[ { "title": "Bcr encodes a GTPase-activating protein for p21rac.", "journal": "Nature", "date": "1991-05-30", "authors": "Diekmann D, Brill S, Garrett M D, Totty N, Hsuan J, Monfries C, Hall C, Lim L, Hall A", "reference": { "type": "PubMed", "id": "1903516", "url": "https://pubmed.ncbi.nlm.nih.gov/1903516" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07960-1", "protein_name": "Rho GTPase-activating protein 1", "gene_name": "ARHGAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1903516", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The gatekeeper mutation T315I confers resistance against small molecules by increasing or restoring the ABL-kinase activity accompanied by aberrant transphosphorylation of endogenous BCR, even in loss-of-function mutants of BCR/ABL.", "journal": "Leukemia", "date": "2009", "authors": "Mian AA, Schull M, Zhao Z, Oancea C, Hundertmark A, Beissert T, Ottmann OG, Ruthardt M", "reference": { "type": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" } ], "record_id": "pubmed.19369965", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chronic myeloid leukemia may be associated with several bcr-abl transcripts including the acute lymphoid leukemia-type 7 kb transcript.", "journal": "Blood", "date": "1990", "authors": "Selleri L, von Lindern M, Hermans A, Meijer D, Torelli G, Grosveld G", "reference": { "type": "PubMed", "id": "2407300", "url": "https://pubmed.ncbi.nlm.nih.gov/2407300" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2407300", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Breakpoint Cluster Region-Mediated Inflammation Is Dependent on Casein Kinase II.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2016", "authors": "Meng J, Jiang JJ, Atsumi T, Bando H, Okuyama Y, Sabharwal L, Nakagawa I, Higuchi H, Ota M, Okawara M, Ishitani R, Nureki O, Higo D, Arima Y, Ogura H, Kamimura D, Murakami M", "reference": { "type": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04206-1", "protein_name": "Transcription factor p65", "gene_name": "RELA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 529, "end_pos": 529, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "Q04206", "url": "https://www.uniprot.org/uniprotkb/Q04206" }, { "database": "iPTMnet", "id": "Q04206", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q04206" }, { "database": "PubMed", "id": "10938077", "url": "https://pubmed.ncbi.nlm.nih.gov/10938077" }, { "database": "PubMed", "id": "14711835", "url": "https://pubmed.ncbi.nlm.nih.gov/14711835" }, { "database": "PubMed", "id": "15016307", "url": "https://pubmed.ncbi.nlm.nih.gov/15016307" }, { "database": "PubMed", "id": "17008051", "url": "https://pubmed.ncbi.nlm.nih.gov/17008051" }, { "database": "PubMed", "id": "20882529", "url": "https://pubmed.ncbi.nlm.nih.gov/20882529" }, { "database": "PubMed", "id": "21598036", "url": "https://pubmed.ncbi.nlm.nih.gov/21598036" }, { "database": "PubMed", "id": "22527100", "url": "https://pubmed.ncbi.nlm.nih.gov/22527100" }, { "database": "PubMed", "id": "24216290", "url": "https://pubmed.ncbi.nlm.nih.gov/24216290" }, { "database": "PubMed", "id": "25620704", "url": "https://pubmed.ncbi.nlm.nih.gov/25620704" }, { "database": "PubMed", "id": "25862606", "url": "https://pubmed.ncbi.nlm.nih.gov/25862606" }, { "database": "PubMed", "id": "26082493", "url": "https://pubmed.ncbi.nlm.nih.gov/26082493" }, { "database": "PubMed", "id": "27543462", "url": "https://pubmed.ncbi.nlm.nih.gov/27543462" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "28105499", "url": "https://pubmed.ncbi.nlm.nih.gov/28105499" }, { "database": "PubMed", "id": "28859166", "url": "https://pubmed.ncbi.nlm.nih.gov/28859166" }, { "database": "PubMed", "id": "29867198", "url": "https://pubmed.ncbi.nlm.nih.gov/29867198" }, { "database": "PubMed", "id": "30992075", "url": "https://pubmed.ncbi.nlm.nih.gov/30992075" }, { "database": "PubMed", "id": "31197122", "url": "https://pubmed.ncbi.nlm.nih.gov/31197122" }, { "database": "PubMed", "id": "32386462", "url": "https://pubmed.ncbi.nlm.nih.gov/32386462" }, { "database": "PubMed", "id": "33438746", "url": "https://pubmed.ncbi.nlm.nih.gov/33438746" }, { "database": "PubMed", "id": "9792644", "url": "https://pubmed.ncbi.nlm.nih.gov/9792644" } ], "site_lbl": "Ser529", "uniprot_canonical_ac": "Q04206-1" } ], "record_id": "pubmed.27630163", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new fused transcript in Philadelphia chromosome positive acute lymphocytic leukaemia.", "journal": "Nature", "date": "1987", "authors": "Fainstein E, Marcelle C, Rosner A, Canaani E, Gale RP, Dreazen O, Smith SD, Croce CM", "reference": { "type": "PubMed", "id": "2825022", "url": "https://pubmed.ncbi.nlm.nih.gov/2825022" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2825022", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alternative 5' end of the bcr-abl transcript in chronic myelogenous leukemia.", "journal": "Oncogene", "date": "1989", "authors": "Romero P, Beran M, Shtalrid M, Andersson B, Talpaz M, Blick M", "reference": { "type": "PubMed", "id": "2915904", "url": "https://pubmed.ncbi.nlm.nih.gov/2915904" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2915904", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of DDR1-BCR signalling by nilotinib as a new therapeutic strategy for metastatic colorectal cancer.", "journal": "EMBO molecular medicine", "date": "2018", "authors": "Jeitany M, Leroy C, Tosti P, Lafitte M, Le Guet J, Simon V, Bonenfant D, Robert B, Grillet F, Mollevi C, El Messaoudi S, Otandault A, Canterel-Thouennon L, Busson M, Thierry AR, Martineau P, Pannequin J, Roche S, Sirvent A", "reference": { "type": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08345-1", "protein_name": "Epithelial discoidin domain-containing receptor 1", "gene_name": "DDR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 484, "end_pos": 484, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q08345", "url": "https://www.uniprot.org/uniprotkb/Q08345" }, { "database": "IntAct", "id": "Q08345", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q08345*" }, { "database": "iPTMnet", "id": "Q08345", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q08345" }, { "database": "PubMed", "id": "22057045", "url": "https://pubmed.ncbi.nlm.nih.gov/22057045" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" } ], "site_lbl": "Tyr484", "uniprot_canonical_ac": "Q08345-1" } ], "record_id": "pubmed.29438985", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural organization of the bcr gene and its role in the Ph' translocation.", "journal": "Nature", "date": "1985", "authors": "Heisterkamp N, Stam K, Groffen J, de Klein A, Grosveld G", "reference": { "type": "PubMed", "id": "2989703", "url": "https://pubmed.ncbi.nlm.nih.gov/2989703" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2989703", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA sequence for human bcr, the gene that translocates to the abl oncogene in chronic myeloid leukaemia.", "journal": "EMBO J.", "date": "1987", "authors": "Hariharan I K, Adams J M", "reference": { "type": "PubMed", "id": "3107980", "url": "https://pubmed.ncbi.nlm.nih.gov/3107980" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3107980", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "bcr genes and transcripts.", "journal": "Oncogene", "date": "1988", "authors": "Lifshitz B, Fainstein E, Marcelle C, Shtivelman E, Amson R, Gale R P, Canaani E", "reference": { "type": "PubMed", "id": "3285291", "url": "https://pubmed.ncbi.nlm.nih.gov/3285291" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3285291", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Shikonin overcomes drug resistance and induces necroptosis by regulating the miR-92a-1-5p/MLKL axis in chronic myeloid leukemia.", "journal": "Aging", "date": "2020-09-14", "authors": "Huang Xianbo, Chen Zhenzhen, Ni Fan, Ye Xiujin, Qian Wenbin", "reference": { "type": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" } ], "record_id": "pubmed.32927433", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Overlapping cDNA clones define the complete coding region for the P210c-abl gene product associated with chronic myelogenous leukemia cells containing the Philadelphia chromosome.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1986", "authors": "Mes-Masson A M, McLaughlin J, Daley G Q, Paskind M, Witte O N", "reference": { "type": "PubMed", "id": "3540951", "url": "https://pubmed.ncbi.nlm.nih.gov/3540951" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3540951", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The interplay between telomeric complex members and BCR::ABL1 oncogenic tyrosine kinase in the maintenance of telomere length in chronic myeloid leukemia.", "journal": "Journal of cancer research and clinical oncology", "date": "2023-08", "authors": "Der\u0119gowska Anna, P\u0119pek Monika, Solarska Iwona, Machnicki Marcin M, Pruszczyk Katarzyna, Dudzi\u0144ski Marek, Niesiob\u0119dzka-Kr\u0119\u017cel Joanna, Sefery\u0144ska Ilona, Sawicki Waldemar, Wnuk Maciej, Stok\u0142osa Tomasz", "reference": { "type": "PubMed", "id": "36871092", "url": "https://pubmed.ncbi.nlm.nih.gov/36871092" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36871092", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Histone demethylase PHF8 facilitates the development of chronic myeloid leukaemia by directly targeting BCR::ABL1.", "journal": "British journal of haematology", "date": "2023-09", "authors": "Feng Huimin, Fu Yue, Cui Zelong, Zhou Minran, Zhang Lu, Gao Zhenxing, Ma Sai, Chen Chunyan", "reference": { "type": "PubMed", "id": "37469124", "url": "https://pubmed.ncbi.nlm.nih.gov/37469124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37469124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Developmental trajectories and cooperating genomic events define molecular subtypes of BCR::ABL1-positive ALL.", "journal": "Blood", "date": "2023-12-28", "authors": "Bastian Lorenz, Beder Thomas, Barz Malwine Jeanette, Bendig Sonja, Bartsch Lorenz, Walter Wencke, Wolgast Nadine, Br\u00e4ndl Bj\u00f6rn, Rohrandt Christian, Hansen Bj\u00f6rn-Thore, Hartmann Alina M, Iben Katharina, Das Gupta Dennis, Denker Miriam, Zimmermann Johannes, Wittig Michael, Chitadze Guranda, Neumann Martin, Schneller Folker, Fiedler Walter, Steffen Bj\u00f6rn, Stelljes Matthias, Faul Christoph, Schwartz Stefan, M\u00fcller Franz-Josef, Cario Gunnar, Harder Lana, Haferlach Claudia, Pfeifer Heike, G\u00f6kbuget Nicola, Br\u00fcggemann Monika, Baldus Claudia D", "reference": { "type": "PubMed", "id": "38153913", "url": "https://pubmed.ncbi.nlm.nih.gov/38153913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38153913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Validation of a novel NGS based BCR::ABL1 kinase domain mutation detection assay in Indian cohort.", "journal": "Scientific reports", "date": "2024-07-08", "authors": "Chaudhary Pooja, Chaudhary Spandan, Patel Falguni, Patel Shiv, Vaishnani Toral, Trivedi Nikha, Patel Dhiren, Sonagara Tushar, Hirapara Ashish, Vyas Kavisha, Patel Lokesh, Kumar Raja, Chakraborty Nikkan, Sharma Divya, Suthar Jigar, Kamdar Payal, Jajodia Ekta, Ahmad Firoz, Arora Neeraj", "reference": { "type": "PubMed", "id": "38977756", "url": "https://pubmed.ncbi.nlm.nih.gov/38977756" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38977756", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tyrosine phosphorylation of BCR by FPS/FES protein-tyrosine kinases induces association of BCR with GRB-2/SOS.", "journal": "Molecular and cellular biology", "date": "1995-02", "authors": "Maru Y, Peters K L, Afar D E, Shibuya M, Witte O N, Smithgall T E", "reference": { "type": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" } ], "record_id": "pubmed.7529874", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bcr-Abl oncoproteins bind directly to activators of the Ras signalling pathway.", "journal": "The EMBO journal", "date": "1994-02-15", "authors": "Puil L, Liu J, Gish G, Mbamalu G, Bowtell D, Pelicci P G, Arlinghaus R, Pawson T", "reference": { "type": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" } ], "record_id": "pubmed.8112292", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of Bcr serine kinase by tyrosine phosphorylation.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Liu J, Wu Y, Ma GZ, Lu D, Haataja L, Heisterkamp N, Groffen J, Arlinghaus RB", "reference": { "type": "PubMed", "id": "8622703", "url": "https://pubmed.ncbi.nlm.nih.gov/8622703" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 283, "end_pos": 283, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "8622703", "url": "https://pubmed.ncbi.nlm.nih.gov/8622703" } ], "site_lbl": "Tyr283", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 360, "end_pos": 360, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "11376433", "url": "https://pubmed.ncbi.nlm.nih.gov/11376433" }, { "database": "PubMed", "id": "8622703", "url": "https://pubmed.ncbi.nlm.nih.gov/8622703" }, { "database": "PubMed", "id": "9467953", "url": "https://pubmed.ncbi.nlm.nih.gov/9467953" }, { "database": "PubMed", "id": "8912843", "url": "https://pubmed.ncbi.nlm.nih.gov/8912843" } ], "site_lbl": "Tyr360", "uniprot_canonical_ac": "P11274-1" } ], "record_id": "pubmed.8622703", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequences within the first exon of BCR inhibit the activated tyrosine kinases of c-Abl and the Bcr-Abl oncoprotein.", "journal": "Cancer research", "date": "1996-11-15", "authors": "Liu J, Wu Y, Arlinghaus R B", "reference": { "type": "PubMed", "id": "8912843", "url": "https://pubmed.ncbi.nlm.nih.gov/8912843" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 354, "end_pos": 354, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "11376433", "url": "https://pubmed.ncbi.nlm.nih.gov/11376433" }, { "database": "PubMed", "id": "11809685", "url": "https://pubmed.ncbi.nlm.nih.gov/11809685" }, { "database": "PubMed", "id": "8912843", "url": "https://pubmed.ncbi.nlm.nih.gov/8912843" } ], "site_lbl": "Ser354", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 360, "end_pos": 360, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "11376433", "url": "https://pubmed.ncbi.nlm.nih.gov/11376433" }, { "database": "PubMed", "id": "8622703", "url": "https://pubmed.ncbi.nlm.nih.gov/8622703" }, { "database": "PubMed", "id": "9467953", "url": "https://pubmed.ncbi.nlm.nih.gov/9467953" }, { "database": "PubMed", "id": "8912843", "url": "https://pubmed.ncbi.nlm.nih.gov/8912843" } ], "site_lbl": "Tyr360", "uniprot_canonical_ac": "P11274-1" } ], "record_id": "pubmed.8912843", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Co-expression with BCR induces activation of the FES tyrosine kinase and phosphorylation of specific N-terminal BCR tyrosine residues.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Li J, Smithgall TE", "reference": { "type": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07332-1", "protein_name": "Tyrosine-protein kinase Fes/Fps", "gene_name": "FES", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "P07332-1", "kinase_gene_name": "FES", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "12522270", "url": "https://pubmed.ncbi.nlm.nih.gov/12522270" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "15302586", "url": "https://pubmed.ncbi.nlm.nih.gov/15302586" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "P08631-1", "kinase_gene_name": "HCK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "12522270", "url": "https://pubmed.ncbi.nlm.nih.gov/12522270" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 246, "end_pos": 246, "kinase_uniprot_canonical_ac": "P07332-1", "kinase_gene_name": "FES", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" } ], "site_lbl": "Tyr246", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 276, "end_pos": 276, "kinase_uniprot_canonical_ac": "P07332-1", "kinase_gene_name": "FES", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" } ], "site_lbl": "Tyr276", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 279, "end_pos": 279, "kinase_uniprot_canonical_ac": "P07332-1", "kinase_gene_name": "FES", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" } ], "site_lbl": "Tyr279", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 283, "end_pos": 283, "kinase_uniprot_canonical_ac": "P07332-1", "kinase_gene_name": "FES", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" } ], "site_lbl": "Tyr283", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 713, "end_pos": 713, "kinase_uniprot_canonical_ac": "P07332-1", "kinase_gene_name": "FES", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P07332", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P07332" }, { "database": "PubMed", "id": "8663427", "url": "https://pubmed.ncbi.nlm.nih.gov/8663427" }, { "database": "PubMed", "id": "7687763", "url": "https://pubmed.ncbi.nlm.nih.gov/7687763" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "UniProtKB", "id": "P07332", "url": "https://www.uniprot.org/uniprotkb/P07332" }, { "database": "PubMed", "id": "15485904", "url": "https://pubmed.ncbi.nlm.nih.gov/15485904" } ], "site_lbl": "Tyr713", "uniprot_canonical_ac": "P07332-1" } ], "record_id": "pubmed.8955135", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of a lymphoid-restricted, Grb2-like SH3-SH2-SH3 protein in T cell receptor signaling.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Trub T, Frantz JD, Miyazaki M, Band H, Shoelson SE", "reference": { "type": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29353-1", "protein_name": "SHC-transforming protein 1", "gene_name": "SHC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 427, "end_pos": 427, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P29353", "url": "https://www.uniprot.org/uniprotkb/P29353" }, { "database": "PubMed", "id": "9121430", "url": "https://pubmed.ncbi.nlm.nih.gov/9121430" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "9566877", "url": "https://pubmed.ncbi.nlm.nih.gov/9566877" }, { "database": "IntAct", "id": "P29353", "url": "https://www.ebi.ac.uk/intact/interactors/id:P29353*" }, { "database": "iPTMnet", "id": "P29353", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P29353" }, { "database": "PubMed", "id": "22057045", "url": "https://pubmed.ncbi.nlm.nih.gov/22057045" }, { "database": "PubMed", "id": "11827484", "url": "https://pubmed.ncbi.nlm.nih.gov/11827484" }, { "database": "PubMed", "id": "12213123", "url": "https://pubmed.ncbi.nlm.nih.gov/12213123" }, { "database": "PubMed", "id": "9254595", "url": "https://pubmed.ncbi.nlm.nih.gov/9254595" }, { "database": "PubMed", "id": "9083103", "url": "https://pubmed.ncbi.nlm.nih.gov/9083103" }, { "database": "PubMed", "id": "8084588", "url": "https://pubmed.ncbi.nlm.nih.gov/8084588" }, { "database": "PubMed", "id": "9175774", "url": "https://pubmed.ncbi.nlm.nih.gov/9175774" }, { "database": "PubMed", "id": "9872323", "url": "https://pubmed.ncbi.nlm.nih.gov/9872323" }, { "database": "PubMed", "id": "8940013", "url": "https://pubmed.ncbi.nlm.nih.gov/8940013" }, { "database": "PubMed", "id": "9973396", "url": "https://pubmed.ncbi.nlm.nih.gov/9973396" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "8663178", "url": "https://pubmed.ncbi.nlm.nih.gov/8663178" }, { "database": "PRO", "id": "P29353", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P29353" } ], "site_lbl": "Tyr427", "uniprot_canonical_ac": "P29353-1" } ], "record_id": "pubmed.8995379", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tyrosine phosphorylation of p120cbl in BCR/abl transformed hematopoietic cells mediates enhanced association with phosphatidylinositol 3-kinase.", "journal": "Oncogene", "date": "1997-05-08", "authors": "Jain S K, Langdon W Y, Varticovski L", "reference": { "type": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" } ], "record_id": "pubmed.9174058", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bcr phosphorylated on tyrosine 177 binds Grb2.", "journal": "Oncogene", "date": "1997", "authors": "Ma G, Lu D, Wu Y, Liu J, Arlinghaus RB", "reference": { "type": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "P07332-1", "kinase_gene_name": "FES", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "12522270", "url": "https://pubmed.ncbi.nlm.nih.gov/12522270" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "15302586", "url": "https://pubmed.ncbi.nlm.nih.gov/15302586" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "P08631-1", "kinase_gene_name": "HCK", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "12522270", "url": "https://pubmed.ncbi.nlm.nih.gov/12522270" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HCK", "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" }, { "database": "IntAct", "id": "P11274", "url": "https://www.ebi.ac.uk/intact/interactors/id:P11274*" }, { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "10887132", "url": "https://pubmed.ncbi.nlm.nih.gov/10887132" }, { "database": "PubMed", "id": "11726515", "url": "https://pubmed.ncbi.nlm.nih.gov/11726515" }, { "database": "PubMed", "id": "7529874", "url": "https://pubmed.ncbi.nlm.nih.gov/7529874" }, { "database": "PubMed", "id": "8112292", "url": "https://pubmed.ncbi.nlm.nih.gov/8112292" }, { "database": "PubMed", "id": "9174058", "url": "https://pubmed.ncbi.nlm.nih.gov/9174058" }, { "database": "PubMed", "id": "9178913", "url": "https://pubmed.ncbi.nlm.nih.gov/9178913" }, { "database": "PubMed", "id": "8955135", "url": "https://pubmed.ncbi.nlm.nih.gov/8955135" }, { "database": "PubMed", "id": "8995379", "url": "https://pubmed.ncbi.nlm.nih.gov/8995379" }, { "database": "PubMed", "id": "19369965", "url": "https://pubmed.ncbi.nlm.nih.gov/19369965" }, { "database": "PubMed", "id": "27630163", "url": "https://pubmed.ncbi.nlm.nih.gov/27630163" }, { "database": "PubMed", "id": "29438985", "url": "https://pubmed.ncbi.nlm.nih.gov/29438985" }, { "database": "PubMed", "id": "32927433", "url": "https://pubmed.ncbi.nlm.nih.gov/32927433" }, { "database": "PubMed", "id": "9407116", "url": "https://pubmed.ncbi.nlm.nih.gov/9407116" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" } ], "site_lbl": "Tyr177", "uniprot_canonical_ac": "P11274-1" } ], "record_id": "pubmed.9178913", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Requirement of two specific tyrosine residues for the catalytic activity of Bcr serine/threonine kinase.", "journal": "Oncogene", "date": "1998", "authors": "Wu Y, Liu J, Arlinghaus RB", "reference": { "type": "PubMed", "id": "9467953", "url": "https://pubmed.ncbi.nlm.nih.gov/9467953" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P11274-1", "protein_name": "Breakpoint cluster region protein", "gene_name": "BCR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P11274", "url": "https://www.uniprot.org/uniprotkb/P11274" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 328, "end_pos": 328, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "11376433", "url": "https://pubmed.ncbi.nlm.nih.gov/11376433" }, { "database": "PubMed", "id": "9467953", "url": "https://pubmed.ncbi.nlm.nih.gov/9467953" } ], "site_lbl": "Tyr328", "uniprot_canonical_ac": "P11274-1" }, { "start_pos": 360, "end_pos": 360, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11274", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11274" }, { "database": "PubMed", "id": "11376433", "url": "https://pubmed.ncbi.nlm.nih.gov/11376433" }, { "database": "PubMed", "id": "8622703", "url": "https://pubmed.ncbi.nlm.nih.gov/8622703" }, { "database": "PubMed", "id": "9467953", "url": "https://pubmed.ncbi.nlm.nih.gov/9467953" }, { "database": "PubMed", "id": "8912843", "url": "https://pubmed.ncbi.nlm.nih.gov/8912843" } ], "site_lbl": "Tyr360", "uniprot_canonical_ac": "P11274-1" } ], "record_id": "pubmed.9467953", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The C494F variant in the CYP11B1 gene is a sequence polymorphism in the Spanish population.", "journal": "J. Clin. Endocrinol. Metab.", "date": "1999", "authors": "Loidi L, Quinteiro C, Barros F, Dom\u00ednguez F, Barreiro J, Pombo M", "reference": { "type": "PubMed", "id": "10599751", "url": "https://pubmed.ncbi.nlm.nih.gov/10599751" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10599751", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of steroid hydroxylase activity in stably transfected V79MZh11B1 and V79MZh11B2 cells by PKC and PKD inhibitors.", "journal": "Endocrine research", "date": "2002-11", "authors": "Bureik Matthias, Zeeh Annette, Bernhardt Rita", "reference": { "type": "PubMed", "id": "12530636", "url": "https://pubmed.ncbi.nlm.nih.gov/12530636" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19099-1", "protein_name": "Cytochrome P450 11B2, mitochondrial", "gene_name": "CYP11B2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12530636", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glucocorticoid-suppressible hyperaldosteronism results from hybrid genes created by unequal crossovers between CYP11B1 and CYP11B2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992-09-01", "authors": "Pascoe L, Curnow K M, Slutsker L, Connell J M, Speiser P W, New M I, White P C", "reference": { "type": "PubMed", "id": "1518866", "url": "https://pubmed.ncbi.nlm.nih.gov/1518866" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19099-1", "protein_name": "Cytochrome P450 11B2, mitochondrial", "gene_name": "CYP11B2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1518866", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the human CYP11B2 (aldosterone synthase) gene causing corticosterone methyloxidase II deficiency.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Pascoe L, Curnow KM, Slutsker L, Rosler A, White PC", "reference": { "type": "PubMed", "id": "1594605", "url": "https://pubmed.ncbi.nlm.nih.gov/1594605" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19099-1", "protein_name": "Cytochrome P450 11B2, mitochondrial", "gene_name": "CYP11B2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1594605", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "21-Hydroxylase and 11beta-hydroxylase mutations in Romanian patients with classic congenital adrenal hyperplasia.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2005", "authors": "Grigorescu Sido A, Weber MM, Grigorescu Sido P, Clausmeyer S, Heinrich U, Schulze E", "reference": { "type": "PubMed", "id": "16046588", "url": "https://pubmed.ncbi.nlm.nih.gov/16046588" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08686-1", "protein_name": "Steroid 21-hydroxylase", "gene_name": "CYP21A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16046588", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The product of the CYP11B2 gene is required for aldosterone biosynthesis in the human adrenal cortex.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1991-10", "authors": "Curnow K M, Tusie-Luna M T, Pascoe L, Natarajan R, Gu J L, Nadler J L, White P C", "reference": { "type": "PubMed", "id": "1775135", "url": "https://pubmed.ncbi.nlm.nih.gov/1775135" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19099-1", "protein_name": "Cytochrome P450 11B2, mitochondrial", "gene_name": "CYP11B2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1775135", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and functional characterization of human 11beta hydroxylase expressed in Escherichia coli.", "journal": "The FEBS journal", "date": "2008-02", "authors": "Z\u00f6llner Andy, Kagawa Norio, Waterman Michael R, Nonaka Yasuki, Takio Koji, Shiro Yoshitsugu, Hannemann Frank, Bernhardt Rita", "reference": { "type": "PubMed", "id": "18215163", "url": "https://pubmed.ncbi.nlm.nih.gov/18215163" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18215163", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Progress in molecular-genetic studies on congenital adrenal hyperplasia due to 11beta-hydroxylase deficiency.", "journal": "World journal of pediatrics : WJP", "date": "2008", "authors": "Zhao LQ, Han S, Tian HM", "reference": { "type": "PubMed", "id": "18661760", "url": "https://pubmed.ncbi.nlm.nih.gov/18661760" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18661760", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional consequences of seven novel mutations in the CYP11B1 gene: four mutations associated with nonclassic and three mutations causing classic 11{beta}-hydroxylase deficiency.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2010", "authors": "Parajes S, Loidi L, Reisch N, Dhir V, Rose IT, Hampel R, Quinkler M, Conway GS, Castro-Feijoo L, Araujo-Vilar D, Pombo M, Dominguez F, Williams EL, Cole TR, Kirk JM, Kaminsky E, Rumsby G, Arlt W, Krone N", "reference": { "type": "PubMed", "id": "20089618", "url": "https://pubmed.ncbi.nlm.nih.gov/20089618" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20089618", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adrenocortical zonation in humans under normal and pathological conditions.", "journal": "J. Clin. Endocrinol. Metab.", "date": "2010", "authors": "Nishimoto Koshiro, Nakagawa Ken, Li Dan, Kosaka Takeo, Oya Mototsugu, Mikami Shuji, Shibata Hirotaka, Itoh Hiroshi, Mitani Fumiko, Yamazaki Takeshi, Ogishima Tadashi, Suematsu Makoto, Mukai Kuniaki", "reference": { "type": "PubMed", "id": "20200334", "url": "https://pubmed.ncbi.nlm.nih.gov/20200334" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19099-1", "protein_name": "Cytochrome P450 11B2, mitochondrial", "gene_name": "CYP11B2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20200334", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mutation in CYP11B1 (Arg-448----His) associated with steroid 11 beta-hydroxylase deficiency in Jews of Moroccan origin.", "journal": "The Journal of clinical investigation", "date": "1991", "authors": "White PC, Dupont J, New MI, Leiberman E, Hochberg Z, Rosler A", "reference": { "type": "PubMed", "id": "2022736", "url": "https://pubmed.ncbi.nlm.nih.gov/2022736" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2022736", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Only two mutations detected in 15 Tunisian patients with 11beta-hydroxylase deficiency: the p.Q356X and the novel p.G379V.", "journal": "Clinical genetics", "date": "2010", "authors": "Kharrat M, Trabelsi S, Chaabouni M, Maazoul F, Kraoua L, Ben Jemaa L, Gandoura N, Barsaoui S, Morel Y, M'rad R, Chaabouni H", "reference": { "type": "PubMed", "id": "20331679", "url": "https://pubmed.ncbi.nlm.nih.gov/20331679" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20331679", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel homozygous p.R454C mutation in the CYP11B1 gene leads to 11beta-hydroxylase deficiency in a Chinese patient.", "journal": "Fertility and sterility", "date": "2011", "authors": "Wu C, Zhou Q, Wan L, Ni L, Zheng C, Qian Y, Jin J", "reference": { "type": "PubMed", "id": "20947076", "url": "https://pubmed.ncbi.nlm.nih.gov/20947076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20947076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insights into aldosterone synthase substrate specificity and targeted inhibition.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2013", "authors": "Strushkevich N, Gilep AA, Shen L, Arrowsmith CH, Edwards AM, Usanov SA, Park HW", "reference": { "type": "PubMed", "id": "23322723", "url": "https://pubmed.ncbi.nlm.nih.gov/23322723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19099-1", "protein_name": "Cytochrome P450 11B2, mitochondrial", "gene_name": "CYP11B2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23322723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A diagnosis not to be missed: nonclassic steroid 11beta-hydroxylase deficiency presenting with premature adrenarche and hirsutism.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2013", "authors": "Reisch N, Hogler W, Parajes S, Rose IT, Dhir V, Gotzinger J, Arlt W, Krone N", "reference": { "type": "PubMed", "id": "23940125", "url": "https://pubmed.ncbi.nlm.nih.gov/23940125" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23940125", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of cDNA and genomic DNA for human cytochrome P-45011 beta.", "journal": "FEBS letters", "date": "1990", "authors": "Kawamoto T, Mitsuuchi Y, Toda K, Miyahara K, Yokoyama Y, Nakao K, Hosoda K, Yamamoto Y, Imura H, Shizuta Y", "reference": { "type": "PubMed", "id": "2401360", "url": "https://pubmed.ncbi.nlm.nih.gov/2401360" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2401360", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Congenital adrenal hyperplasia due to 11-beta-hydroxylase deficiency: functional consequences of four CYP11B1 mutations.", "journal": "European journal of human genetics : EJHG", "date": "2014", "authors": "Menabo S, Polat S, Baldazzi L, Kulle AE, Holterhus PM, Grotzinger J, Fanelli F, Balsamo A, Riepe FG", "reference": { "type": "PubMed", "id": "24022297", "url": "https://pubmed.ncbi.nlm.nih.gov/24022297" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24022297", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterisation of three novel CYP11B1 mutations in classic and non-classic 11beta-hydroxylase deficiency.", "journal": "European journal of endocrinology", "date": "2014", "authors": "Polat S, Kulle A, Karaca Z, Akkurt I, Kurtoglu S, Kelestimur F, Grotzinger J, Holterhus PM, Riepe FG", "reference": { "type": "PubMed", "id": "24536089", "url": "https://pubmed.ncbi.nlm.nih.gov/24536089" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24536089", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two Novel CYP11B1 Gene Mutations in Patients from Two Croatian Families with 11 beta -Hydroxylase Deficiency.", "journal": "International journal of endocrinology", "date": "2014", "authors": "Dumic K, Yuen T, Grubic Z, Kusec V, Barisic I, New MI", "reference": { "type": "PubMed", "id": "24987415", "url": "https://pubmed.ncbi.nlm.nih.gov/24987415" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24987415", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the molecular genetic pathology in patients with 11beta-hydroxylase deficiency.", "journal": "Clinical endocrinology", "date": "2015", "authors": "Mooij CF, Parajes S, Rose IT, Taylor AE, Bayraktaroglu T, Wass JA, Connell JM, Ray DW, Arlt W, Krone N", "reference": { "type": "PubMed", "id": "26053152", "url": "https://pubmed.ncbi.nlm.nih.gov/26053152" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26053152", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phenotypic, metabolic, and molecular genetic characterization of six patients with congenital adrenal hyperplasia caused by novel mutations in the CYP11B1 gene.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2016", "authors": "Nguyen HH, Eiden-Plach A, Hannemann F, Malunowicz EM, Hartmann MF, Wudy SA, Bernhardt R", "reference": { "type": "PubMed", "id": "26476331", "url": "https://pubmed.ncbi.nlm.nih.gov/26476331" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26476331", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The in vitro metabolism of 11\u03b2-hydroxyprogesterone and 11-ketoprogesterone to 11-ketodihydrotestosterone in the backdoor pathway.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2018-04", "authors": "van Rooyen Desmar\u00e9, Gent Rachelle, Barnard Lise, Swart Amanda C", "reference": { "type": "PubMed", "id": "29277707", "url": "https://pubmed.ncbi.nlm.nih.gov/29277707" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29277707", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic variants in CYP11B1 influence the susceptibility to coronary heart disease.", "journal": "BMC medical genomics", "date": "2022", "authors": "Huang X, Cheng Y, Wang N", "reference": { "type": "PubMed", "id": "35831903", "url": "https://pubmed.ncbi.nlm.nih.gov/35831903" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35831903", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular analysis of 12 Chinese patients with 11\u03b2-hydroxylase deficiency and in vitro functional study of 20 CYP11B1 missense variants.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2023-04", "authors": "Sun Bang, Lu Lin, Xie Shaowei, Zhang Wei, Zhang Xiaoxia, Tong Anli, Chen Shi, Wu Xueyan, Mao Jiangfeng, Wang Xi, Qiu Ling, Nie Min", "reference": { "type": "PubMed", "id": "36929050", "url": "https://pubmed.ncbi.nlm.nih.gov/36929050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36929050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clinical and molecular characterization of 10 Chinese children with congenital adrenal hyperplasia due to 11beta-hydroxylase deficiency.", "journal": "World journal of pediatrics : WJP", "date": "2023-07-24", "authors": "Lu Wen-Li, Ma Xiao-Yu, Zhang Jiao, Wang Jun-Qi, Zhang Ting-Ting, Ye Lei, Xiao Yuan, Dong Zhi-Ya, Wang Wei, Sun Shou-Yue, Li Chuan-Yin, Hu Rong-Gui, Ning Guang, Zhang Li-Dan", "reference": { "type": "PubMed", "id": "37486441", "url": "https://pubmed.ncbi.nlm.nih.gov/37486441" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37486441", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and functional characterization of compound heterozygous CYP11B1 gene mutations.", "journal": "Endocrine", "date": "2024-01-29", "authors": "Liu He, Liu Fuqiang, Wei Zichun, Liu Pan, Liu Qiao, Chen Li, Hou Xinguo", "reference": { "type": "PubMed", "id": "38285409", "url": "https://pubmed.ncbi.nlm.nih.gov/38285409" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38285409", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Analysis of a family with 11\u03b2-hydroxylase deficiency due to a mutation in the CYP11B1 gene].", "journal": "Zhonghua yi xue za zhi", "date": "2024-06-11", "authors": "Yu Y Y, Tao Y K, Hou J Z, Zhou G X, Du J J, Zhang D", "reference": { "type": "PubMed", "id": "38858218", "url": "https://pubmed.ncbi.nlm.nih.gov/38858218" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38858218", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A nonsense mutation (TGG [Trp116]-->TAG [Stop]) in CYP11B1 causes steroid 11 beta-hydroxylase deficiency.", "journal": "J. Clin. Endocrinol. Metab.", "date": "1993", "authors": "Naiki Y, Kawamoto T, Mitsuuchi Y, Miyahara K, Toda K, Orii T, Imura H, Shizuta Y", "reference": { "type": "PubMed", "id": "7903314", "url": "https://pubmed.ncbi.nlm.nih.gov/7903314" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7903314", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the CYP11B1 gene causing congenital adrenal hyperplasia and hypertension cluster in exons 6, 7, and 8.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Curnow KM, Slutsker L, Vitek J, Cole T, Speiser PW, New MI, White PC, Pascoe L", "reference": { "type": "PubMed", "id": "8506298", "url": "https://pubmed.ncbi.nlm.nih.gov/8506298" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8506298", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CYP11B1 mutations causing congenital adrenal hyperplasia due to 11 beta-hydroxylase deficiency.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1996", "authors": "Geley S, Kapelari K, Johrer K, Peter M, Glatzl J, Vierhapper H, Schwarz S, Helmberg A, Sippell WG, White PC, Kofler R", "reference": { "type": "PubMed", "id": "8768848", "url": "https://pubmed.ncbi.nlm.nih.gov/8768848" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8768848", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CYP11B1 mutations causing non-classic adrenal hyperplasia due to 11 beta-hydroxylase deficiency.", "journal": "Human molecular genetics", "date": "1997", "authors": "Joehrer K, Geley S, Strasser-Wozak EM, Azziz R, Wollmann HA, Schmitt K, Kofler R, White PC", "reference": { "type": "PubMed", "id": "9302260", "url": "https://pubmed.ncbi.nlm.nih.gov/9302260" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P15538", "url": "https://www.uniprot.org/uniprotkb/P15538" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9302260", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of cDNA coding for the beta chain of human complement component C4b-binding protein: sequence homology with the alpha chain.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1990", "authors": "Hillarp A, Dahlback B", "reference": { "type": "PubMed", "id": "2300577", "url": "https://pubmed.ncbi.nlm.nih.gov/2300577" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20851", "url": "https://www.uniprot.org/uniprotkb/P20851" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2300577", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C4b-Binding Protein Deposition is Induced in Diseased Aortic Heart Valves, Coinciding with C3d.", "journal": "The Journal of heart valve disease", "date": "2015", "authors": "Dikhoff MJ, ter Weeme M, Vonk AB, Kupreishvili K, Blom AM, Krijnen PA, Stooker W, Niessen HW", "reference": { "type": "PubMed", "id": "26897815", "url": "https://pubmed.ncbi.nlm.nih.gov/26897815" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20851", "url": "https://www.uniprot.org/uniprotkb/P20851" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26897815", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arterial Blood Pressure Induces Transient C4b-Binding Protein in Human Saphenous Vein Grafts.", "journal": "Annals of vascular surgery", "date": "2017", "authors": "Kupreishvili K, Meischl C, Vonk ABA, Stooker W, Eijsman L, Blom AM, Quax PHA, van Hinsbergh VWM, Niessen HWM, Krijnen PAJ", "reference": { "type": "PubMed", "id": "28163174", "url": "https://pubmed.ncbi.nlm.nih.gov/28163174" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20851", "url": "https://www.uniprot.org/uniprotkb/P20851" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28163174", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Serum amyloid A, protein Z, and C4b-binding protein beta chain as new potential biomarkers for pulmonary tuberculosis.", "journal": "PloS one", "date": "2017", "authors": "Jiang TT, Shi LY, Wei LL, Li X, Yang S, Wang C, Liu CM, Chen ZL, Tu HH, Li ZJ, Li JC", "reference": { "type": "PubMed", "id": "28278182", "url": "https://pubmed.ncbi.nlm.nih.gov/28278182" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20851", "url": "https://www.uniprot.org/uniprotkb/P20851" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28278182", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "C4BP(\u03b2-)-mediated immunomodulation attenuates inflammation in DSS-induced murine colitis and in myeloid cells from IBD patients.", "journal": "Pharmacological research", "date": "2023-11", "authors": "Serrano Inmaculada, Luque Ana, Ruiz-Cerulla Alexandra, Navas Sergio, Blom Anna M, Rodr\u00edguez de C\u00f3rdoba Santiago, Fern\u00e1ndez Francisco J, Cristina Vega M, Rodr\u00edguez-Moranta Francisco, Guardiola Jordi, Aran Josep M", "reference": { "type": "PubMed", "id": "37806602", "url": "https://pubmed.ncbi.nlm.nih.gov/37806602" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20851", "url": "https://www.uniprot.org/uniprotkb/P20851" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37806602", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human C4b-binding protein beta-chain gene.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Hillarp A, Pardo-Manuel F, Ruiz R R, Rodriguez de Cordoba S, Dahlb\u00e4ck B", "reference": { "type": "PubMed", "id": "8325877", "url": "https://pubmed.ncbi.nlm.nih.gov/8325877" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20851-1", "protein_name": "C4b-binding protein beta chain", "gene_name": "C4BPB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P20851", "url": "https://www.uniprot.org/uniprotkb/P20851" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8325877", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence analysis and chromosomal localization of human Cap Z. Conserved residues within the actin-binding domain may link Cap Z to gelsolin/severin and profilin protein families.", "journal": "J. Biol. Chem.", "date": "1995", "authors": "Barron-Casella EA, Torres MA, Scherer SW, Heng HH, Tsui LC, Casella JF", "reference": { "type": "PubMed", "id": "7665558", "url": "https://pubmed.ncbi.nlm.nih.gov/7665558" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P47756", "url": "https://www.uniprot.org/uniprotkb/P47756" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7665558", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAGE hypomethylation, a new epigenetic biomarker for colon cancer detection.", "journal": "Cancer epidemiology, biomarkers & prevention : a publication of the American Association for Cancer Research, cosponsored by the American Society of Preventive Oncology", "date": "2008", "authors": "Grunau C, Brun ME, Rivals I, Selves J, Hindermann W, Favre-Mercuret M, Granier G, De Sario A", "reference": { "type": "PubMed", "id": "18541613", "url": "https://pubmed.ncbi.nlm.nih.gov/18541613" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13072-1", "protein_name": "B melanoma antigen 1", "gene_name": "BAGE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13072", "url": "https://www.uniprot.org/uniprotkb/Q13072" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18541613", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of tumor-specific antigen MAGE, GAGE and BAGE in ovarian cancer tissues and cell lines.", "journal": "BMC cancer", "date": "2010", "authors": "Zhang S, Zhou X, Yu H, Yu Y", "reference": { "type": "PubMed", "id": "20423514", "url": "https://pubmed.ncbi.nlm.nih.gov/20423514" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13072-1", "protein_name": "B melanoma antigen 1", "gene_name": "BAGE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTW1-1", "protein_name": "G antigen 1", "gene_name": "GAGE1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13072", "url": "https://www.uniprot.org/uniprotkb/Q13072" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20423514", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAGE: a new gene encoding an antigen recognized on human melanomas by cytolytic T lymphocytes.", "journal": "Immunity", "date": "1995", "authors": "Bo\u00ebl P, Wildmann C, Sensi M L, Brasseur R, Renauld J C, Coulie P, Boon T, van der Bruggen P", "reference": { "type": "PubMed", "id": "7895173", "url": "https://pubmed.ncbi.nlm.nih.gov/7895173" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13072-1", "protein_name": "B melanoma antigen 1", "gene_name": "BAGE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13072", "url": "https://www.uniprot.org/uniprotkb/Q13072" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7895173", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mapping of a target region of allelic loss to a 0.5-cM interval on chromosome 22q13 in human colorectal cancer.", "journal": "Gastroenterology", "date": "1999", "authors": "Castells A, Ino Y, Louis D N, Ramesh V, Gusella J F, Rustgi A K", "reference": { "type": "PubMed", "id": "10500065", "url": "https://pubmed.ncbi.nlm.nih.gov/10500065" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13323-1", "protein_name": "Bcl-2-interacting killer", "gene_name": "BIK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13323", "url": "https://www.uniprot.org/uniprotkb/Q13323" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10500065", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enhancement of Bik antitumor effect by Bik mutants.", "journal": "Cancer research", "date": "2003", "authors": "Li YM, Wen Y, Zhou BP, Kuo HP, Ding Q, Hung MC", "reference": { "type": "PubMed", "id": "14633680", "url": "https://pubmed.ncbi.nlm.nih.gov/14633680" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13323-1", "protein_name": "Bcl-2-interacting killer", "gene_name": "BIK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13323", "url": "https://www.uniprot.org/uniprotkb/Q13323" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 33, "end_pos": 33, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13323", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13323" }, { "database": "PubMed", "id": "14633680", "url": "https://pubmed.ncbi.nlm.nih.gov/14633680" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" } ], "site_lbl": "Thr33", "uniprot_canonical_ac": "Q13323-1" }, { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13323", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13323" }, { "database": "PubMed", "id": "14633680", "url": "https://pubmed.ncbi.nlm.nih.gov/14633680" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" } ], "site_lbl": "Ser35", "uniprot_canonical_ac": "Q13323-1" } ], "record_id": "pubmed.14633680", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BikDDA, a mutant of Bik with longer half-life expression protein, can be a novel therapeutic gene for triple-negative breast cancer.", "journal": "PloS one", "date": "2014", "authors": "Jiao S, Wu M, Ye F, Tang H, Xie X, Xie X", "reference": { "type": "PubMed", "id": "24637719", "url": "https://pubmed.ncbi.nlm.nih.gov/24637719" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13323-1", "protein_name": "Bcl-2-interacting killer", "gene_name": "BIK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13323", "url": "https://www.uniprot.org/uniprotkb/Q13323" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 124, "end_pos": 124, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13323", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13323" }, { "database": "PubMed", "id": "24637719", "url": "https://pubmed.ncbi.nlm.nih.gov/24637719" } ], "site_lbl": "Ser124", "uniprot_canonical_ac": "Q13323-1" } ], "record_id": "pubmed.24637719", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of Casein Kinase II by Gallic Acid Induces BIK-BAX/BAK-Mediated ER Ca(++)-ROS-Dependent Apoptosis of Human Oral Cancer Cells.", "journal": "Frontiers in physiology", "date": "2017", "authors": "Lin ML, Chen SS", "reference": { "type": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13323-1", "protein_name": "Bcl-2-interacting killer", "gene_name": "BIK", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13323", "url": "https://www.uniprot.org/uniprotkb/Q13323" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 33, "end_pos": 33, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13323", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13323" }, { "database": "PubMed", "id": "14633680", "url": "https://pubmed.ncbi.nlm.nih.gov/14633680" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" } ], "site_lbl": "Thr33", "uniprot_canonical_ac": "Q13323-1" }, { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13323", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13323" }, { "database": "PubMed", "id": "14633680", "url": "https://pubmed.ncbi.nlm.nih.gov/14633680" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" } ], "site_lbl": "Ser35", "uniprot_canonical_ac": "Q13323-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 392, "end_pos": 392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2, CDK2 and NUAK1", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "11239457", "url": "https://pubmed.ncbi.nlm.nih.gov/11239457" }, { "database": "PubMed", "id": "12393879", "url": "https://pubmed.ncbi.nlm.nih.gov/12393879" }, { "database": "PubMed", "id": "16552184", "url": "https://pubmed.ncbi.nlm.nih.gov/16552184" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10559267", "url": "https://pubmed.ncbi.nlm.nih.gov/10559267" }, { "database": "PubMed", "id": "10597229", "url": "https://pubmed.ncbi.nlm.nih.gov/10597229" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10747897", "url": "https://pubmed.ncbi.nlm.nih.gov/10747897" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10884347", "url": "https://pubmed.ncbi.nlm.nih.gov/10884347" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11508859", "url": "https://pubmed.ncbi.nlm.nih.gov/11508859" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11741290", "url": "https://pubmed.ncbi.nlm.nih.gov/11741290" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "12081208", "url": "https://pubmed.ncbi.nlm.nih.gov/12081208" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12776195", "url": "https://pubmed.ncbi.nlm.nih.gov/12776195" }, { "database": "PubMed", "id": "12792782", "url": "https://pubmed.ncbi.nlm.nih.gov/12792782" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12898523", "url": "https://pubmed.ncbi.nlm.nih.gov/12898523" }, { "database": "PubMed", "id": "12937839", "url": "https://pubmed.ncbi.nlm.nih.gov/12937839" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14640983", "url": "https://pubmed.ncbi.nlm.nih.gov/14640983" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "15038834", "url": "https://pubmed.ncbi.nlm.nih.gov/15038834" }, { "database": "PubMed", "id": "15064747", "url": "https://pubmed.ncbi.nlm.nih.gov/15064747" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15709766", "url": "https://pubmed.ncbi.nlm.nih.gov/15709766" }, { "database": "PubMed", "id": "15837201", "url": "https://pubmed.ncbi.nlm.nih.gov/15837201" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "16082409", "url": "https://pubmed.ncbi.nlm.nih.gov/16082409" }, { "database": "PubMed", "id": "16299809", "url": "https://pubmed.ncbi.nlm.nih.gov/16299809" }, { "database": "PubMed", "id": "16319070", "url": "https://pubmed.ncbi.nlm.nih.gov/16319070" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16741955", "url": "https://pubmed.ncbi.nlm.nih.gov/16741955" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "17051326", "url": "https://pubmed.ncbi.nlm.nih.gov/17051326" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17180249", "url": "https://pubmed.ncbi.nlm.nih.gov/17180249" }, { "database": "PubMed", "id": "17237827", "url": "https://pubmed.ncbi.nlm.nih.gov/17237827" }, { "database": "PubMed", "id": "17341630", "url": "https://pubmed.ncbi.nlm.nih.gov/17341630" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17523842", "url": "https://pubmed.ncbi.nlm.nih.gov/17523842" }, { "database": "PubMed", "id": "17565390", "url": "https://pubmed.ncbi.nlm.nih.gov/17565390" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17966099", "url": "https://pubmed.ncbi.nlm.nih.gov/17966099" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18443131", "url": "https://pubmed.ncbi.nlm.nih.gov/18443131" }, { "database": "PubMed", "id": "18472237", "url": "https://pubmed.ncbi.nlm.nih.gov/18472237" }, { "database": "PubMed", "id": "18495777", "url": "https://pubmed.ncbi.nlm.nih.gov/18495777" }, { "database": "PubMed", "id": "18523266", "url": "https://pubmed.ncbi.nlm.nih.gov/18523266" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18718914", "url": "https://pubmed.ncbi.nlm.nih.gov/18718914" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19253369", "url": "https://pubmed.ncbi.nlm.nih.gov/19253369" }, { "database": "PubMed", "id": "19428812", "url": "https://pubmed.ncbi.nlm.nih.gov/19428812" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19834494", "url": "https://pubmed.ncbi.nlm.nih.gov/19834494" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19932175", "url": "https://pubmed.ncbi.nlm.nih.gov/19932175" }, { "database": "PubMed", "id": "20009884", "url": "https://pubmed.ncbi.nlm.nih.gov/20009884" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20234175", "url": "https://pubmed.ncbi.nlm.nih.gov/20234175" }, { "database": "PubMed", "id": "20346999", "url": "https://pubmed.ncbi.nlm.nih.gov/20346999" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20810912", "url": "https://pubmed.ncbi.nlm.nih.gov/20810912" }, { "database": "PubMed", "id": "21084272", "url": "https://pubmed.ncbi.nlm.nih.gov/21084272" }, { "database": "PubMed", "id": "21210663", "url": "https://pubmed.ncbi.nlm.nih.gov/21210663" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21339981", "url": "https://pubmed.ncbi.nlm.nih.gov/21339981" }, { "database": "PubMed", "id": "21455220", "url": "https://pubmed.ncbi.nlm.nih.gov/21455220" }, { "database": "PubMed", "id": "21457773", "url": "https://pubmed.ncbi.nlm.nih.gov/21457773" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21769452", "url": "https://pubmed.ncbi.nlm.nih.gov/21769452" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21832239", "url": "https://pubmed.ncbi.nlm.nih.gov/21832239" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22914926", "url": "https://pubmed.ncbi.nlm.nih.gov/22914926" }, { "database": "PubMed", "id": "23414419", "url": "https://pubmed.ncbi.nlm.nih.gov/23414419" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23565200", "url": "https://pubmed.ncbi.nlm.nih.gov/23565200" }, { "database": "PubMed", "id": "23603988", "url": "https://pubmed.ncbi.nlm.nih.gov/23603988" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24286312", "url": "https://pubmed.ncbi.nlm.nih.gov/24286312" }, { "database": "PubMed", "id": "24362252", "url": "https://pubmed.ncbi.nlm.nih.gov/24362252" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24473091", "url": "https://pubmed.ncbi.nlm.nih.gov/24473091" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "25139266", "url": "https://pubmed.ncbi.nlm.nih.gov/25139266" }, { "database": "PubMed", "id": "25311616", "url": "https://pubmed.ncbi.nlm.nih.gov/25311616" }, { "database": "PubMed", "id": "25429619", "url": "https://pubmed.ncbi.nlm.nih.gov/25429619" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25633290", "url": "https://pubmed.ncbi.nlm.nih.gov/25633290" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26936915", "url": "https://pubmed.ncbi.nlm.nih.gov/26936915" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28498467", "url": "https://pubmed.ncbi.nlm.nih.gov/28498467" }, { "database": "PubMed", "id": "28878400", "url": "https://pubmed.ncbi.nlm.nih.gov/28878400" }, { "database": "PubMed", "id": "28937686", "url": "https://pubmed.ncbi.nlm.nih.gov/28937686" }, { "database": "PubMed", "id": "29033320", "url": "https://pubmed.ncbi.nlm.nih.gov/29033320" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "30096294", "url": "https://pubmed.ncbi.nlm.nih.gov/30096294" }, { "database": "PubMed", "id": "30416048", "url": "https://pubmed.ncbi.nlm.nih.gov/30416048" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30725256", "url": "https://pubmed.ncbi.nlm.nih.gov/30725256" }, { "database": "PubMed", "id": "30942456", "url": "https://pubmed.ncbi.nlm.nih.gov/30942456" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31496797", "url": "https://pubmed.ncbi.nlm.nih.gov/31496797" }, { "database": "PubMed", "id": "31617338", "url": "https://pubmed.ncbi.nlm.nih.gov/31617338" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32181328", "url": "https://pubmed.ncbi.nlm.nih.gov/32181328" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32681102", "url": "https://pubmed.ncbi.nlm.nih.gov/32681102" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863216", "url": "https://pubmed.ncbi.nlm.nih.gov/32863216" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33209651", "url": "https://pubmed.ncbi.nlm.nih.gov/33209651" }, { "database": "PubMed", "id": "33266043", "url": "https://pubmed.ncbi.nlm.nih.gov/33266043" }, { "database": "PubMed", "id": "33303565", "url": "https://pubmed.ncbi.nlm.nih.gov/33303565" }, { "database": "PubMed", "id": "34209868", "url": "https://pubmed.ncbi.nlm.nih.gov/34209868" }, { "database": "PubMed", "id": "34216619", "url": "https://pubmed.ncbi.nlm.nih.gov/34216619" }, { "database": "PubMed", "id": "35618207", "url": "https://pubmed.ncbi.nlm.nih.gov/35618207" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "35902040", "url": "https://pubmed.ncbi.nlm.nih.gov/35902040" }, { "database": "PubMed", "id": "36058261", "url": "https://pubmed.ncbi.nlm.nih.gov/36058261" }, { "database": "PubMed", "id": "36399430", "url": "https://pubmed.ncbi.nlm.nih.gov/36399430" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8956076", "url": "https://pubmed.ncbi.nlm.nih.gov/8956076" }, { "database": "PubMed", "id": "9246643", "url": "https://pubmed.ncbi.nlm.nih.gov/9246643" }, { "database": "PubMed", "id": "9254608", "url": "https://pubmed.ncbi.nlm.nih.gov/9254608" }, { "database": "PubMed", "id": "9467949", "url": "https://pubmed.ncbi.nlm.nih.gov/9467949" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9747884", "url": "https://pubmed.ncbi.nlm.nih.gov/9747884" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "22214662", "url": "https://pubmed.ncbi.nlm.nih.gov/22214662" } ], "site_lbl": "Ser392", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 392, "end_pos": 392, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2, CDK2 and NUAK1", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "11239457", "url": "https://pubmed.ncbi.nlm.nih.gov/11239457" }, { "database": "PubMed", "id": "12393879", "url": "https://pubmed.ncbi.nlm.nih.gov/12393879" }, { "database": "PubMed", "id": "16552184", "url": "https://pubmed.ncbi.nlm.nih.gov/16552184" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10559267", "url": "https://pubmed.ncbi.nlm.nih.gov/10559267" }, { "database": "PubMed", "id": "10597229", "url": "https://pubmed.ncbi.nlm.nih.gov/10597229" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10747897", "url": "https://pubmed.ncbi.nlm.nih.gov/10747897" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10884347", "url": "https://pubmed.ncbi.nlm.nih.gov/10884347" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11508859", "url": "https://pubmed.ncbi.nlm.nih.gov/11508859" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11741290", "url": "https://pubmed.ncbi.nlm.nih.gov/11741290" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "12081208", "url": "https://pubmed.ncbi.nlm.nih.gov/12081208" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12776195", "url": "https://pubmed.ncbi.nlm.nih.gov/12776195" }, { "database": "PubMed", "id": "12792782", "url": "https://pubmed.ncbi.nlm.nih.gov/12792782" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12898523", "url": "https://pubmed.ncbi.nlm.nih.gov/12898523" }, { "database": "PubMed", "id": "12937839", "url": "https://pubmed.ncbi.nlm.nih.gov/12937839" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14640983", "url": "https://pubmed.ncbi.nlm.nih.gov/14640983" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "15038834", "url": "https://pubmed.ncbi.nlm.nih.gov/15038834" }, { "database": "PubMed", "id": "15064747", "url": "https://pubmed.ncbi.nlm.nih.gov/15064747" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15709766", "url": "https://pubmed.ncbi.nlm.nih.gov/15709766" }, { "database": "PubMed", "id": "15837201", "url": "https://pubmed.ncbi.nlm.nih.gov/15837201" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "16082409", "url": "https://pubmed.ncbi.nlm.nih.gov/16082409" }, { "database": "PubMed", "id": "16299809", "url": "https://pubmed.ncbi.nlm.nih.gov/16299809" }, { "database": "PubMed", "id": "16319070", "url": "https://pubmed.ncbi.nlm.nih.gov/16319070" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16741955", "url": "https://pubmed.ncbi.nlm.nih.gov/16741955" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "17051326", "url": "https://pubmed.ncbi.nlm.nih.gov/17051326" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17180249", "url": "https://pubmed.ncbi.nlm.nih.gov/17180249" }, { "database": "PubMed", "id": "17237827", "url": "https://pubmed.ncbi.nlm.nih.gov/17237827" }, { "database": "PubMed", "id": "17341630", "url": "https://pubmed.ncbi.nlm.nih.gov/17341630" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17523842", "url": "https://pubmed.ncbi.nlm.nih.gov/17523842" }, { "database": "PubMed", "id": "17565390", "url": "https://pubmed.ncbi.nlm.nih.gov/17565390" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17966099", "url": "https://pubmed.ncbi.nlm.nih.gov/17966099" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18443131", "url": "https://pubmed.ncbi.nlm.nih.gov/18443131" }, { "database": "PubMed", "id": "18472237", "url": "https://pubmed.ncbi.nlm.nih.gov/18472237" }, { "database": "PubMed", "id": "18495777", "url": "https://pubmed.ncbi.nlm.nih.gov/18495777" }, { "database": "PubMed", "id": "18523266", "url": "https://pubmed.ncbi.nlm.nih.gov/18523266" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18718914", "url": "https://pubmed.ncbi.nlm.nih.gov/18718914" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19253369", "url": "https://pubmed.ncbi.nlm.nih.gov/19253369" }, { "database": "PubMed", "id": "19428812", "url": "https://pubmed.ncbi.nlm.nih.gov/19428812" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19834494", "url": "https://pubmed.ncbi.nlm.nih.gov/19834494" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19932175", "url": "https://pubmed.ncbi.nlm.nih.gov/19932175" }, { "database": "PubMed", "id": "20009884", "url": "https://pubmed.ncbi.nlm.nih.gov/20009884" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20234175", "url": "https://pubmed.ncbi.nlm.nih.gov/20234175" }, { "database": "PubMed", "id": "20346999", "url": "https://pubmed.ncbi.nlm.nih.gov/20346999" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20810912", "url": "https://pubmed.ncbi.nlm.nih.gov/20810912" }, { "database": "PubMed", "id": "21084272", "url": "https://pubmed.ncbi.nlm.nih.gov/21084272" }, { "database": "PubMed", "id": "21210663", "url": "https://pubmed.ncbi.nlm.nih.gov/21210663" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21339981", "url": "https://pubmed.ncbi.nlm.nih.gov/21339981" }, { "database": "PubMed", "id": "21455220", "url": "https://pubmed.ncbi.nlm.nih.gov/21455220" }, { "database": "PubMed", "id": "21457773", "url": "https://pubmed.ncbi.nlm.nih.gov/21457773" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21769452", "url": "https://pubmed.ncbi.nlm.nih.gov/21769452" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21832239", "url": "https://pubmed.ncbi.nlm.nih.gov/21832239" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22914926", "url": "https://pubmed.ncbi.nlm.nih.gov/22914926" }, { "database": "PubMed", "id": "23414419", "url": "https://pubmed.ncbi.nlm.nih.gov/23414419" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23565200", "url": "https://pubmed.ncbi.nlm.nih.gov/23565200" }, { "database": "PubMed", "id": "23603988", "url": "https://pubmed.ncbi.nlm.nih.gov/23603988" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24286312", "url": "https://pubmed.ncbi.nlm.nih.gov/24286312" }, { "database": "PubMed", "id": "24362252", "url": "https://pubmed.ncbi.nlm.nih.gov/24362252" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24473091", "url": "https://pubmed.ncbi.nlm.nih.gov/24473091" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "25139266", "url": "https://pubmed.ncbi.nlm.nih.gov/25139266" }, { "database": "PubMed", "id": "25311616", "url": "https://pubmed.ncbi.nlm.nih.gov/25311616" }, { "database": "PubMed", "id": "25429619", "url": "https://pubmed.ncbi.nlm.nih.gov/25429619" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25633290", "url": "https://pubmed.ncbi.nlm.nih.gov/25633290" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26936915", "url": "https://pubmed.ncbi.nlm.nih.gov/26936915" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28498467", "url": "https://pubmed.ncbi.nlm.nih.gov/28498467" }, { "database": "PubMed", "id": "28878400", "url": "https://pubmed.ncbi.nlm.nih.gov/28878400" }, { "database": "PubMed", "id": "28937686", "url": "https://pubmed.ncbi.nlm.nih.gov/28937686" }, { "database": "PubMed", "id": "29033320", "url": "https://pubmed.ncbi.nlm.nih.gov/29033320" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "30096294", "url": "https://pubmed.ncbi.nlm.nih.gov/30096294" }, { "database": "PubMed", "id": "30416048", "url": "https://pubmed.ncbi.nlm.nih.gov/30416048" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30725256", "url": "https://pubmed.ncbi.nlm.nih.gov/30725256" }, { "database": "PubMed", "id": "30942456", "url": "https://pubmed.ncbi.nlm.nih.gov/30942456" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31496797", "url": "https://pubmed.ncbi.nlm.nih.gov/31496797" }, { "database": "PubMed", "id": "31617338", "url": "https://pubmed.ncbi.nlm.nih.gov/31617338" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32181328", "url": "https://pubmed.ncbi.nlm.nih.gov/32181328" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32681102", "url": "https://pubmed.ncbi.nlm.nih.gov/32681102" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863216", "url": "https://pubmed.ncbi.nlm.nih.gov/32863216" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33209651", "url": "https://pubmed.ncbi.nlm.nih.gov/33209651" }, { "database": "PubMed", "id": "33266043", "url": "https://pubmed.ncbi.nlm.nih.gov/33266043" }, { "database": "PubMed", "id": "33303565", "url": "https://pubmed.ncbi.nlm.nih.gov/33303565" }, { "database": "PubMed", "id": "34209868", "url": "https://pubmed.ncbi.nlm.nih.gov/34209868" }, { "database": "PubMed", "id": "34216619", "url": "https://pubmed.ncbi.nlm.nih.gov/34216619" }, { "database": "PubMed", "id": "35618207", "url": "https://pubmed.ncbi.nlm.nih.gov/35618207" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "35902040", "url": "https://pubmed.ncbi.nlm.nih.gov/35902040" }, { "database": "PubMed", "id": "36058261", "url": "https://pubmed.ncbi.nlm.nih.gov/36058261" }, { "database": "PubMed", "id": "36399430", "url": "https://pubmed.ncbi.nlm.nih.gov/36399430" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8956076", "url": "https://pubmed.ncbi.nlm.nih.gov/8956076" }, { "database": "PubMed", "id": "9246643", "url": "https://pubmed.ncbi.nlm.nih.gov/9246643" }, { "database": "PubMed", "id": "9254608", "url": "https://pubmed.ncbi.nlm.nih.gov/9254608" }, { "database": "PubMed", "id": "9467949", "url": "https://pubmed.ncbi.nlm.nih.gov/9467949" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9747884", "url": "https://pubmed.ncbi.nlm.nih.gov/9747884" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "22214662", "url": "https://pubmed.ncbi.nlm.nih.gov/22214662" } ], "site_lbl": "Ser392", "uniprot_canonical_ac": "P04637-1" } ], "record_id": "pubmed.29033852", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rhomboid domain containing 1 promotes the growth of non-small cell lung cancer through the activation of EGFR and regulation of the BIK-mediated apoptosis.", "journal": "Neoplasma", "date": "2022", "authors": "Xu ZY, Li X, Yao RH, Yang LM, Peng H, Ren WJ, Lu H, Wang P", "reference": { "type": "PubMed", "id": "34962825", "url": "https://pubmed.ncbi.nlm.nih.gov/34962825" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13323-1", "protein_name": "Bcl-2-interacting killer", "gene_name": "BIK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13323", "url": "https://www.uniprot.org/uniprotkb/Q13323" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34962825", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bik, a novel death-inducing protein shares a distinct sequence motif with Bcl-2 family proteins and interacts with viral and cellular survival-promoting proteins.", "journal": "Oncogene", "date": "1995", "authors": "Boyd J M, Gallo G J, Elangovan B, Houghton A B, Malstrom S, Avery B J, Ebb R G, Subramanian T, Chittenden T, Lutz R J", "reference": { "type": "PubMed", "id": "7478623", "url": "https://pubmed.ncbi.nlm.nih.gov/7478623" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13323-1", "protein_name": "Bcl-2-interacting killer", "gene_name": "BIK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13323", "url": "https://www.uniprot.org/uniprotkb/Q13323" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7478623", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of apoptosis by human Nbk/Bik, a BH3-containing protein that interacts with E1B 19K.", "journal": "Mol. Cell. Biol.", "date": "1996", "authors": "Han J, Sabbatini P, White E", "reference": { "type": "PubMed", "id": "8816500", "url": "https://pubmed.ncbi.nlm.nih.gov/8816500" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13323-1", "protein_name": "Bcl-2-interacting killer", "gene_name": "BIK", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13323", "url": "https://www.uniprot.org/uniprotkb/Q13323" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8816500", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel homozygous variant of CCIN causes male infertility owing to the abnormal sperm head with a nuclear subsidence phenotype.", "journal": "Clinical genetics", "date": "2023-04", "authors": "He Jiaxin, Liu Qiang, Wang Weili, Su Lilan, Meng Lanlan, Tan Chen, Zhang Huan, Zhang Qianjun, Lu Guangxiu, Du Juan, Lin Ge, Tu Chaofeng, Tan Yue-Qiu", "reference": { "type": "PubMed", "id": "36527329", "url": "https://pubmed.ncbi.nlm.nih.gov/36527329" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13939-1", "protein_name": "Calicin", "gene_name": "CCIN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13939", "url": "https://www.uniprot.org/uniprotkb/Q13939" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36527329", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in CCIN cause teratozoospermia and male infertility.", "journal": "Science bulletin", "date": "2022-10-31", "authors": "Fan Yong, Huang Chenhui, Chen Juan, Chen Yanyan, Wang Yan, Yan Zhiguang, Yu Weina, Wu Haibo, Yang Ying, Nie Leitong, Huang Sijia, Wang Fangfang, Wang Haoyu, Hua Yunfeng, Lyu Qifeng, Kuang Yanping, Lei Ming", "reference": { "type": "PubMed", "id": "36546111", "url": "https://pubmed.ncbi.nlm.nih.gov/36546111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13939-1", "protein_name": "Calicin", "gene_name": "CCIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CDE2-1", "protein_name": "Calicin", "gene_name": "Ccin", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13939", "url": "https://www.uniprot.org/uniprotkb/Q13939" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 42, "end_pos": 42, "sequence_org": "H", "sequence_mut": "L", "comment": "Knockin homozygous animals develop normally, however males are infertile and their spermatozoa show a substantial decrease in motility; spermatozoa from homozygous males exhibit several abnormalities, including abnormal head shaping, with an increase in their length and width, apical defect of the acrosome, and nuclear lacunae devoid of chromatin, at the flagellum, mutant spermatozoa display mitochondrial sheath misassembly and coiling tail around the nucleus; may severely impair protein stability.", "evidence": [ { "database": "UniProtKB", "id": "Q8CDE2", "url": "https://www.uniprot.org/uniprotkb/Q8CDE2" }, { "database": "PubMed", "id": "36546111", "url": "https://pubmed.ncbi.nlm.nih.gov/36546111" } ], "uniprot_canonical_ac": "Q8CDE2-1" }, { "start_pos": 432, "end_pos": 432, "sequence_org": "R", "sequence_mut": "W", "comment": "Knockin homozygous animals develop normally, however males are infertile and their spermatozoa show a substantial decrease in motility; spermatozoa from homozygous males exhibit several abnormalities, including abnormal head shaping, with an increase in their length and width, apical defect of the acrosome, and nuclear lacunae devoid of chromatin, at the flagellum, mutant spermatozoa display mitochondrial sheath misassembly and coiling tail around the nucleus; when associated in trans with 447-C--I-588; may severely impair protein stability.", "evidence": [ { "database": "UniProtKB", "id": "Q8CDE2", "url": "https://www.uniprot.org/uniprotkb/Q8CDE2" }, { "database": "PubMed", "id": "36546111", "url": "https://pubmed.ncbi.nlm.nih.gov/36546111" } ], "uniprot_canonical_ac": "Q8CDE2-1" }, { "start_pos": 447, "end_pos": 588, "sequence_org": "CFDTCTGEVVQCITFPIEFNHRPLLSFHQDNILRVHSHRQSVEINLQKIKANKSTTSVPLLPNSCPLDVSHAICSIGDSKVFVCGGVTTASDVQTKDYTINPNAYLLDQKIGEWQTLACPPEALDCPACCLAKLPCKILQRI", "sequence_mut": "", "comment": "Knockin homozygous animals develop normally, however males are infertile and their spermatozoa show a substantial decrease in motility; spermatozoa from homozygous males exhibit several abnormalities, including abnormal head shaping, with an increase in their length and width, apical defect of the acrosome, and nuclear lacunae devoid of chromatin, at the flagellum, mutant spermatozoa display mitochondrial sheath misassembly and coiling tail around the nucleus; when associated in trans with W-432; may severely impair protein stability.", "evidence": [ { "database": "UniProtKB", "id": "Q8CDE2", "url": "https://www.uniprot.org/uniprotkb/Q8CDE2" }, { "database": "PubMed", "id": "36546111", "url": "https://pubmed.ncbi.nlm.nih.gov/36546111" } ], "uniprot_canonical_ac": "Q8CDE2-1" } ], "record_id": "pubmed.36546111", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular nature of calicin, a major basic protein of the mammalian sperm head cytoskeleton.", "journal": "Exp. Cell Res.", "date": "1995", "authors": "von Bulow M, Heid H, Hess H, Franke WW", "reference": { "type": "PubMed", "id": "7641791", "url": "https://pubmed.ncbi.nlm.nih.gov/7641791" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13939-1", "protein_name": "Calicin", "gene_name": "CCIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q28068-1", "protein_name": "Calicin", "gene_name": "CCIN", "tax_name": "Bovine" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13939", "url": "https://www.uniprot.org/uniprotkb/Q13939" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7641791", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chromosomal microarray mapping suggests a role for BSX and Neurogranin in neurocognitive and behavioral defects in the 11q terminal deletion disorder (Jacobsen syndrome).", "journal": "Neurogenetics", "date": "2009", "authors": "Coldren CD, Lai Z, Shragg P, Rossi E, Glidewell SC, Zuffardi O, Mattina T, Ivy DD, Curfs LM, Mattson SN, Riley EP, Treier M, Grossfeld PD", "reference": { "type": "PubMed", "id": "18855024", "url": "https://pubmed.ncbi.nlm.nih.gov/18855024" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3C1V8-1", "protein_name": "Brain-specific homeobox protein homolog", "gene_name": "BSX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3C1V8", "url": "https://www.uniprot.org/uniprotkb/Q3C1V8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18855024", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic ablation of the Bsx homeodomain transcription factor in zebrafish: Impact on mature pineal gland morphology and circadian behavior.", "journal": "Journal of pineal research", "date": "2022", "authors": "Carstensen MB, Medvetzky A, Weinberger A, Driever W, Gothilf Y, Rath MF", "reference": { "type": "PubMed", "id": "35249239", "url": "https://pubmed.ncbi.nlm.nih.gov/35249239" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q3C1V8-1", "protein_name": "Brain-specific homeobox protein homolog", "gene_name": "BSX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q3C1V8", "url": "https://www.uniprot.org/uniprotkb/Q3C1V8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35249239", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural features of heteromeric channels composed of CALHM2 and CALHM4 paralogs.", "journal": "eLife", "date": "2024-06-18", "authors": "Dro\u017cd\u017cyk Katarzyna, Peter Martina, Dutzler Raimund", "reference": { "type": "PubMed", "id": "38896440", "url": "https://pubmed.ncbi.nlm.nih.gov/38896440" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5JW98-1", "protein_name": "Calcium homeostasis modulator protein 4", "gene_name": "CALHM4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HA72-1", "protein_name": "Calcium homeostasis modulator protein 2", "gene_name": "CALHM2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5JW98", "url": "https://www.uniprot.org/uniprotkb/Q5JW98" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38896440", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ERLIN1-CHUK-CWF19L1 gene cluster influences liver fat deposition and hepatic inflammation in the NHLBI Family Heart Study.", "journal": "Atherosclerosis", "date": "2013", "authors": "Feitosa MF, Wojczynski MK, North KE, Zhang Q, Province MA, Carr JJ, Borecki IB", "reference": { "type": "PubMed", "id": "23477746", "url": "https://pubmed.ncbi.nlm.nih.gov/23477746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q69YN2-1", "protein_name": "CWF19-like protein 1", "gene_name": "CWF19L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q69YN2", "url": "https://www.uniprot.org/uniprotkb/Q69YN2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23477746", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homozygous splice mutation in CWF19L1 in a Turkish family with recessive ataxia syndrome.", "journal": "Neurology", "date": "2014", "authors": "Burns R, Majczenko K, Xu J, Peng W, Yapici Z, Dowling JJ, Li JZ, Burmeister M", "reference": { "type": "PubMed", "id": "25361784", "url": "https://pubmed.ncbi.nlm.nih.gov/25361784" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q69YN2-1", "protein_name": "CWF19-like protein 1", "gene_name": "CWF19L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5RGJ5-1", "protein_name": "CWF19-like protein 1", "gene_name": "cwf19l1", "tax_name": "Zebrafish" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q69YN2", "url": "https://www.uniprot.org/uniprotkb/Q69YN2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25361784", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the specific interactors of the human lariat RNA debranching enzyme 1 protein.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Masaki S, Yoshimoto R, Kaida D, Hata A, Satoh T, Ohno M, Kataoka N", "reference": { "type": "PubMed", "id": "25671812", "url": "https://pubmed.ncbi.nlm.nih.gov/25671812" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q69YN2-1", "protein_name": "CWF19-like protein 1", "gene_name": "CWF19L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q69YN2", "url": "https://www.uniprot.org/uniprotkb/Q69YN2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25671812", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heterozygous pathogenic variants in CWF19L1 in a Chinese family with spinocerebellar ataxia, autosomal recessive 17.", "journal": "Journal of clinical laboratory analysis", "date": "2022-12", "authors": "Ruan Miaohua, Wang Hongwei, Zhu Mianmian, Sun Rongyue, Shi Jiamin, Wang Qiu, Chen Yuan, Wang Yihong, Wang Dan", "reference": { "type": "PubMed", "id": "36357319", "url": "https://pubmed.ncbi.nlm.nih.gov/36357319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q69YN2-1", "protein_name": "CWF19-like protein 1", "gene_name": "CWF19L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q69YN2", "url": "https://www.uniprot.org/uniprotkb/Q69YN2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36357319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expansion of the phenotypic and molecular spectrum of CWF19L1-related disorder.", "journal": "Clinical genetics", "date": "2022-12-01", "authors": "Alvarez Carolina, Grimmel Mona, Ebrahimi-Fakhari Darius, Paul Victoria, Deininger Natalie, Riess Angelika, Haack Tobias, Gardella Elena, M\u00f8ller Rikke, Bayat Allan", "reference": { "type": "PubMed", "id": "36453471", "url": "https://pubmed.ncbi.nlm.nih.gov/36453471" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q69YN2-1", "protein_name": "CWF19-like protein 1", "gene_name": "CWF19L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q69YN2", "url": "https://www.uniprot.org/uniprotkb/Q69YN2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36453471", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel CWF19L1 mutations in patients with spinocerebellar ataxia, autosomal recessive 17.", "journal": "Journal of human genetics", "date": "2023-12", "authors": "Phulpagar Prashant, Holla Vikram V, Tomar Deepti, Kamble Nitish, Yadav Ravi, Pal Pramod Kumar, Muthusamy Babylakshmi", "reference": { "type": "PubMed", "id": "37752213", "url": "https://pubmed.ncbi.nlm.nih.gov/37752213" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q69YN2-1", "protein_name": "CWF19-like protein 1", "gene_name": "CWF19L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q69YN2", "url": "https://www.uniprot.org/uniprotkb/Q69YN2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37752213", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of two novel calpain large subunit genes.", "journal": "Gene", "date": "2001", "authors": "Dear T N, Boehm T", "reference": { "type": "PubMed", "id": "11675017", "url": "https://pubmed.ncbi.nlm.nih.gov/11675017" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6MZZ7-1", "protein_name": "Calpain-13", "gene_name": "CAPN13", "tax_name": "Human" }, { "uniprot_canonical_ac": "A8MX76-1", "protein_name": "Calpain-14", "gene_name": "CAPN14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6MZZ7", "url": "https://www.uniprot.org/uniprotkb/Q6MZZ7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11675017", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gene-environment interaction for hypertension among African American women across generations.", "journal": "Biological research for nursing", "date": "2010", "authors": "Taylor JY, Sun YV, Hunt SC, Kardia SL", "reference": { "type": "PubMed", "id": "20591971", "url": "https://pubmed.ncbi.nlm.nih.gov/20591971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6MZZ7-1", "protein_name": "Calpain-13", "gene_name": "CAPN13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6MZZ7", "url": "https://www.uniprot.org/uniprotkb/Q6MZZ7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20591971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivating mutations of tumor suppressor genes ABCA1 and CAPN13 in colorectal cancers.", "journal": "Pathology, research and practice", "date": "2020", "authors": "Mo HY, Choi EJ, Yoo NJ, Lee SH", "reference": { "type": "PubMed", "id": "32088085", "url": "https://pubmed.ncbi.nlm.nih.gov/32088085" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6MZZ7-1", "protein_name": "Calpain-13", "gene_name": "CAPN13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6MZZ7", "url": "https://www.uniprot.org/uniprotkb/Q6MZZ7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32088085", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A common genetic variant of FCN3/CD164L2 is associated with essential hypertension in a Chinese population.", "journal": "Clinical and experimental hypertension (New York, N.Y. : 1993)", "date": "2012", "authors": "Lu J, Li M, Zhang R, Hu C, Wang C, Jiang F, Yu W, Qin W, Tang S, Jia W", "reference": { "type": "PubMed", "id": "22471352", "url": "https://pubmed.ncbi.nlm.nih.gov/22471352" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6UWJ8-1", "protein_name": "CD164 sialomucin-like 2 protein", "gene_name": "CD164L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6UWJ8", "url": "https://www.uniprot.org/uniprotkb/Q6UWJ8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22471352", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, expression analysis, and chromosomal localization of a novel butyrophilin-like receptor.", "journal": "J. Hum. Genet.", "date": "1999", "authors": "Shibui A, Tsunoda T, Seki N, Suzuki Y, Sugano S, Sugane K", "reference": { "type": "PubMed", "id": "10429365", "url": "https://pubmed.ncbi.nlm.nih.gov/10429365" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6UXE8-1", "protein_name": "Butyrophilin-like protein 3", "gene_name": "BTNL3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6UXE8", "url": "https://www.uniprot.org/uniprotkb/Q6UXE8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10429365", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ancestry and frequency of genetic variants in the general population are confounders in the characterization of germline variants linked to cancer.", "journal": "BMC medical genetics", "date": "2020", "authors": "Bobyn A, Zarrei M, Zhu Y, Hoffman M, Brenner D, Resnick AC, Scherer SW, Gallo M", "reference": { "type": "PubMed", "id": "32375678", "url": "https://pubmed.ncbi.nlm.nih.gov/32375678" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6UXE8-1", "protein_name": "Butyrophilin-like protein 3", "gene_name": "BTNL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UX41-1", "protein_name": "Butyrophilin-like protein 8", "gene_name": "BTNL8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6UXE8", "url": "https://www.uniprot.org/uniprotkb/Q6UXE8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32375678", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Frameshift mutations of immunomodulatory BTN2A1, BTN2A2, and BTNL3 genes in colon cancers.", "journal": "Pathology, research and practice", "date": "2023-09", "authors": "Kim Jae Woong, Rim Doeun, Ann Chang Hyeok, Lee Sug Hyung", "reference": { "type": "PubMed", "id": "37634314", "url": "https://pubmed.ncbi.nlm.nih.gov/37634314" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6UXE8-1", "protein_name": "Butyrophilin-like protein 3", "gene_name": "BTNL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y259-1", "protein_name": "Choline/ethanolamine kinase", "gene_name": "CHKB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVV5-1", "protein_name": "Butyrophilin subfamily 2 member A2", "gene_name": "BTN2A2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6UXE8", "url": "https://www.uniprot.org/uniprotkb/Q6UXE8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37634314", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Basonuclin 2: an extremely conserved homolog of the zinc finger protein basonuclin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Vanhoutteghem A, Djian P", "reference": { "type": "PubMed", "id": "14988505", "url": "https://pubmed.ncbi.nlm.nih.gov/14988505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZN30-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "BNC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BMQ3-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "Bnc2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZN30", "url": "https://www.uniprot.org/uniprotkb/Q6ZN30" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14988505", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of Basonuclin2, a DNA-binding zinc-finger protein expressed in germ tissues and skin keratinocytes.", "journal": "Genomics", "date": "2004", "authors": "Romano RA, Li H, Tummala R, Maul R, Sinha S", "reference": { "type": "PubMed", "id": "15081112", "url": "https://pubmed.ncbi.nlm.nih.gov/15081112" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZN30-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "BNC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BMQ3-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "Bnc2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZN30", "url": "https://www.uniprot.org/uniprotkb/Q6ZN30" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15081112", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Basonuclins 1 and 2, whose genes share a common origin, are proteins with widely different properties and functions.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Vanhoutteghem A, Djian P", "reference": { "type": "PubMed", "id": "16891417", "url": "https://pubmed.ncbi.nlm.nih.gov/16891417" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZN30-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "BNC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01954-1", "protein_name": "Zinc finger protein basonuclin-1", "gene_name": "BNC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZN30", "url": "https://www.uniprot.org/uniprotkb/Q6ZN30" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16891417", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human basonuclin 2 gene has the potential to generate nearly 90,000 mRNA isoforms encoding over 2000 different proteins.", "journal": "Genomics", "date": "2007", "authors": "Vanhoutteghem A, Djian P", "reference": { "type": "PubMed", "id": "16942855", "url": "https://pubmed.ncbi.nlm.nih.gov/16942855" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZN30-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "BNC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZN30", "url": "https://www.uniprot.org/uniprotkb/Q6ZN30" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16942855", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Functional SNP in BNC2 Is Associated with Adolescent Idiopathic Scoliosis.", "journal": "American journal of human genetics", "date": "2015", "authors": "Ogura Y, Kou I, Miura S, Takahashi A, Xu L, Takeda K, Takahashi Y, Kono K, Kawakami N, Uno K, Ito M, Minami S, Yonezawa I, Yanagida H, Taneichi H, Zhu Z, Tsuji T, Suzuki T, Sudo H, Kotani T, Watanabe K, Hosogane N, Okada E, Iida A, Nakajima M, Sudo A, Chiba K, Hiraki Y, Toyama Y, Qiu Y, Shukunami C, Kamatani Y, Kubo M, Matsumoto M, Ikegawa S", "reference": { "type": "PubMed", "id": "26211971", "url": "https://pubmed.ncbi.nlm.nih.gov/26211971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZN30-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "BNC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZN30", "url": "https://www.uniprot.org/uniprotkb/Q6ZN30" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26211971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic characterization of the adolescent idiopathic scoliosis-associated transcriptome and regulome.", "journal": "Human molecular genetics", "date": "2021", "authors": "Makki N, Zhao J, Liu Z, Eckalbar WL, Ushiki A, Khanshour AM, Wu J, Rios J, Gray RS, Wise CA, Ahituv N", "reference": { "type": "PubMed", "id": "33179741", "url": "https://pubmed.ncbi.nlm.nih.gov/33179741" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZN30-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "BNC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZN30", "url": "https://www.uniprot.org/uniprotkb/Q6ZN30" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33179741", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional genomics uncovers the transcription factor BNC2 as required for myofibroblastic activation in fibrosis.", "journal": "Nature communications", "date": "2022", "authors": "Bobowski-Gerard M, Boulet C, Zummo FP, Dubois-Chevalier J, Gheeraert C, Bou Saleh M, Strub JM, Farce A, Ploton M, Guille L, Vandel J, Bongiovanni A, Very N, Woitrain E, Deprince A, Lalloyer F, Bauge E, Ferri L, Ntandja-Wandji LC, Cotte AK, Grangette C, Vallez E, Cianferani S, Raverdy V, Caiazzo R, Gnemmi V, Leteurtre E, Pourcet B, Paumelle R, Ravnskjaer K, Lassailly G, Haas JT, Mathurin P, Pattou F, Dubuquoy L, Staels B, Lefebvre P, Eeckhoute J", "reference": { "type": "PubMed", "id": "36088459", "url": "https://pubmed.ncbi.nlm.nih.gov/36088459" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZN30-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "BNC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZN30", "url": "https://www.uniprot.org/uniprotkb/Q6ZN30" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36088459", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Basonuclin-2 regulates extracellular matrix production and degradation.", "journal": "Life science alliance", "date": "2023-10", "authors": "Orang Ayla, Dredge B Kate, Liu Chi Yau, Bracken Julie M, Chen Chun-Hsien, Sourdin Laura, Whitfield Holly J, Lumb Rachael, Boyle Sarah T, Davis Melissa J, Samuel Michael S, Gregory Philip A, Khew-Goodall Yeesim, Goodall Gregory J, Pillman Katherine A, Bracken Cameron P", "reference": { "type": "PubMed", "id": "37536977", "url": "https://pubmed.ncbi.nlm.nih.gov/37536977" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZN30-1", "protein_name": "Zinc finger protein basonuclin-2", "gene_name": "BNC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZN30", "url": "https://www.uniprot.org/uniprotkb/Q6ZN30" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37536977", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]