }, { "field": "exact_n_linked_sites", "count": 11 }, { "field": "exact_n_linked_glycan_sites", "count": 11 }, { "field": "exact_n_linked_glycans", "count": 6 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "exact_o_linked_glycan_sites", "count": 5 }, { "field": "exact_o_linked_glycans", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 24 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_sites", "count": 11 }, { "field": "o_linked_sites", "count": 5 }, { "field": "n_linked_glycan_sites", "count": 11 }, { "field": "o_linked_glycan_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 6 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "exact_sites", "count": 16 }, { "field": "exact_n_linked_sites", "count": 11 }, { "field": "exact_n_linked_glycan_sites", "count": 11 }, { "field": "exact_n_linked_glycans", "count": 6 }, { "field": "exact_o_linked_sites", "count": 5 }, { "field": "exact_o_linked_glycan_sites", "count": 5 }, { "field": "exact_o_linked_glycans", "count": 4 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The position of the disulfide bonds in human plasma alpha 2 HS-glycoprotein and the repeating double disulfide bonds in the domain structure.", "journal": "Biochim. Biophys. Acta", "date": "1989", "authors": "Araki T, Yoshioka Y, Schmid K", "reference": { "type": "PubMed", "id": "2645941", "url": "https://pubmed.ncbi.nlm.nih.gov/2645941" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2645941", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The arrangement of disulfide loops in human alpha 2-HS glycoprotein. Similarity to the disulfide bridge structures of cystatins and kininogens.", "journal": "J. Biol. Chem.", "date": "1989", "authors": "Kellermann J, Haupt H, Auerswald EA, Muller-Ester W", "reference": { "type": "PubMed", "id": "2760061", "url": "https://pubmed.ncbi.nlm.nih.gov/2760061" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2760061", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of AHSG with alopecia and mental retardation (APMR) syndrome.", "journal": "Human genetics", "date": "2017", "authors": "Reza Sailani M, Jahanbani F, Nasiri J, Behnam M, Salehi M, Sedghi M, Hoseinzadeh M, Takahashi S, Zia A, Gruber J, Lynch JL, Lam D, Winkelmann J, Amirkiai S, Pang B, Rego S, Mazroui S, Bernstein JA, Snyder MP", "reference": { "type": "PubMed", "id": "28054173", "url": "https://pubmed.ncbi.nlm.nih.gov/28054173" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28054173", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human alpha 2-HS-glycoprotein: the A and B chains with a connecting sequence are encoded by a single mRNA transcript.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Lee C C, Bowman B H, Yang F M", "reference": { "type": "PubMed", "id": "3474608", "url": "https://pubmed.ncbi.nlm.nih.gov/3474608" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3474608", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AHSG, a Gene Promoting Tumour Proliferation, Migration and Invasion, is an Independent Prognostic Factor for Poor Overall Survival in Lung Adenocarcinoma.", "journal": "Molecular biology reports", "date": "2023-09", "authors": "Xing Xiaoying, Cao Fumin, Gao Liping, Song Minglei", "reference": { "type": "PubMed", "id": "37535244", "url": "https://pubmed.ncbi.nlm.nih.gov/37535244" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37535244", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evaluation of atherosclerotic risk in rosacea patients through serum fetuin-A and carotid intima media thickness.", "journal": "Journal of cosmetic dermatology", "date": "2024-03", "authors": "Kulakl\u0131 Sevgi, Y\u0131ld\u0131rmak Sembol, O\u011fuz I\u015f\u0131l Deniz, Usta Murat, Tosun Alptekin, Ak\u015fan Burak", "reference": { "type": "PubMed", "id": "37994275", "url": "https://pubmed.ncbi.nlm.nih.gov/37994275" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37994275", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fetuin-A and its genetic association with cardiometabolic disease.", "journal": "Scientific reports", "date": "2023-12-06", "authors": "Al Ali Lawien, van de Vegte Yordi J, Said M Abdullah, Groot Hilde E, Hendriks Tom, Yeung Ming Wai, Lipsic Erik, van der Harst Pim", "reference": { "type": "PubMed", "id": "38052855", "url": "https://pubmed.ncbi.nlm.nih.gov/38052855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38052855", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EVALUATION OF FETUIN-A LEVEL IN POLYCYSTIC OVARY SYNDROME AND ITS ASSOCIATION WITH ASPROSIN AND SOME BIOCHEMICAL PARAMETERS.", "journal": "Georgian medical news", "date": "2023-10", "authors": "Mahmmoed B, Hilal N, Sarhat E", "reference": { "type": "PubMed", "id": "38096518", "url": "https://pubmed.ncbi.nlm.nih.gov/38096518" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38096518", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The complete amino acid sequence of the A-chain of human plasma alpha 2HS-glycoprotein.", "journal": "J. Biol. Chem.", "date": "1986", "authors": "Yoshioka Y, Gejyo F, Marti T, Rickli E E, B\u00fcrgi W, Offner G D, Troxler R F, Schmid K", "reference": { "type": "PubMed", "id": "3944104", "url": "https://pubmed.ncbi.nlm.nih.gov/3944104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3944104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the B-chain of human plasma alpha 2HS-glycoprotein. The complete amino acid sequence and primary structure of its heteroglycan.", "journal": "J. Biol. Chem.", "date": "1983", "authors": "Gejyo F, Chang JL, Burgi W, Schmid K, Offner GD, Troxler RF, Van Halbeek H, Dorland L, Gerwig GJ, Vliegenthart JF", "reference": { "type": "PubMed", "id": "6833285", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, "referenced_glycans": [ { "glytoucan_ac": "G65562ZE" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G84467IZ" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ASN-156 AND ASN-176", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111000.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-156, N-176, T-256, T-270, S-346", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111000.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-156, N-176, T-256, T-270, S-346", "icn3d_view": {}, "start_pos": 256, "start_aa": "Ser", "end_pos": 256, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser256", "evidence": [ { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-156, N-176, T-256, T-270, S-346", "icn3d_view": {}, "start_pos": 270, "start_aa": "Thr", "end_pos": 270, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr270", "evidence": [ { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 270, "start_aa": "Thr", "end_pos": 270, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr270", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G65562ZE", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "GlycoSuiteDB curation notes. Reported structure can be attached to the following: N-156, N-176, T-256, T-270, S-346", "icn3d_view": {}, "start_pos": 346, "start_aa": "Ser", "end_pos": 346, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser346", "evidence": [ { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010100000011111011.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Ser", "end_pos": 346, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser346", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "6833285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6833285" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01001", "uniprot_canonical_ac": "P02765-1" } ], "glycan_expression": [ { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Thr", "start_pos": 270, "end_pos": 270 }, { "glytoucan_ac": "G65562ZE", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Ser", "start_pos": 346, "end_pos": 346 }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Thr", "start_pos": 270, "end_pos": 270 }, { "glytoucan_ac": "G74722FL", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Ser", "start_pos": 346, "end_pos": 346 } ], "record_id": "pubmed.6833285", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 3 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "exact_n_linked_glycan_sites", "count": 2 }, { "field": "exact_n_linked_glycans", "count": 1 }, { "field": "exact_o_linked_sites", "count": 3 }, { "field": "exact_o_linked_glycan_sites", "count": 3 }, { "field": "exact_o_linked_glycans", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 3 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 1 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 5 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "exact_n_linked_glycan_sites", "count": 2 }, { "field": "exact_n_linked_glycans", "count": 1 }, { "field": "exact_o_linked_sites", "count": 3 }, { "field": "exact_o_linked_glycan_sites", "count": 3 }, { "field": "exact_o_linked_glycans", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular evidence for human alpha 2-HS glycoprotein (AHSG) polymorphism.", "journal": "Human genetics", "date": "1997", "authors": "Osawa M, Umetsu K, Ohki T, Nagasawa T, Suzuki T, Takeichi S", "reference": { "type": "PubMed", "id": "9003486", "url": "https://pubmed.ncbi.nlm.nih.gov/9003486" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9003486", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the gene encoding human alpha 2-HS glycoprotein (AHSG).", "journal": "Gene", "date": "1997", "authors": "Osawa M, Umetsu K, Sato M, Ohki T, Yukawa N, Suzuki T, Takeichi S", "reference": { "type": "PubMed", "id": "9322749", "url": "https://pubmed.ncbi.nlm.nih.gov/9322749" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P02765", "url": "https://www.uniprot.org/uniprotkb/P02765" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9322749", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2001", "authors": "Xu X R, Huang J, Xu Z G, Qian B Z, Zhu Z D, Yan Q, Cai T, Zhang X, Xiao H S, Qu J, Liu F, Huang Q H, Cheng Z H, Li N G, Du J J, Hu W, Shen K T, Lu G, Fu G, Zhong M, Xu S H, Gu W Y, Huang W, Zhao X T, Hu G X, Gu J R, Chen Z, Han Z G", "reference": { "type": "PubMed", "id": "11752456", "url": "https://pubmed.ncbi.nlm.nih.gov/11752456" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A1B0GV85-1", "protein_name": "Reelin domain-containing protein 1", "gene_name": "REELD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C864-1", "protein_name": "Putative uncharacterized protein DANCR", "gene_name": "DANCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11752456", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of tissue expression and full-length coding sequence of a novel human gene mapping at 3q12.1 and transcribed in oligodendrocytes.", "journal": "Gene", "date": "2002", "authors": "Fayein Nicole-Adeline, Stankoff Bruno, Auffray Charles, Devignes Marie-Dominique", "reference": { "type": "PubMed", "id": "12036590", "url": "https://pubmed.ncbi.nlm.nih.gov/12036590" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12036590", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of genes differentially expressed in human primary lung squamous cell carcinoma.", "journal": "Lung cancer (Amsterdam, Netherlands)", "date": "2007", "authors": "Liu Y, Sun W, Zhang K, Zheng H, Ma Y, Lin D, Zhang X, Feng L, Lei W, Zhang Z, Guo S, Han N, Tong W, Feng X, Gao Y, Cheng S", "reference": { "type": "PubMed", "id": "17316888", "url": "https://pubmed.ncbi.nlm.nih.gov/17316888" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17316888", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Predicted expansion of the claudin multigene family.", "journal": "FEBS Lett.", "date": "2011", "authors": "Mineta K, Yamamoto Y, Yamazaki Y, Tanaka H, Tada Y, Saito K, Tamura A, Igarashi M, Endo T, Takeuchi K, Tsukita S", "reference": { "type": "PubMed", "id": "21276448", "url": "https://pubmed.ncbi.nlm.nih.gov/21276448" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "B3SHH9-1", "protein_name": "Transmembrane protein 114", "gene_name": "TMEM114", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NFC5-1", "protein_name": "Transmembrane protein 235", "gene_name": "TMEM235", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9CQX5-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "Cldnd1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "B1AQL3-1", "protein_name": "Transmembrane protein 235", "gene_name": "Tmem235", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9D563-1", "protein_name": "Transmembrane protein 114", "gene_name": "Tmem114", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21276448", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Down Regulation of CLDND1 Induces Apoptosis in Breast Cancer Cells.", "journal": "PloS one", "date": "2015", "authors": "Achari C, Winslow S, Larsson C", "reference": { "type": "PubMed", "id": "26083392", "url": "https://pubmed.ncbi.nlm.nih.gov/26083392" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26083392", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The retinoic acid receptor-related orphan receptor alpha positively regulates tight junction protein claudin domain-containing 1 mRNA expression in human brain endothelial cells.", "journal": "Journal of biochemistry", "date": "2017", "authors": "Matsuoka H, Shima A, Uda A, Ezaki H, Michihara A", "reference": { "type": "PubMed", "id": "28130419", "url": "https://pubmed.ncbi.nlm.nih.gov/28130419" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28130419", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Claudin domain containing 1 contributing to endothelial cell adhesion decreases in presence of cerebellar hemorrhage.", "journal": "Journal of neuroscience research", "date": "2017", "authors": "Ohnishi M, Ochiai H, Matsuoka K, Akagi M, Nakayama Y, Shima A, Uda A, Matsuoka H, Kamishikiryo J, Michihara A, Inoue A", "reference": { "type": "PubMed", "id": "28244141", "url": "https://pubmed.ncbi.nlm.nih.gov/28244141" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9CQX5-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "Cldnd1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28244141", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Long non-coding RNA Z38 promotes cell proliferation and metastasis in human renal cell carcinoma.", "journal": "Molecular medicine reports", "date": "2017", "authors": "He X, Liu H, Guo F, Feng Y, Gao Y, Sun F, Song B, Lu H, Li Y", "reference": { "type": "PubMed", "id": "28849012", "url": "https://pubmed.ncbi.nlm.nih.gov/28849012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28849012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcription of CLDND1 in human brain endothelial cells is regulated by the myeloid zinc finger 1.", "journal": "Clinical and experimental pharmacology & physiology", "date": "2021-02", "authors": "Shima Akiho, Matsuoka Hiroshi, Yamaoka Alice, Michihara Akihiro", "reference": { "type": "PubMed", "id": "33037622", "url": "https://pubmed.ncbi.nlm.nih.gov/33037622" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33037622", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A loss of function mutation in CLDN25 causing Pelizaeus-Merzbacher-like leukodystrophy.", "journal": "Human molecular genetics", "date": "2024-06-05", "authors": "Hashimoto Yosuke, Besmond Claude, Boddaert Nathalie, Munnich Arnold, Campbell Matthew", "reference": { "type": "PubMed", "id": "38493358", "url": "https://pubmed.ncbi.nlm.nih.gov/38493358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NY35-1", "protein_name": "Claudin domain-containing protein 1", "gene_name": "CLDND1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NY35", "url": "https://www.uniprot.org/uniprotkb/Q9NY35" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38493358", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.", "journal": "Genome biology", "date": "2007", "authors": "Szafranski K, Schindler S, Taudien S, Hiller M, Huse K, Jahn N, Schreiber S, Backofen R, Platzer M", "reference": { "type": "PubMed", "id": "17672918", "url": "https://pubmed.ncbi.nlm.nih.gov/17672918" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N1P7-1", "protein_name": "Beta/gamma crystallin domain-containing protein 2", "gene_name": "CRYBG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86WP2-1", "protein_name": "Vasculin", "gene_name": "GPBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2Z4-1", "protein_name": "Tyrosine--tRNA ligase, mitochondrial", "gene_name": "YARS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VE9-1", "protein_name": "Serine incorporator 5", "gene_name": "SERINC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96LC7-1", "protein_name": "Sialic acid-binding Ig-like lectin 10", "gene_name": "SIGLEC10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NHM5-1", "protein_name": "Lysine-specific demethylase 2B", "gene_name": "KDM2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75071-1", "protein_name": "EF-hand calcium-binding domain-containing protein 14", "gene_name": "EFCAB14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WXK1-1", "protein_name": "Ankyrin repeat and SOCS box protein 15", "gene_name": "ASB15", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43390-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein R", "gene_name": "HNRNPR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58658-1", "protein_name": "Protein eva-1 homolog C", "gene_name": "EVA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EF6-1", "protein_name": "F-box only protein 17", "gene_name": "FBXO17", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DX52-1", "protein_name": "Golgin subfamily A member 8F", "gene_name": "GOLGA8F", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96HE9-1", "protein_name": "Proline-rich protein 11", "gene_name": "PRR11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5JVF3-1", "protein_name": "PCI domain-containing protein 2", "gene_name": "PCID2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQZ5-1", "protein_name": "StAR-related lipid transfer protein 7, mitochondrial", "gene_name": "STARD7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5U8-1", "protein_name": "Mitochondrial pyruvate carrier 1", "gene_name": "MPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5HYK7-1", "protein_name": "SH3 domain-containing protein 19", "gene_name": "SH3D19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y97-1", "protein_name": "Histone-lysine N-methyltransferase KMT5C", "gene_name": "KMT5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NXP2-1", "protein_name": "Golgi-associated RAB2 interactor protein 1A", "gene_name": "GARIN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z3V4-1", "protein_name": "Ubiquitin-protein ligase E3B", "gene_name": "UBE3B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N1P7", "url": "https://www.uniprot.org/uniprotkb/Q8N1P7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17672918", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Absent in melanoma 1-like (AIM1L) serves as a novel candidate for overall survival in hepatocellular carcinoma.", "journal": "Bioengineered", "date": "2021", "authors": "Zhou W, Zhang Y, Zhang S, Yang Z", "reference": { "type": "PubMed", "id": "34130591", "url": "https://pubmed.ncbi.nlm.nih.gov/34130591" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N1P7-1", "protein_name": "Beta/gamma crystallin domain-containing protein 2", "gene_name": "CRYBG2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N1P7", "url": "https://www.uniprot.org/uniprotkb/Q8N1P7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34130591", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tissue expression of copines and isolation of copines I and III from the cytosol of human neutrophils.", "journal": "J. Leukoc. Biol.", "date": "2003", "authors": "Cowland JB, Carter D, Bjerregaard MD, Johnsen AH, Borregaard N, Lollike K", "reference": { "type": "PubMed", "id": "12949241", "url": "https://pubmed.ncbi.nlm.nih.gov/12949241" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96FN4-1", "protein_name": "Copine-2", "gene_name": "CPNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99829-1", "protein_name": "Copine-1", "gene_name": "CPNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCH3-1", "protein_name": "Copine-5", "gene_name": "CPNE5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75131-1", "protein_name": "Copine-3", "gene_name": "CPNE3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95741-1", "protein_name": "Copine-6", "gene_name": "CPNE6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A23-1", "protein_name": "Copine-4", "gene_name": "CPNE4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBL6-1", "protein_name": "Copine-7", "gene_name": "CPNE7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96FN4", "url": "https://www.uniprot.org/uniprotkb/Q96FN4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12949241", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sex-specific proteome differences in the anterior cingulate cortex of schizophrenia.", "journal": "Journal of psychiatric research", "date": "2010", "authors": "Martins-de-Souza D, Schmitt A, Roder R, Lebar M, Schneider-Axmann T, Falkai P, Turck CW", "reference": { "type": "PubMed", "id": "20381070", "url": "https://pubmed.ncbi.nlm.nih.gov/20381070" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96FN4-1", "protein_name": "Copine-2", "gene_name": "CPNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12765-1", "protein_name": "Secernin-1", "gene_name": "SCRN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96FN4", "url": "https://www.uniprot.org/uniprotkb/Q96FN4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20381070", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular analysis of the GCF gene identifies revisions to the cDNA and amino acid sequences.", "journal": "Biochim. Biophys. Acta", "date": "1999", "authors": "Takimoto M, Mao P, Wei G, Yamazaki H, Miura T, Johnson AC, Kuzumaki N", "reference": { "type": "PubMed", "id": "10500253", "url": "https://pubmed.ncbi.nlm.nih.gov/10500253" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16383-1", "protein_name": "Intron Large complex component GCFC2", "gene_name": "GCFC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16383", "url": "https://www.uniprot.org/uniprotkb/P16383" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10500253", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A locus on 2p12 containing the co-regulated MRPL19 and C2ORF3 genes is associated to dyslexia.", "journal": "Hum. Mol. Genet.", "date": "2007", "authors": "Anthoni Heidi, Zucchelli Marco, Matsson Hans, M\u00fcller-Myhsok Bertram, Fransson Ingegerd, Schumacher Johannes, Massinen Satu, Onkamo P\u00e4ivi, Warnke Andreas, Griesemann Heide, Hoffmann Per, Nopola-Hemmi Jaana, Lyytinen Heikki, Schulte-K\u00f6rne Gerd, Kere Juha, N\u00f6then Markus M, Peyrard-Janvid Myriam", "reference": { "type": "PubMed", "id": "17309879", "url": "https://pubmed.ncbi.nlm.nih.gov/17309879" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16383-1", "protein_name": "Intron Large complex component GCFC2", "gene_name": "GCFC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16383", "url": "https://www.uniprot.org/uniprotkb/P16383" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17309879", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of dyslexia candidate genes in the Raine cohort representing the general Australian population.", "journal": "Genes, brain, and behavior", "date": "2011", "authors": "Paracchini S, Ang QW, Stanley FJ, Monaco AP, Pennell CE, Whitehouse AJ", "reference": { "type": "PubMed", "id": "20846247", "url": "https://pubmed.ncbi.nlm.nih.gov/20846247" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16383-1", "protein_name": "Intron Large complex component GCFC2", "gene_name": "GCFC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16383", "url": "https://www.uniprot.org/uniprotkb/P16383" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20846247", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of a human DNA binding factor that represses transcription.", "journal": "Cell", "date": "1989", "authors": "Kageyama R, Pastan I", "reference": { "type": "PubMed", "id": "2556218", "url": "https://pubmed.ncbi.nlm.nih.gov/2556218" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16383-1", "protein_name": "Intron Large complex component GCFC2", "gene_name": "GCFC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16383", "url": "https://www.uniprot.org/uniprotkb/P16383" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2556218", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional regulation of IER5 in response to radiation in HepG2.", "journal": "Cancer gene therapy", "date": "2016", "authors": "Yang C, Yin L, Zhou P, Liu X, Yang M, Yang F, Jiang H, Ding K", "reference": { "type": "PubMed", "id": "26915404", "url": "https://pubmed.ncbi.nlm.nih.gov/26915404" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16383-1", "protein_name": "Intron Large complex component GCFC2", "gene_name": "GCFC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16383", "url": "https://www.uniprot.org/uniprotkb/P16383" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26915404", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homeodomain proteins MEIS1 and PBXs regulate the lineage-specific transcription of the platelet factor 4 gene.", "journal": "Blood", "date": "2003-06-15", "authors": "Okada Yoshiaki, Nagai Ryohei, Sato Takahiro, Matsuura Eri, Minami Takashi, Morita Ikuo, Doi Takefumi", "reference": { "type": "PubMed", "id": "12609849", "url": "https://pubmed.ncbi.nlm.nih.gov/12609849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00470-1", "protein_name": "Homeobox protein Meis1", "gene_name": "MEIS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40425-1", "protein_name": "Pre-B-cell leukemia transcription factor 2", "gene_name": "PBX2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40424-1", "protein_name": "Pre-B-cell leukemia transcription factor 1", "gene_name": "PBX1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00470", "url": "https://www.uniprot.org/uniprotkb/O00470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12609849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MEIS1 p.R272H in familial restless legs syndrome.", "journal": "Neurology", "date": "2009", "authors": "Vilarino-Guell C, Chai H, Keeling BH, Young JE, Rajput A, Lynch T, Aasly JO, Uitti RJ, Wszolek ZK, Farrer MJ, Lin SC", "reference": { "type": "PubMed", "id": "19620614", "url": "https://pubmed.ncbi.nlm.nih.gov/19620614" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00470-1", "protein_name": "Homeobox protein Meis1", "gene_name": "MEIS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00470", "url": "https://www.uniprot.org/uniprotkb/O00470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19620614", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA-dependent formation of transcription factor pairs alters their binding specificity.", "journal": "Nature", "date": "2015", "authors": "Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J", "reference": { "type": "PubMed", "id": "26550823", "url": "https://pubmed.ncbi.nlm.nih.gov/26550823" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00470-1", "protein_name": "Homeobox protein Meis1", "gene_name": "MEIS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60479-1", "protein_name": "Homeobox protein DLX-3", "gene_name": "DLX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14770-1", "protein_name": "Homeobox protein Meis2", "gene_name": "MEIS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00470", "url": "https://www.uniprot.org/uniprotkb/O00470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26550823", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Small-Molecule Wnt Inhibitor ICG-001 Efficiently Inhibits Colorectal Cancer Stemness and Metastasis by Suppressing MEIS1 Expression.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Choi JH, Jang TY, Jeon SE, Kim JH, Lee CJ, Yun HJ, Jung JY, Park SY, Nam JS", "reference": { "type": "PubMed", "id": "34948208", "url": "https://pubmed.ncbi.nlm.nih.gov/34948208" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00470-1", "protein_name": "Homeobox protein Meis1", "gene_name": "MEIS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00470", "url": "https://www.uniprot.org/uniprotkb/O00470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34948208", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Downregulation of MEIS1 mediated by ELFN1-AS1/EZH2/DNMT3a axis promotes tumorigenesis and oxaliplatin resistance in colorectal cancer.", "journal": "Signal transduction and targeted therapy", "date": "2022", "authors": "Li Y, Gan Y, Liu J, Li J, Zhou Z, Tian R, Sun R, Liu J, Xiao Q, Li Y, Lu P, Peng Y, Peng Y, Shu G, Yin G", "reference": { "type": "PubMed", "id": "35351858", "url": "https://pubmed.ncbi.nlm.nih.gov/35351858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00470-1", "protein_name": "Homeobox protein Meis1", "gene_name": "MEIS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00470", "url": "https://www.uniprot.org/uniprotkb/O00470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35351858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Elucidating the importance and regulation of key enhancers for human MEIS1 expression.", "journal": "Leukemia", "date": "2022", "authors": "Xiang P, Yang X, Escano L, Dhillon I, Schneider E, Clemans-Gibbon J, Wei W, Wong J, Wang SX, Tam D, Deng Y, Yung E, Morin GB, Hoodless PA, Hirst M, Karsan A, Kuchenbauer F, Humphries RK, Rouhi A", "reference": { "type": "PubMed", "id": "35624144", "url": "https://pubmed.ncbi.nlm.nih.gov/35624144" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00470-1", "protein_name": "Homeobox protein Meis1", "gene_name": "MEIS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00470", "url": "https://www.uniprot.org/uniprotkb/O00470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35624144", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "3D Chromatin Organization Involving MEIS1 Factor in the cis-Regulatory Landscape of GJB2.", "journal": "International journal of molecular sciences", "date": "2022", "authors": "Le Nabec A, Blotas C, Briset A, Collobert M, Ferec C, Moisan S", "reference": { "type": "PubMed", "id": "35805969", "url": "https://pubmed.ncbi.nlm.nih.gov/35805969" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00470-1", "protein_name": "Homeobox protein Meis1", "gene_name": "MEIS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00470", "url": "https://www.uniprot.org/uniprotkb/O00470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35805969", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and mapping of the MEIS1 gene, the human homolog of a murine leukemogenic gene.", "journal": "Genomics", "date": "1997", "authors": "Smith JE Jr, Bollekens JA, Inghirami G, Takeshita K", "reference": { "type": "PubMed", "id": "9226379", "url": "https://pubmed.ncbi.nlm.nih.gov/9226379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O00470-1", "protein_name": "Homeobox protein Meis1", "gene_name": "MEIS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O00470", "url": "https://www.uniprot.org/uniprotkb/O00470" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9226379", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PPPYVEPTAP motif is the late domain of human T-cell leukemia virus type 1 Gag and mediates its functional interaction with cellular proteins Nedd4 and Tsg101.", "journal": "J. Virol.", "date": "2003", "authors": "Bouamr Fadila, Melillo Jessica A, Wang Margaret Q, Nagashima Kunio, de Los Santos Martha, Rein Alan, Goff Stephen P", "reference": { "type": "PubMed", "id": "14581525", "url": "https://pubmed.ncbi.nlm.nih.gov/14581525" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99816-1", "protein_name": "Tumor susceptibility gene 101 protein", "gene_name": "TSG101", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14581525", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The E3 ligase Aip4/Itch ubiquitinates and targets ErbB-4 for degradation.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2007", "authors": "Omerovic J, Santangelo L, Puggioni EM, Marrocco J, Dall'Armi C, Palumbo C, Belleudi F, Di Marcotullio L, Frati L, Torrisi MR, Cesareni G, Gulino A, Alimandi M", "reference": { "type": "PubMed", "id": "17463226", "url": "https://pubmed.ncbi.nlm.nih.gov/17463226" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17463226", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Herpes simplex virus type 2 UL56 interacts with the ubiquitin ligase Nedd4 and increases its ubiquitination.", "journal": "J. Virol.", "date": "2008", "authors": "Ushijima Yoko, Koshizuka Tetsuo, Goshima Fumi, Kimura Hiroshi, Nishiyama Yukihiro", "reference": { "type": "PubMed", "id": "18353951", "url": "https://pubmed.ncbi.nlm.nih.gov/18353951" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18353951", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ubiquitin ligase Nedd4-1 is dispensable for the regulation of PTEN stability and localization.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008-06-24", "authors": "Fouladkou Fatemeh, Landry Tamara, Kawabe Hiroshi, Neeb Antje, Lu Chen, Brose Nils, Stambolic Vuk, Rotin Daniela", "reference": { "type": "PubMed", "id": "18562292", "url": "https://pubmed.ncbi.nlm.nih.gov/18562292" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18562292", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nedd4 family-interacting protein 1 (Ndfip1) is required for the exosomal secretion of Nedd4 family proteins.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Putz U, Howitt J, Lackovic J, Foot N, Kumar S, Silke J, Tan SS", "reference": { "type": "PubMed", "id": "18819914", "url": "https://pubmed.ncbi.nlm.nih.gov/18819914" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8R0W6-1", "protein_name": "NEDD4 family-interacting protein 1", "gene_name": "Ndfip1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT67-1", "protein_name": "NEDD4 family-interacting protein 1", "gene_name": "NDFIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18819914", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nedd4 mediates ErbB4 JM-a/CYT-1 ICD ubiquitination and degradation in MDCK II cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2009", "authors": "Zeng F, Xu J, Harris RC", "reference": { "type": "PubMed", "id": "19193720", "url": "https://pubmed.ncbi.nlm.nih.gov/19193720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0M0-1", "protein_name": "NEDD4-like E3 ubiquitin-protein ligase WWP1", "gene_name": "WWP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46935-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "Nedd4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15303-1", "protein_name": "Receptor tyrosine-protein kinase erbB-4", "gene_name": "ERBB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12931-1", "protein_name": "Proto-oncogene tyrosine-protein kinase Src", "gene_name": "SRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19193720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HECT E3 ubiquitin ligase Nedd4-1 ubiquitinates ACK and regulates epidermal growth factor (EGF)-induced degradation of EGF receptor and ACK.", "journal": "Mol. Cell. Biol.", "date": "2010", "authors": "Lin Q, Wang J, Childress C, Sudol M, Carey DJ, Yang W", "reference": { "type": "PubMed", "id": "20086093", "url": "https://pubmed.ncbi.nlm.nih.gov/20086093" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O54967-1", "protein_name": "Activated CDC42 kinase 1", "gene_name": "Tnk2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20086093", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of Rap2A by the ubiquitin ligase Nedd4-1 controls neurite development.", "journal": "Neuron", "date": "2010", "authors": "Kawabe H, Neeb A, Dimova K, Young SM Jr, Takeda M, Katsurabayashi S, Mitkovski M, Malakhova OA, Zhang DE, Umikawa M, Kariya K, Goebbels S, Nave KA, Rosenmund C, Jahn O, Rhee J, Brose N", "reference": { "type": "PubMed", "id": "20159449", "url": "https://pubmed.ncbi.nlm.nih.gov/20159449" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62940-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "Nedd4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q80ZJ1-1", "protein_name": "Ras-related protein Rap-2a", "gene_name": "Rap2a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P83510-1", "protein_name": "Traf2 and NCK-interacting protein kinase", "gene_name": "Tnik", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P10114-1", "protein_name": "Ras-related protein Rap-2a", "gene_name": "RAP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKE5-1", "protein_name": "TRAF2 and NCK-interacting protein kinase", "gene_name": "TNIK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46935-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "Nedd4", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 148, "end_pos": 148, "sequence_org": "K", "sequence_mut": "R", "comment": "Reduced NEDD4-dependent ubiquitination; when associated with R-5; R-94 and R-150. Increased binding to RAB40C; when associated with R-117 and R-150. Increased localization within endolysosomes; when associated with R-117 and R-150. Decreased cell invasion; when associated with R-117 and R-150.", "evidence": [ { "database": "UniProtKB", "id": "P10114", "url": "https://www.uniprot.org/uniprotkb/P10114" }, { "database": "PubMed", "id": "20159449", "url": "https://pubmed.ncbi.nlm.nih.gov/20159449" }, { "database": "PubMed", "id": "35293963", "url": "https://pubmed.ncbi.nlm.nih.gov/35293963" } ], "uniprot_canonical_ac": "P10114-1" }, { "start_pos": 150, "end_pos": 150, "sequence_org": "K", "sequence_mut": "R", "comment": "Reduced NEDD4-dependent ubiquitination; when associated with R-5; R-94 and R-148. Increased binding to RAB40C; when associated with R-117 and R-148. Increased localization within endolysosomes; when associated with R-117 and R-148. Decreased cell invasion; when associated with R-117 and R-148.", "evidence": [ { "database": "UniProtKB", "id": "P10114", "url": "https://www.uniprot.org/uniprotkb/P10114" }, { "database": "PubMed", "id": "20159449", "url": "https://pubmed.ncbi.nlm.nih.gov/20159449" }, { "database": "PubMed", "id": "35293963", "url": "https://pubmed.ncbi.nlm.nih.gov/35293963" } ], "uniprot_canonical_ac": "P10114-1" }, { "start_pos": 39, "end_pos": 39, "sequence_org": "F", "sequence_mut": "S", "comment": "Loss of RASGEF1A- and RASGEF1B-mediated GDP to GTP exchange. Complete loss of interaction with MAP4K4, MINK1 and TNIK, and loss of ubiquitination by NEDD4.", "evidence": [ { "database": "UniProtKB", "id": "P10114", "url": "https://www.uniprot.org/uniprotkb/P10114" }, { "database": "PubMed", "id": "20159449", "url": "https://pubmed.ncbi.nlm.nih.gov/20159449" }, { "database": "PubMed", "id": "19645719", "url": "https://pubmed.ncbi.nlm.nih.gov/19645719" }, { "database": "PubMed", "id": "15342639", "url": "https://pubmed.ncbi.nlm.nih.gov/15342639" } ], "uniprot_canonical_ac": "P10114-1" }, { "start_pos": 5, "end_pos": 5, "sequence_org": "K", "sequence_mut": "R", "comment": "Reduced NEDD4-dependent ubiquitination; when associated with R-94; R-148 and R-150.", "evidence": [ { "database": "UniProtKB", "id": "P10114", "url": "https://www.uniprot.org/uniprotkb/P10114" }, { "database": "PubMed", "id": "20159449", "url": "https://pubmed.ncbi.nlm.nih.gov/20159449" } ], "uniprot_canonical_ac": "P10114-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "K", "sequence_mut": "R", "comment": "Reduced NEDD4-dependent ubiquitination; when associated with R-5; R-148 and R-150.", "evidence": [ { "database": "UniProtKB", "id": "P10114", "url": "https://www.uniprot.org/uniprotkb/P10114" }, { "database": "PubMed", "id": "20159449", "url": "https://pubmed.ncbi.nlm.nih.gov/20159449" } ], "uniprot_canonical_ac": "P10114-1" } ], "record_id": "pubmed.20159449", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arrestin domain-containing protein 3 recruits the NEDD4 E3 ligase to mediate ubiquitination of the beta2-adrenergic receptor.", "journal": "EMBO Rep.", "date": "2010", "authors": "Nabhan JF, Pan H, Lu Q", "reference": { "type": "PubMed", "id": "20559325", "url": "https://pubmed.ncbi.nlm.nih.gov/20559325" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07550-1", "protein_name": "Beta-2 adrenergic receptor", "gene_name": "ADRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B67-1", "protein_name": "Arrestin domain-containing protein 3", "gene_name": "ARRDC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 346, "end_pos": 349, "sequence_org": "PPSY", "sequence_mut": "AASA", "comment": "Strongly reduces interaction with NEDD4. Abolishes interaction with NEDD4; when associated with 391-A--A-394. Abolishes interaction with HGS; when associated with 391-A--A-394.", "evidence": [ { "database": "UniProtKB", "id": "Q96B67", "url": "https://www.uniprot.org/uniprotkb/Q96B67" }, { "database": "PubMed", "id": "23208550", "url": "https://pubmed.ncbi.nlm.nih.gov/23208550" }, { "database": "PubMed", "id": "20559325", "url": "https://pubmed.ncbi.nlm.nih.gov/20559325" } ], "uniprot_canonical_ac": "Q96B67-1" }, { "start_pos": 391, "end_pos": 394, "sequence_org": "PPLY", "sequence_mut": "AALA", "comment": "Abolishes interaction with NEDD4; when associated with 346-A--A-349.", "evidence": [ { "database": "UniProtKB", "id": "Q96B67", "url": "https://www.uniprot.org/uniprotkb/Q96B67" }, { "database": "PubMed", "id": "20559325", "url": "https://pubmed.ncbi.nlm.nih.gov/20559325" } ], "uniprot_canonical_ac": "Q96B67-1" } ], "record_id": "pubmed.20559325", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the HECT:ubiquitin complex and its role in ubiquitin chain elongation.", "journal": "EMBO reports", "date": "2011-04", "authors": "Maspero Elena, Mari Sara, Valentini Eleonora, Musacchio Andrea, Fish Alexander, Pasqualato Sebastiano, Polo Simona", "reference": { "type": "PubMed", "id": "21399620", "url": "https://pubmed.ncbi.nlm.nih.gov/21399620" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21399620", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nedd4-1 binds and ubiquitylates activated FGFR1 to control its endocytosis and function.", "journal": "The EMBO journal", "date": "2011", "authors": "Persaud A, Alberts P, Hayes M, Guettler S, Clarke I, Sicheri F, Dirks P, Ciruna B, Rotin D", "reference": { "type": "PubMed", "id": "21765395", "url": "https://pubmed.ncbi.nlm.nih.gov/21765395" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WU20-1", "protein_name": "Fibroblast growth factor receptor substrate 2", "gene_name": "FRS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11362-1", "protein_name": "Fibroblast growth factor receptor 1", "gene_name": "FGFR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19174-1", "protein_name": "1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1", "gene_name": "PLCG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21765395", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deubiquitination of EGFR by Cezanne-1 contributes to cancer progression.", "journal": "Oncogene", "date": "2012", "authors": "Pareja F, Ferraro DA, Rubin C, Cohen-Dvashi H, Zhang F, Aulmann S, Ben-Chetrit N, Pines G, Navon R, Crosetto N, Kostler W, Carvalho S, Lavi S, Schmitt F, Dikic I, Yakhini Z, Sinn P, Mills GB, Yarden Y", "reference": { "type": "PubMed", "id": "22179831", "url": "https://pubmed.ncbi.nlm.nih.gov/22179831" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6GQQ9-1", "protein_name": "OTU domain-containing protein 7B", "gene_name": "OTUD7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00533-1", "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 194, "end_pos": 194, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of deubiquitinating activity. Increased ability to interact with polyubiquitin.", "evidence": [ { "database": "UniProtKB", "id": "Q6GQQ9", "url": "https://www.uniprot.org/uniprotkb/Q6GQQ9" }, { "database": "PubMed", "id": "22179831", "url": "https://pubmed.ncbi.nlm.nih.gov/22179831" }, { "database": "PubMed", "id": "27732584", "url": "https://pubmed.ncbi.nlm.nih.gov/27732584" }, { "database": "PubMed", "id": "14748687", "url": "https://pubmed.ncbi.nlm.nih.gov/14748687" }, { "database": "PubMed", "id": "12682062", "url": "https://pubmed.ncbi.nlm.nih.gov/12682062" } ], "uniprot_canonical_ac": "Q6GQQ9-1" }, { "start_pos": 194, "end_pos": 194, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of deubiquitinating activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6GQQ9", "url": "https://www.uniprot.org/uniprotkb/Q6GQQ9" }, { "database": "PubMed", "id": "22179831", "url": "https://pubmed.ncbi.nlm.nih.gov/22179831" }, { "database": "PubMed", "id": "14748687", "url": "https://pubmed.ncbi.nlm.nih.gov/14748687" }, { "database": "PubMed", "id": "12682062", "url": "https://pubmed.ncbi.nlm.nih.gov/12682062" } ], "uniprot_canonical_ac": "Q6GQQ9-1" }, { "start_pos": 809, "end_pos": 809, "sequence_org": "F", "sequence_mut": "A", "comment": "Does not affect interaction with EGFR.", "evidence": [ { "database": "UniProtKB", "id": "Q6GQQ9", "url": "https://www.uniprot.org/uniprotkb/Q6GQQ9" }, { "database": "PubMed", "id": "22179831", "url": "https://pubmed.ncbi.nlm.nih.gov/22179831" } ], "uniprot_canonical_ac": "Q6GQQ9-1" }, { "start_pos": 810, "end_pos": 810, "sequence_org": "Y", "sequence_mut": "A", "comment": "Impairs interaction with EGFR.", "evidence": [ { "database": "UniProtKB", "id": "Q6GQQ9", "url": "https://www.uniprot.org/uniprotkb/Q6GQQ9" }, { "database": "PubMed", "id": "22179831", "url": "https://pubmed.ncbi.nlm.nih.gov/22179831" } ], "uniprot_canonical_ac": "Q6GQQ9-1" } ], "record_id": "pubmed.22179831", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MARCH2 promotes endocytosis and lysosomal sorting of carvedilol-bound beta(2)-adrenergic receptors.", "journal": "J. Cell Biol.", "date": "2012", "authors": "Han SO, Xiao K, Kim J, Wu JH, Wisler JW, Nakamura N, Freedman NJ, Shenoy SK", "reference": { "type": "PubMed", "id": "23166351", "url": "https://pubmed.ncbi.nlm.nih.gov/23166351" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10608-1", "protein_name": "Beta-2 adrenergic receptor", "gene_name": "Adrb2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Y2K6-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 20", "gene_name": "USP20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07550-1", "protein_name": "Beta-2 adrenergic receptor", "gene_name": "ADRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TEY7-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 33", "gene_name": "USP33", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0N8-1", "protein_name": "E3 ubiquitin-protein ligase MARCHF2", "gene_name": "MARCHF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23166351", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of a ubiquitin-loaded HECT ligase reveals the molecular basis for catalytic priming.", "journal": "Nature structural & molecular biology", "date": "2013-06", "authors": "Maspero Elena, Valentini Eleonora, Mari Sara, Cecatiello Valentina, Soffientini Paolo, Pasqualato Sebastiano, Polo Simona", "reference": { "type": "PubMed", "id": "23644597", "url": "https://pubmed.ncbi.nlm.nih.gov/23644597" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23644597", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cellular localization and characterization of cytosolic binding partners for Gla domain-containing proteins PRRG4 and PRRG2.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Yazicioglu MN, Monaldini L, Chu K, Khazi FR, Murphy SL, Huang H, Margaritis P, High KA", "reference": { "type": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96QZ7-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1", "gene_name": "MAGI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TCQ9-4", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3", "gene_name": "MAGI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZD6-1", "protein_name": "Transmembrane gamma-carboxyglutamic acid protein 4", "gene_name": "PRRG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14669-1", "protein_name": "Transmembrane gamma-carboxyglutamic acid protein 2", "gene_name": "PRRG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46937-1", "protein_name": "Transcriptional coactivator YAP1", "gene_name": "YAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV5-1", "protein_name": "WW domain-containing transcription regulator protein 1", "gene_name": "WWTR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 189, "end_pos": 189, "sequence_org": "Y", "sequence_mut": "A", "comment": "Reduced binding to MAGI1, MAGI3, NEDD4, NEDD4L, WWTR1 and YAP1.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZD6", "url": "https://www.uniprot.org/uniprotkb/Q9BZD6" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" } ], "uniprot_canonical_ac": "Q9BZD6-1" }, { "start_pos": 207, "end_pos": 207, "sequence_org": "Y", "sequence_mut": "A", "comment": "Reduced binding to MAGI1. No effect on binding to MAGI3, NEDD4, NEDD4L, WWTR1 or YAP1.", "evidence": [ { "database": "UniProtKB", "id": "Q9BZD6", "url": "https://www.uniprot.org/uniprotkb/Q9BZD6" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" } ], "uniprot_canonical_ac": "Q9BZD6-1" }, { "start_pos": 199, "end_pos": 199, "sequence_org": "W", "sequence_mut": "A", "comment": "Loss of interaction with ERBB4, loss of transcriptional coactivation function toward CTF and reduced interaction with PRRG4; when associated with A-202.", "evidence": [ { "database": "UniProtKB", "id": "P46937", "url": "https://www.uniprot.org/uniprotkb/P46937" }, { "database": "PubMed", "id": "12807903", "url": "https://pubmed.ncbi.nlm.nih.gov/12807903" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" } ], "uniprot_canonical_ac": "P46937-1" }, { "start_pos": 202, "end_pos": 202, "sequence_org": "P", "sequence_mut": "A", "comment": "Loss of interaction with ERBB4, loss of transcriptional coactivation function toward CTF and reduced interaction with PRRG4; when associated with A-199.", "evidence": [ { "database": "UniProtKB", "id": "P46937", "url": "https://www.uniprot.org/uniprotkb/P46937" }, { "database": "PubMed", "id": "12807903", "url": "https://pubmed.ncbi.nlm.nih.gov/12807903" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" } ], "uniprot_canonical_ac": "P46937-1" }, { "start_pos": 217, "end_pos": 217, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on interaction with PRRG4.", "evidence": [ { "database": "UniProtKB", "id": "P46937", "url": "https://www.uniprot.org/uniprotkb/P46937" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" } ], "uniprot_canonical_ac": "P46937-1" }, { "start_pos": 258, "end_pos": 258, "sequence_org": "W", "sequence_mut": "A", "comment": "Reduced interaction with PRRG4; when associated with A-261.", "evidence": [ { "database": "UniProtKB", "id": "P46937", "url": "https://www.uniprot.org/uniprotkb/P46937" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" } ], "uniprot_canonical_ac": "P46937-1" }, { "start_pos": 261, "end_pos": 261, "sequence_org": "P", "sequence_mut": "A", "comment": "Reduced interaction with PRRG4; when associated with A-258.", "evidence": [ { "database": "UniProtKB", "id": "P46937", "url": "https://www.uniprot.org/uniprotkb/P46937" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" } ], "uniprot_canonical_ac": "P46937-1" }, { "start_pos": 111, "end_pos": 158, "sequence_org": "AHLRQQSYDVTDELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKA", "sequence_mut": "", "comment": "Reduced binding to PRRG4.", "evidence": [ { "database": "UniProtKB", "id": "Q9GZV5", "url": "https://www.uniprot.org/uniprotkb/Q9GZV5" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" } ], "uniprot_canonical_ac": "Q9GZV5-1" }, { "start_pos": 394, "end_pos": 400, "sequence_org": "EPFLTWL", "sequence_mut": "", "comment": "No effect on binding to PRRG4.", "evidence": [ { "database": "UniProtKB", "id": "Q9GZV5", "url": "https://www.uniprot.org/uniprotkb/Q9GZV5" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" } ], "uniprot_canonical_ac": "Q9GZV5-1" }, { "start_pos": 89, "end_pos": 89, "sequence_org": "S", "sequence_mut": "A", "comment": "Significant resistance to inhibition by STK3/MST2 and LATS2. No effect on binding to PRRG4.", "evidence": [ { "database": "UniProtKB", "id": "Q9GZV5", "url": "https://www.uniprot.org/uniprotkb/Q9GZV5" }, { "database": "PubMed", "id": "23873930", "url": "https://pubmed.ncbi.nlm.nih.gov/23873930" }, { "database": "PubMed", "id": "18227151", "url": "https://pubmed.ncbi.nlm.nih.gov/18227151" } ], "uniprot_canonical_ac": "Q9GZV5-1" } ], "record_id": "pubmed.23873930", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural and biochemical basis for ubiquitin ligase recruitment by arrestin-related domain-containing protein-3 (ARRDC3).", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Qi S, O'Hayre M, Gutkind JS, Hurley JH", "reference": { "type": "PubMed", "id": "24379409", "url": "https://pubmed.ncbi.nlm.nih.gov/24379409" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B67-1", "protein_name": "Arrestin domain-containing protein 3", "gene_name": "ARRDC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 795, "end_pos": 795, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes interaction with ARRDC3; when associated with A-868 and A-920.", "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" }, { "database": "PubMed", "id": "24379409", "url": "https://pubmed.ncbi.nlm.nih.gov/24379409" } ], "uniprot_canonical_ac": "P46934-1" }, { "start_pos": 868, "end_pos": 868, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes interaction with ARRDC3; when associated with A-795 and A-920.", "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" }, { "database": "PubMed", "id": "24379409", "url": "https://pubmed.ncbi.nlm.nih.gov/24379409" } ], "uniprot_canonical_ac": "P46934-1" }, { "start_pos": 920, "end_pos": 920, "sequence_org": "W", "sequence_mut": "A", "comment": "Abolishes interaction with ARRDC3; when associated with A-795 and A-868.", "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" }, { "database": "PubMed", "id": "24379409", "url": "https://pubmed.ncbi.nlm.nih.gov/24379409" } ], "uniprot_canonical_ac": "P46934-1" } ], "record_id": "pubmed.24379409", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nedd4 family interacting protein 1 (Ndfip1) is required for ubiquitination and nuclear trafficking of BRCA1-associated ATM activator 1 (BRAT1) during the DNA damage response.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Low LH, Chow YL, Li Y, Goh CP, Putz U, Silke J, Ouchi T, Howitt J, Tan SS", "reference": { "type": "PubMed", "id": "25631046", "url": "https://pubmed.ncbi.nlm.nih.gov/25631046" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PJG6-1", "protein_name": "Integrator complex assembly factor BRAT1", "gene_name": "BRAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J02-1", "protein_name": "E3 ubiquitin-protein ligase Itchy homolog", "gene_name": "ITCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8C3R1-1", "protein_name": "Integrator complex assembly factor BRAT1", "gene_name": "Brat1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8R0W6-1", "protein_name": "NEDD4 family-interacting protein 1", "gene_name": "Ndfip1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT67-1", "protein_name": "NEDD4 family-interacting protein 1", "gene_name": "NDFIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25631046", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Auto-ubiquitination of NEDD4-1 Recruits USP13 to Facilitate Autophagy through Deubiquitinating VPS34.", "journal": "Cell reports", "date": "2020-02-25", "authors": "Xie Weihong, Jin Shouheng, Wu Yaoxing, Xian Huifang, Tian Shuo, Liu Di-Ao, Guo Zhiyong, Cui Jun", "reference": { "type": "PubMed", "id": "32101753", "url": "https://pubmed.ncbi.nlm.nih.gov/32101753" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92995-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 13", "gene_name": "USP13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32101753", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DMT1 ubiquitination by Nedd4 protects against ferroptosis after intracerebral hemorrhage.", "journal": "CNS neuroscience & therapeutics", "date": "2024-04", "authors": "Lv Bingchen, Fu Ping, Wang Miao, Cui Likun, Bao Lei, Wang Xingzhi, Yu Lu, Zhou Chao, Zhu Mengxin, Wang Fei, Pang Ye, Qi Suhua, Zhang Zuohui, Cui Guiyun", "reference": { "type": "PubMed", "id": "38634270", "url": "https://pubmed.ncbi.nlm.nih.gov/38634270" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49282-1", "protein_name": "Natural resistance-associated macrophage protein 2", "gene_name": "Slc11a2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38634270", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ECHDC2 inhibits the proliferation of gastric cancer cells by binding with NEDD4 to degrade MCCC2 and reduce aerobic glycolysis.", "journal": "Molecular medicine (Cambridge, Mass.)", "date": "2024-05-23", "authors": "He Jiancheng, Yi Jianfeng, Ji Li, Dai Lingchen, Chen Yu, Xue Wanjiang", "reference": { "type": "PubMed", "id": "38783226", "url": "https://pubmed.ncbi.nlm.nih.gov/38783226" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCC0-1", "protein_name": "Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial", "gene_name": "MCCC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YB7-1", "protein_name": "Enoyl-CoA hydratase domain-containing protein 2, mitochondrial", "gene_name": "ECHDC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38783226", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Role of Ubiquitination and the E3 Ligase Nedd4 in Regulating Corneal Epithelial Wound Healing.", "journal": "Investigative ophthalmology & visual science", "date": "2024-06-03", "authors": "Ling Xuemei, Xu Weiwei, Tang Jingjing, Cao Qiongjie, Luo Guangying, Chen Xiaoyan, Yang Shuai, Reinach Peter Sol, Yan Dongsheng", "reference": { "type": "PubMed", "id": "38888282", "url": "https://pubmed.ncbi.nlm.nih.gov/38888282" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46934-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "NEDD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46935-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4", "gene_name": "Nedd4", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P46934", "url": "https://www.uniprot.org/uniprotkb/P46934" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38888282", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[The influence of calcineurin gene polymorphism on morphofunctional characteristics of cardiovascular system of athletes].", "journal": "Rossiiskii fiziologicheskii zhurnal imeni I.M. Sechenova", "date": "2008", "authors": "Akhmetov II, Linde EV, Shikhova IuV, Popov DV, Missina SS, Vinogradoba OL, Rogozkin VA", "reference": { "type": "PubMed", "id": "18825932", "url": "https://pubmed.ncbi.nlm.nih.gov/18825932" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NA66-1", "protein_name": "Cyclic nucleotide-binding domain-containing protein 1", "gene_name": "CNBD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NA66", "url": "https://www.uniprot.org/uniprotkb/Q8NA66" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18825932", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Personalized cancer vaccine effectively mobilizes antitumor T cell immunity in ovarian cancer.", "journal": "Science translational medicine", "date": "2018-04-11", "authors": "Tanyi Janos L, Bobisse Sara, Ophir Eran, Tuyaerts Sandra, Roberti Annalisa, Genolet Raphael, Baumgartner Petra, Stevenson Brian J, Iseli Christian, Dangaj Denarda, Czerniecki Brian, Semilietof Aikaterini, Racle Julien, Michel Alexandra, Xenarios Ioannis, Chiang Cheryl, Monos Dimitri S, Torigian Drew A, Nisenbaum Harvey L, Michielin Olivier, June Carl H, Levine Bruce L, Powell Daniel J, Gfeller David, Mick Rosemarie, Dafni Urania, Zoete Vincent, Harari Alexandre, Coukos George, Kandalaft Lana E", "reference": { "type": "PubMed", "id": "29643231", "url": "https://pubmed.ncbi.nlm.nih.gov/29643231" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BQW3-2", "protein_name": "Transcription factor COE4", "gene_name": "EBF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93086-6", "protein_name": "P2X purinoceptor 5", "gene_name": "P2RX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14839-1", "protein_name": "ATP-dependent chromatin remodeler CHD4", "gene_name": "CHD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TAX3-1", "protein_name": "Terminal uridylyltransferase 4", "gene_name": "TUT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDV7-1", "protein_name": "Trinucleotide repeat-containing gene 6A protein", "gene_name": "TNRC6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVR5-1", "protein_name": "Protein kintoun", "gene_name": "DNAAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS98-1", "protein_name": "Semaphorin-3G", "gene_name": "SEMA3G", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BQW3", "url": "https://www.uniprot.org/uniprotkb/Q9BQW3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29643231", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Flt3 ligand structure and unexpected commonalities of helical bundles and cystine knots.", "journal": "Nat. Struct. Biol.", "date": "2000", "authors": "Savvides S N, Boone T, Andrew Karplus P", "reference": { "type": "PubMed", "id": "10881197", "url": "https://pubmed.ncbi.nlm.nih.gov/10881197" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10881197", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insulin and insulinomimetic agents induce activation of phosphatidylinositol 3'-kinase upon its association with pp185 (IRS-1) in intact rat livers.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Hadari YR, Tzahar E, Nadiv O, Rothenberg P, Roberts CT Jr, LeRoith D, Yarden Y, Zick Y", "reference": { "type": "PubMed", "id": "1381348", "url": "https://pubmed.ncbi.nlm.nih.gov/1381348" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15520-1", "protein_name": "Fibroblast growth factor 10", "gene_name": "FGF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WU20-1", "protein_name": "Fibroblast growth factor receptor substrate 2", "gene_name": "FRS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09038-4", "protein_name": "Fibroblast growth factor 2", "gene_name": "FGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10767-1", "protein_name": "Fibroblast growth factor 6", "gene_name": "FGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43320-1", "protein_name": "Fibroblast growth factor 16", "gene_name": "FGF16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95750-1", "protein_name": "Fibroblast growth factor 19", "gene_name": "FGF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08620-1", "protein_name": "Fibroblast growth factor 4", "gene_name": "FGF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11487-1", "protein_name": "Fibroblast growth factor 3", "gene_name": "FGF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21781-1", "protein_name": "Fibroblast growth factor 7", "gene_name": "FGF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31371-1", "protein_name": "Fibroblast growth factor 9", "gene_name": "FGF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4H2-1", "protein_name": "Insulin receptor substrate 2", "gene_name": "IRS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36888-1", "protein_name": "Receptor-type tyrosine-protein kinase FLT3", "gene_name": "FLT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05230-1", "protein_name": "Fibroblast growth factor 1", "gene_name": "FGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCT0-1", "protein_name": "Fibroblast growth factor 22", "gene_name": "FGF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76093-1", "protein_name": "Fibroblast growth factor 18", "gene_name": "FGF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35568-1", "protein_name": "Insulin receptor substrate 1", "gene_name": "IRS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13480-1", "protein_name": "GRB2-associated-binding protein 1", "gene_name": "GAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR96-1", "protein_name": "Toll-like receptor 9", "gene_name": "TLR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22455-1", "protein_name": "Fibroblast growth factor receptor 4", "gene_name": "FGFR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP95-1", "protein_name": "Fibroblast growth factor 20", "gene_name": "FGF20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Z14-1", "protein_name": "Beta-klotho", "gene_name": "KLB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC2-1", "protein_name": "GRB2-associated-binding protein 2", "gene_name": "GAB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1381348", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The evolution of phosphatidylinositol 3-kinases as regulators of growth and metabolism.", "journal": "Nature reviews. Genetics", "date": "2006", "authors": "Engelman JA, Luo J, Cantley LC", "reference": { "type": "PubMed", "id": "16847462", "url": "https://pubmed.ncbi.nlm.nih.gov/16847462" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15520-1", "protein_name": "Fibroblast growth factor 10", "gene_name": "FGF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WU20-1", "protein_name": "Fibroblast growth factor receptor substrate 2", "gene_name": "FRS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09038-4", "protein_name": "Fibroblast growth factor 2", "gene_name": "FGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10767-1", "protein_name": "Fibroblast growth factor 6", "gene_name": "FGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43320-1", "protein_name": "Fibroblast growth factor 16", "gene_name": "FGF16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95750-1", "protein_name": "Fibroblast growth factor 19", "gene_name": "FGF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08620-1", "protein_name": "Fibroblast growth factor 4", "gene_name": "FGF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11487-1", "protein_name": "Fibroblast growth factor 3", "gene_name": "FGF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21781-1", "protein_name": "Fibroblast growth factor 7", "gene_name": "FGF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31371-1", "protein_name": "Fibroblast growth factor 9", "gene_name": "FGF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4H2-1", "protein_name": "Insulin receptor substrate 2", "gene_name": "IRS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36888-1", "protein_name": "Receptor-type tyrosine-protein kinase FLT3", "gene_name": "FLT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05230-1", "protein_name": "Fibroblast growth factor 1", "gene_name": "FGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCT0-1", "protein_name": "Fibroblast growth factor 22", "gene_name": "FGF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76093-1", "protein_name": "Fibroblast growth factor 18", "gene_name": "FGF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35568-1", "protein_name": "Insulin receptor substrate 1", "gene_name": "IRS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13480-1", "protein_name": "GRB2-associated-binding protein 1", "gene_name": "GAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR96-1", "protein_name": "Toll-like receptor 9", "gene_name": "TLR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22455-1", "protein_name": "Fibroblast growth factor receptor 4", "gene_name": "FGFR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP95-1", "protein_name": "Fibroblast growth factor 20", "gene_name": "FGF20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Z14-1", "protein_name": "Beta-klotho", "gene_name": "KLB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC2-1", "protein_name": "GRB2-associated-binding protein 2", "gene_name": "GAB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16847462", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel c-CBL and CBL-b ubiquitin ligase mutations in human acute myeloid leukemia.", "journal": "Blood", "date": "2007", "authors": "Caligiuri MA, Briesewitz R, Yu J, Wang L, Wei M, Arnoczky KJ, Marburger TB, Wen J, Perrotti D, Bloomfield CD, Whitman SP", "reference": { "type": "PubMed", "id": "17475912", "url": "https://pubmed.ncbi.nlm.nih.gov/17475912" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36888-1", "protein_name": "Receptor-type tyrosine-protein kinase FLT3", "gene_name": "FLT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22681-1", "protein_name": "E3 ubiquitin-protein ligase CBL", "gene_name": "CBL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17475912", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Exon 8 splice site mutations in the gene encoding the E3-ligase CBL are associated with core binding factor acute myeloid leukemias.", "journal": "Haematologica", "date": "2008", "authors": "Abbas S, Rotmans G, Lowenberg B, Valk PJ", "reference": { "type": "PubMed", "id": "18698078", "url": "https://pubmed.ncbi.nlm.nih.gov/18698078" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36888-1", "protein_name": "Receptor-type tyrosine-protein kinase FLT3", "gene_name": "FLT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22681-1", "protein_name": "E3 ubiquitin-protein ligase CBL", "gene_name": "CBL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18698078", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new cytokine-based dynamic stratification during induction is highly predictive of survivals in acute myeloid leukemia.", "journal": "Cancer medicine", "date": "2021", "authors": "Peterlin P, Gaschet J, Guillaume T, Garnier A, Eveillard M, Le Bourgeois A, Cherel M, Debord C, Le Bris Y, Theisen O, Godon C, Mahe B, Dubruille V, Wuilleme S, Touzeau C, Gastinne T, Blin N, Lok A, Tessoulin B, Le Gouill S, Moreau P, Bene MC, Chevallier P", "reference": { "type": "PubMed", "id": "33369136", "url": "https://pubmed.ncbi.nlm.nih.gov/33369136" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33369136", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fast Maturation of Splenic Dendritic Cells Upon TBI Is Associated With FLT3/FLT3L Signaling.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Zhang J, Li Z, Chandrasekar A, Li S, Ludolph A, Boeckers TM, Huber-Lang M, Roselli F, Olde Heuvel F", "reference": { "type": "PubMed", "id": "35281004", "url": "https://pubmed.ncbi.nlm.nih.gov/35281004" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35281004", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FLT3LG and IFITM3P6 consolidate T cell activity in the bone marrow microenvironment and are prognostic factors in acute myelocytic leukemia.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Chen H, Wu M, Xia H, Du S, Zhou G, Long G, Zhu Y, Huang X, Yang D", "reference": { "type": "PubMed", "id": "36081495", "url": "https://pubmed.ncbi.nlm.nih.gov/36081495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36081495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Early-life hyperoxia-induced Flt3L drives neonatal lung dendritic cell expansion and proinflammatory responses.", "journal": "Frontiers in immunology", "date": "2023", "authors": "Cui Tracy X, Brady Alexander E, Zhang Ying-Jian, Fulton Christina T, Goldsmith Adam M, Popova Antonia P", "reference": { "type": "PubMed", "id": "36845082", "url": "https://pubmed.ncbi.nlm.nih.gov/36845082" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36845082", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FLT3L governs the development of partially overlapping hematopoietic lineages in humans and mice.", "journal": "Cell", "date": "2024-05-23", "authors": "Momenilandi Mana, L\u00e9vy Romain, Sobrino Steicy, Li Jingwei, Lagresle-Peyrou Chantal, Esmaeilzadeh Hossein, Fayand Antoine, Le Floc'h Corentin, Gu\u00e9rin Antoine, Mina Erika Della, Shearer Debra, Delmonte Ottavia M, Yatim Ahmad, Mulder Kevin, Mancini Mathieu, Rinchai Darawan, Denis Adeline, Neehus Anna-Lena, Balogh Karla, Brendle Sarah, Rokni-Zadeh Hassan, Changi-Ashtiani Majid, Seeleuthner Yoann, Deswarte Caroline, Bessot Boris, Cremades Cassandre, Materna Marie, Cederholm Axel, Ogishi Masato, Philippot Quentin, Beganovic Omer, Ackermann Mania, Wuyts Margareta, Khan Taushif, Fou\u00e9r\u00e9 S\u00e9bastien, Herms Florian, Chanal Johan, Palterer Boaz, Bruneau Julie, Molina Thierry J, Leclerc-Mercier St\u00e9phanie, Pr\u00e9tet Jean-Luc, Youssefian Leila, Vahidnezhad Hassan, Parvaneh Nima, Claeys Kristl G, Schrijvers Rik, Luka Marine, P\u00e9rot Philippe, Fourgeaud Jacques, Nourrisson C\u00e9line, Poirier Philippe, Jouanguy Emmanuelle, Boisson-Dupuis St\u00e9phanie, Bustamante Jacinta, Notarangelo Luigi D, Christensen Neil, Landegren Nils, Abel Laurent, Marr Nico, Six Emmanuelle, Langlais David, Waterboer Tim, Ginhoux Florent, Ma Cindy S, Tangye Stuart G, Meyts Isabelle, Lachmann Nico, Hu Jiafen, Shahrooei Mohammad, Bossuyt Xavier, Casanova Jean-Laurent, B\u00e9ziat Vivien", "reference": { "type": "PubMed", "id": "38701783", "url": "https://pubmed.ncbi.nlm.nih.gov/38701783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49772-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "Flt3lg; Flt3l", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38701783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Insulin-like growth factor induces phosphorylation of immunoreactive insulin receptor substrate and its association with phosphatidylinositol-3 kinase in human thymocytes.", "journal": "The Journal of experimental medicine", "date": "1995", "authors": "Kooijman R, Lauf JJ, Kappers AC, Rijkers GT", "reference": { "type": "PubMed", "id": "7543144", "url": "https://pubmed.ncbi.nlm.nih.gov/7543144" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15520-1", "protein_name": "Fibroblast growth factor 10", "gene_name": "FGF10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WU20-1", "protein_name": "Fibroblast growth factor receptor substrate 2", "gene_name": "FRS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99570-1", "protein_name": "Phosphoinositide 3-kinase regulatory subunit 4", "gene_name": "PIK3R4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09038-4", "protein_name": "Fibroblast growth factor 2", "gene_name": "FGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10767-1", "protein_name": "Fibroblast growth factor 6", "gene_name": "FGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43320-1", "protein_name": "Fibroblast growth factor 16", "gene_name": "FGF16", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95750-1", "protein_name": "Fibroblast growth factor 19", "gene_name": "FGF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08620-1", "protein_name": "Fibroblast growth factor 4", "gene_name": "FGF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11487-1", "protein_name": "Fibroblast growth factor 3", "gene_name": "FGF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21781-1", "protein_name": "Fibroblast growth factor 7", "gene_name": "FGF7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31371-1", "protein_name": "Fibroblast growth factor 9", "gene_name": "FGF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y4H2-1", "protein_name": "Insulin receptor substrate 2", "gene_name": "IRS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06124-2", "protein_name": "Tyrosine-protein phosphatase non-receptor type 11", "gene_name": "PTPN11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36888-1", "protein_name": "Receptor-type tyrosine-protein kinase FLT3", "gene_name": "FLT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05230-1", "protein_name": "Fibroblast growth factor 1", "gene_name": "FGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCT0-1", "protein_name": "Fibroblast growth factor 22", "gene_name": "FGF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "O76093-1", "protein_name": "Fibroblast growth factor 18", "gene_name": "FGF18", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEB9-1", "protein_name": "Phosphatidylinositol 3-kinase catalytic subunit type 3", "gene_name": "PIK3C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35568-1", "protein_name": "Insulin receptor substrate 1", "gene_name": "IRS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13480-1", "protein_name": "GRB2-associated-binding protein 1", "gene_name": "GAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NR96-1", "protein_name": "Toll-like receptor 9", "gene_name": "TLR9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22455-1", "protein_name": "Fibroblast growth factor receptor 4", "gene_name": "FGFR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZV9-1", "protein_name": "Fibroblast growth factor 23", "gene_name": "FGF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP95-1", "protein_name": "Fibroblast growth factor 20", "gene_name": "FGF20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Z14-1", "protein_name": "Beta-klotho", "gene_name": "KLB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UQC2-1", "protein_name": "GRB2-associated-binding protein 2", "gene_name": "GAB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7543144", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural analysis of human and murine flt3 ligand genomic loci.", "journal": "Oncogene", "date": "1995", "authors": "Lyman SD, Stocking K, Davison B, Fletcher F, Johnson L, Escobar S", "reference": { "type": "PubMed", "id": "7566977", "url": "https://pubmed.ncbi.nlm.nih.gov/7566977" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49772-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "Flt3lg; Flt3l", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7566977", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of the human homologue of the murine flt3 ligand: a growth factor for early hematopoietic progenitor cells.", "journal": "Blood", "date": "1994", "authors": "Lyman SD, James L, Johnson L, Brasel K, de Vries P, Escobar SS, Downey H, Splett RR, Beckmann MP, McKenna HJ", "reference": { "type": "PubMed", "id": "8180375", "url": "https://pubmed.ncbi.nlm.nih.gov/8180375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49771-1", "protein_name": "Fms-related tyrosine kinase 3 ligand", "gene_name": "FLT3LG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49771", "url": "https://www.uniprot.org/uniprotkb/P49771" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8180375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of gp36, a human mucin-type glycoprotein preferentially expressed in vascular endothelium.", "journal": "The Biochemical journal", "date": "1999", "authors": "Zimmer G, Oeffner F, Von Messling V, Tschernig T, Groness HJ, Klenk HD, Herrler G", "reference": { "type": "PubMed", "id": "10393083", "url": "https://pubmed.ncbi.nlm.nih.gov/10393083" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86YL7-1", "protein_name": "Podoplanin", "gene_name": "PDPN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86YL7", "url": "https://www.uniprot.org/uniprotkb/Q86YL7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10393083", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular identification of Aggrus/T1alpha as a platelet aggregation-inducing factor expressed in colorectal tumors.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kato Y, Fujita N, Kunita A, Sato S, Kaneko M, Osawa M, Tsuruo T", "reference": { "type": "PubMed", "id": "14522983", "url": "https://pubmed.ncbi.nlm.nih.gov/14522983" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86YL7-1", "protein_name": "Podoplanin", "gene_name": "PDPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62011-1", "protein_name": "Podoplanin", "gene_name": "Pdpn", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86YL7", "url": "https://www.uniprot.org/uniprotkb/Q86YL7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 52, "end_pos": 52, "sequence_org": "T", "sequence_mut": "A", "comment": "Eliminates induction of platelet aggregation.", "evidence": [ { "database": "UniProtKB", "id": "Q86YL7", "url": "https://www.uniprot.org/uniprotkb/Q86YL7" }, { "database": "PubMed", "id": "14522983", "url": "https://pubmed.ncbi.nlm.nih.gov/14522983" } ], "uniprot_canonical_ac": "Q86YL7-1" }, { "start_pos": 34, "end_pos": 34, "sequence_org": "T", "sequence_mut": "A", "comment": "Eliminates platelet aggregation activity.", "evidence": [ { "database": "UniProtKB", "id": "Q62011", "url": "https://www.uniprot.org/uniprotkb/Q62011" }, { "database": "PubMed", "id": "14522983", "url": "https://pubmed.ncbi.nlm.nih.gov/14522983" } ], "uniprot_canonical_ac": "Q62011-1" } ], "record_id": "pubmed.14522983", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lymphatic neoangiogenesis in human kidney transplants is associated with immunologically active lymphocytic infiltrates.", "journal": "J. Am. Soc. Nephrol.", "date": "2004", "authors": "Kerjaschki Dontscho, Regele Heinrich M, Moosberger Isabella, Nagy-Bojarski Katalyn, Watschinger Bruno, Soleiman Afschin, Birner Peter, Krieger Sigurd, Hovorka Anny, Silberhumer Georg, Laakkonen Pirjo, Petrova Tatiana, Langer Brigitte, Raab Ingrid", "reference": { "type": "PubMed", "id": "14978162", "url": "https://pubmed.ncbi.nlm.nih.gov/14978162" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86YL7-1", "protein_name": "Podoplanin", "gene_name": "PDPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00585-1", "protein_name": "C-C motif chemokine 21", "gene_name": "CCL21", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86YL7", "url": "https://www.uniprot.org/uniprotkb/Q86YL7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14978162", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional sialylated O-glycan to platelet aggregation on Aggrus (T1alpha/Podoplanin) molecules expressed in Chinese hamster ovary cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kaneko M, Kato Y, Kunita A, Fujita N, Tsuruo T, Osawa M", "reference": { "type": "PubMed", "id": "15231832", "url": "https://pubmed.ncbi.nlm.nih.gov/15231832" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86YL7-1", "protein_name": "Podoplanin", "gene_name": "PDPN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62011-1", "protein_name": "Podoplanin", "gene_name": "Pdpn", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86YL7", "url": "https://www.uniprot.org/uniprotkb/Q86YL7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15231832", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of human PA2.26 antigen (T1alpha-2, podoplanin), a small membrane mucin induced in oral squamous cell carcinomas.", "journal": "International journal of cancer", "date": "2005", "authors": "Martin-Villar E, Scholl FG, Gamallo C, Yurrita MM, Munoz-Guerra M, Cruces J, Quintanilla M", "reference": { "type": "PubMed", "id": "15515019", "url": "https://pubmed.ncbi.nlm.nih.gov/15515019" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86YL7-1", "protein_name": "Podoplanin", "gene_name": "PDPN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86YL7", "url": "https://www.uniprot.org/uniprotkb/Q86YL7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15515019", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]