[ { "title": "Upregulation of Synuclein-gamma and Snai1 Contributes to Poor Clinical Prognosis in Oral Squamous Cell Carcinoma Patients.", "journal": "BioMed research international", "date": "2022", "authors": "Yang J, Pan Y, Peng L, Zhang L, Zhao J, Zheng Z, Zheng J, Xu X, Zeng Y", "reference": { "type": "PubMed", "id": "35434126", "url": "https://pubmed.ncbi.nlm.nih.gov/35434126" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O76070-1", "protein_name": "Gamma-synuclein", "gene_name": "SNCG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O76070", "url": "https://www.uniprot.org/uniprotkb/O76070" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35434126", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gamma synuclein promotes cancer metastasis through the MKK3/6-p38MAPK cascade.", "journal": "International journal of biological sciences", "date": "2022", "authors": "Liu J, Shao T, Zhang J, Liu Q, Hua H, Zhang H, Wang J, Luo T, Shi YE, Jiang Y", "reference": { "type": "PubMed", "id": "35637967", "url": "https://pubmed.ncbi.nlm.nih.gov/35637967" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O76070-1", "protein_name": "Gamma-synuclein", "gene_name": "SNCG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O76070", "url": "https://www.uniprot.org/uniprotkb/O76070" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35637967", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effects of the Methylation Levels for the Breast Cancer Associated Genes BCSG1 and BRCA1 on Cellular Proliferation and Migration.", "journal": "Genetic testing and molecular biomarkers", "date": "2022", "authors": "Li J, Li P, Li J, Yang H, Liu G, Shen P, Jiang G", "reference": { "type": "PubMed", "id": "36166741", "url": "https://pubmed.ncbi.nlm.nih.gov/36166741" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O76070-1", "protein_name": "Gamma-synuclein", "gene_name": "SNCG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O76070", "url": "https://www.uniprot.org/uniprotkb/O76070" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36166741", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Upregulation of Parkinson's disease-associated protein alpha-synuclein suppresses tumorigenesis via interaction with mGluR5 and gamma-synuclein in liver cancer.", "journal": "Archives of biochemistry and biophysics", "date": "2023-08", "authors": "Yang Hui-Min, Cheng Yun-Zhong, Hou Tian-Zhong, Fan Jing-Kai, Gu Li, Zhang Jian-Nan, Zhang Hong", "reference": { "type": "PubMed", "id": "37487948", "url": "https://pubmed.ncbi.nlm.nih.gov/37487948" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O76070-1", "protein_name": "Gamma-synuclein", "gene_name": "SNCG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37377-1", "protein_name": "Alpha-synuclein", "gene_name": "Snca", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P31424-1", "protein_name": "Metabotropic glutamate receptor 5", "gene_name": "Grm5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63544-1", "protein_name": "Gamma-synuclein", "gene_name": "Sncg", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O76070", "url": "https://www.uniprot.org/uniprotkb/O76070" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37487948", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a breast cancer-specific gene, BCSG1, by direct differential cDNA sequencing.", "journal": "Cancer Res.", "date": "1997", "authors": "Ji H, Liu Y E, Jia T, Wang M, Liu J, Xiao G, Joseph B K, Rosen C, Shi Y E", "reference": { "type": "PubMed", "id": "9044857", "url": "https://pubmed.ncbi.nlm.nih.gov/9044857" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O76070-1", "protein_name": "Gamma-synuclein", "gene_name": "SNCG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O76070", "url": "https://www.uniprot.org/uniprotkb/O76070" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9044857", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Organization, expression and polymorphism of the human persyn gene.", "journal": "Hum. Mol. Genet.", "date": "1998", "authors": "Ninkina N N, Alimova-Kost M V, Paterson J W, Delaney L, Cohen B B, Imreh S, Gnuchev N V, Davies A M, Buchman V L", "reference": { "type": "PubMed", "id": "9700196", "url": "https://pubmed.ncbi.nlm.nih.gov/9700196" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O76070-1", "protein_name": "Gamma-synuclein", "gene_name": "SNCG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O76070", "url": "https://www.uniprot.org/uniprotkb/O76070" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9700196", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification, localization and characterization of the human gamma-synuclein gene.", "journal": "Hum. Genet.", "date": "1998", "authors": "Lavedan C, Leroy E, Dehejia A, Buchholtz S, Dutra A, Nussbaum R L, Polymeropoulos M H", "reference": { "type": "PubMed", "id": "9737786", "url": "https://pubmed.ncbi.nlm.nih.gov/9737786" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O76070-1", "protein_name": "Gamma-synuclein", "gene_name": "SNCG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O76070", "url": "https://www.uniprot.org/uniprotkb/O76070" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9737786", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tprg, a gene predominantly expressed in skin, is a direct target of the transcription factor p63.", "journal": "J. Invest. Dermatol.", "date": "2008", "authors": "Antonini D, Dentice M, Mahtani P, De Rosa L, Della Gatta G, Mandinova A, Salvatore D, Stupka E, Missero C", "reference": { "type": "PubMed", "id": "18256694", "url": "https://pubmed.ncbi.nlm.nih.gov/18256694" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZUI0-1", "protein_name": "Tumor protein p63-regulated gene 1 protein", "gene_name": "TPRG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9DBS2-1", "protein_name": "Tumor protein p63-regulated gene 1-like protein", "gene_name": "Tprg1l", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8CB49-1", "protein_name": "Tumor protein p63-regulated gene 1 protein", "gene_name": "Tprg1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZUI0", "url": "https://www.uniprot.org/uniprotkb/Q6ZUI0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18256694", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Non-replication of association for six polymorphisms from meta-analysis of genome-wide association studies of Parkinson's disease: large-scale collaborative study.", "journal": "American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics", "date": "2010", "authors": "Evangelou E, Maraganore DM, Annesi G, Brighina L, Brice A, Elbaz A, Ferrarese C, Hadjigeorgiou GM, Krueger R, Lambert JC, Lesage S, Markopoulou K, Mellick GD, Meeus B, Pedersen NL, Quattrone A, Van Broeckhoven C, Sharma M, Silburn PA, Tan EK, Wirdefeldt K, Ioannidis JP", "reference": { "type": "PubMed", "id": "19475631", "url": "https://pubmed.ncbi.nlm.nih.gov/19475631" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZUI0-1", "protein_name": "Tumor protein p63-regulated gene 1 protein", "gene_name": "TPRG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZUI0", "url": "https://www.uniprot.org/uniprotkb/Q6ZUI0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19475631", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tumor protein P63 Regulated 1 contributes to inflammation and cell proliferation of cystitis glandularis through regulating the NF-small ka, CyrillicB/cyclooxygenase-2/prostaglandin E2 axis.", "journal": "Bosnian journal of basic medical sciences", "date": "2022", "authors": "Hong T, Piao S, Sun L, Tao Y, Ke M", "reference": { "type": "PubMed", "id": "34998360", "url": "https://pubmed.ncbi.nlm.nih.gov/34998360" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZUI0-1", "protein_name": "Tumor protein p63-regulated gene 1 protein", "gene_name": "TPRG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZUI0", "url": "https://www.uniprot.org/uniprotkb/Q6ZUI0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34998360", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy", "journal": "Anal. Chem.", "date": "2017", "authors": "Qin H., Cheng K., Zhu J., Mao J., Wang F., Dong M., Chen R., Guo Z., Liang X., Ye M., Zou H.", "reference": { "type": "DOI", "id": "10.1021/acs.analchem.6b02887", "url": "https://doi.org/10.1021/acs.analchem.6b02887" }, "referenced_glycans": [ { "glytoucan_ac": "G57321FI" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04180-1", "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09666-1", "protein_name": "Neuroblast differentiation-associated protein AHNAK", "gene_name": "AHNAK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q712K3-1", "protein_name": "Ubiquitin-conjugating enzyme E2 R2", "gene_name": "UBE2R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96C57-1", "protein_name": "Protein CUSTOS", "gene_name": "C12orf43; CUSTOS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05160-1", "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04264-1", "protein_name": "Keratin, type II cytoskeletal 1", "gene_name": "KRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13201-1", "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXB8-1", "protein_name": "Peptidase inhibitor 16", "gene_name": "PI16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13790-1", "protein_name": "Apolipoprotein F", "gene_name": "APOF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02656-1", "protein_name": "Apolipoprotein C-III", "gene_name": "APOC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02649-1", "protein_name": "Apolipoprotein E", "gene_name": "APOE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07996-1", "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00450-1", "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03952-1", "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78423-1", "protein_name": "Fractalkine", "gene_name": "CX3CL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35442-1", "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02749-1", "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06727-1", "protein_name": "Apolipoprotein A-IV", "gene_name": "APOA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00747-1", "protein_name": "Plasminogen", "gene_name": "PLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02768-1", "protein_name": "Albumin", "gene_name": "ALB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02786-1", "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10643-1", "protein_name": "Complement component C7", "gene_name": "C7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01042-1", "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZP8-1", "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00748-1", "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14515-1", "protein_name": "SPARC-like protein 1", "gene_name": "SPARCL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13727-1", "protein_name": "Bone marrow proteoglycan", "gene_name": "PRG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04756-1", "protein_name": "Hepatocyte growth factor activator serine protease", "gene_name": "HGFAC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04196-1", "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25311-1", "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWG1-1", "protein_name": "Dynein axonemal intermediate chain 3", "gene_name": "DNAI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24592-1", "protein_name": "Insulin-like growth factor-binding protein 6", "gene_name": "IGFBP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUN1-1", "protein_name": "Protein MENT", "gene_name": "MENT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01023-1", "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SEGSSVNLSPPLEQCVPDR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 199, "start_aa": "Ser", "end_pos": 217, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QGPPASPTASPEPPPPE", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 424, "start_aa": "Gln", "end_pos": 440, "end_aa": "Glu", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P04180-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "MKGNVDISAPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1081, "start_aa": "Met", "end_pos": 1091, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q09666-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AQQQMTSSQK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2, "start_aa": "Ala", "end_pos": 11, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q712K3-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NNALDFVTK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 3213, "start_aa": "Asn", "end_pos": 3221, "end_aa": "Lys", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P04114-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NNALDFVTKSYNETK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3213, "start_aa": "Asn", "end_pos": 3227, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P04114-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVVQPSVGAAAGPVVPPCPGR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 341, "start_aa": "Thr", "end_pos": 361, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EKEESPQPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 134, "start_aa": "Glu", "end_pos": 142, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q96C57-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QSTLSYQEPLRT", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 650, "start_aa": "Gln", "end_pos": 661, "end_aa": "Thr", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05160-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "MSGECAPNVSVSVSTSHTTISGGGSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 493, "start_aa": "Met", "end_pos": 518, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P04264-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NQTLTSTEKAEGVVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 97, "start_aa": "Asn", "end_pos": 111, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "Q13201-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SADKVTDKTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 318, "start_aa": "Ser", "end_pos": 327, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q6UXB8-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SGVQQLIQYYQDQKDANISQPETTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 251, "start_aa": "Ser", "end_pos": 275, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q13790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SGVQQLIQYYQDQKDANISQPETTKEGLR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 251, "start_aa": "Ser", "end_pos": 279, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q13790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DANISQPETTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 265, "start_aa": "Asp", "end_pos": 275, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q13790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DANISQPETTKEGLR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 265, "start_aa": "Asp", "end_pos": 279, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q13790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DKFSEFWDLDPEVRPTSAVAA", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 79, "start_aa": "Asp", "end_pos": 99, "end_aa": "Ala", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02656-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FSEFWDLDPEVRPTSAVAA", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 81, "start_aa": "Phe", "end_pos": 99, "end_aa": "Ala", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02656-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVGS", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Thr", "end_pos": 215, "end_aa": "Ser", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01100", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VQAAVGTSAAPVPSDNH", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 301, "start_aa": "Val", "end_pos": 317, "end_aa": "His", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QQTEWQSGQR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 34, "start_aa": "Gln", "end_pos": 43, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "KVNCTTQPCPTAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2288, "start_aa": "Lys", "end_pos": 2300, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P04275-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "KVNCTTQPCPTAKAPTCGLCEVAR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2288, "start_aa": "Lys", "end_pos": 2311, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P04275-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CGACPPGYSGNGIQCTDVDECK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 572, "start_aa": "Cys", "end_pos": 593, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P07996-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EHEGAIYPDNTTDFQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 129, "start_aa": "Glu", "end_pos": 144, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EHEGAIYPDNTTDFQRADDK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 129, "start_aa": "Glu", "end_pos": 148, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NNEGTYYSPNYNPQSR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 485, "start_aa": "Asn", "end_pos": 500, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1211, "start_aa": "Gly", "end_pos": 1248, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P0C0L5-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LCNTGDNSVCTTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Leu", "end_pos": 386, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P03952-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LCNTGDNSVCTTKTSTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Leu", "end_pos": 390, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P03952-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RVEDLHVGATVAPSSRR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 30, "start_aa": "Arg", "end_pos": 46, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05154-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VEDLHVGATVAPSSR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 31, "start_aa": "Val", "end_pos": 45, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05154-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ASSNPNATSSSSQDPESLQDR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 20, "start_aa": "Ala", "end_pos": 40, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ASSNPNATSSSSQDPESLQDRGEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 20, "start_aa": "Ala", "end_pos": 44, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GEGKVATTVISK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 41, "start_aa": "Gly", "end_pos": 52, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VATTVISK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 45, "start_aa": "Val", "end_pos": 52, "end_aa": "Lys", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "MLFVEPILEVSSLPTTNSTTNSATK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Met", "end_pos": 77, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AQDGGPVGTELFR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 175, "start_aa": "Ala", "end_pos": 187, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P78423-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CPEPKSCDTPPPCPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 114, "start_aa": "Cys", "end_pos": 128, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CPEPKSCDTPPPCPRCPEPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 114, "start_aa": "Cys", "end_pos": 133, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SCDTPPPCPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 119, "start_aa": "Ser", "end_pos": 128, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SCDTPPPCPRCPEPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 119, "start_aa": "Ser", "end_pos": 133, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SCDTPPPCPRCPEPKSCDTPPPCPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 119, "start_aa": "Ser", "end_pos": 143, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "His", "end_pos": 126, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "KGCQQGQGAEINAISENTETLR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 224, "start_aa": "Lys", "end_pos": 245, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P35442-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QYVDGDQCESNPCLNGGSCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Gln", "end_pos": 109, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00740-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TCPKPDDLPFSTVVPLK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 22, "start_aa": "Thr", "end_pos": 38, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ENADSLQASLRPHADELK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 170, "start_aa": "Glu", "end_pos": 187, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P06727-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CTTPPPSSGPTYQCLK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 262, "start_aa": "Cys", "end_pos": 277, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00747-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 349, "start_aa": "Ile", "end_pos": 386, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00747-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TCVADESAENCDK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 76, "start_aa": "Thr", "end_pos": 88, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02768-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LAGTESPVREEPGEDFPAAR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 101, "start_aa": "Leu", "end_pos": 120, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02786-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CVQKENPLTQAVPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 688, "start_aa": "Cys", "end_pos": 701, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P10643-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CVQKENPLTQAVPKCQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 688, "start_aa": "Cys", "end_pos": 704, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P10643-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ENPLTQAVPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 692, "start_aa": "Glu", "end_pos": 701, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P10643-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SSSPELSEMLEYDR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 1148, "start_aa": "Ser", "end_pos": 1161, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01011", "uniprot_canonical_ac": "P12259-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FTVNNLAEPQKAPSHQQATTAGSPLR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 786, "start_aa": "Phe", "end_pos": 811, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P12259-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "APSHQQATTAGSPLR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 797, "start_aa": "Ala", "end_pos": 811, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P12259-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IGEIKEETTVSPPHTSMAPAQDEER", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 393, "start_aa": "Ile", "end_pos": 417, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IGEIKEETTVSPPHTSMAPAQDEERDSGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 393, "start_aa": "Ile", "end_pos": 421, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EETTVSPPHTSMAPAQDEER", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 398, "start_aa": "Glu", "end_pos": 417, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EETTVSPPHTSMAPAQDEERDSGKEQGHTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 398, "start_aa": "Glu", "end_pos": 427, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DSGKEQGHTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 418, "start_aa": "Asp", "end_pos": 427, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TEHLASSSEDSTTPSAQTQEK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 521, "start_aa": "Thr", "end_pos": 541, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SVSEINPTTQMK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 621, "start_aa": "Ser", "end_pos": 632, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VQNHCQEPYYQAAAAGALTCATPGTWK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 191, "start_aa": "Val", "end_pos": 217, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q9NZP8-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NNATVHEQVGGPSLTSDLQAQSK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 107, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LSWEYCDLAQCQTPTQAAPPTPVSPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 285, "start_aa": "Leu", "end_pos": 310, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00748-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 311, "start_aa": "Leu", "end_pos": 344, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00748-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TPPQSQTPGALPAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 331, "start_aa": "Thr", "end_pos": 344, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00748-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TPPQSQTPGALPAKR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 331, "start_aa": "Thr", "end_pos": 345, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00748-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QEEDNTQSDDILEESDQPTQVSK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 233, "start_aa": "Gln", "end_pos": 255, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q14515-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VHENENIGTTEPGEHQEAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Val", "end_pos": 408, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q14515-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QSTNAYPDLR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 102, "start_aa": "Gln", "end_pos": 111, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P07225-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SETSTFETPLGAK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 21, "start_aa": "Ser", "end_pos": 33, "end_aa": "Lys", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P13727-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AVPSSSSPQAQALTEDGRPCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Ala", "end_pos": 109, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q04756-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NGTGHGNSTHHGPEYMR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 240, "start_aa": "Asn", "end_pos": 256, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SSTTKPPFKPHGSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Ser", "end_pos": 284, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SSTTKPPFKPHGSRDHHHPHKPHEHGPPPPPDER", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Ser", "end_pos": 304, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GGETAQSADPQWEQLNNK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 31, "start_aa": "Gly", "end_pos": 48, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05546-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VQWKVDNALQSGNSQESVTEQDSK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 39, "start_aa": "Val", "end_pos": 62, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P01834-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DIVEYYNDSNGSHVLQGR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asp", "end_pos": 120, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P25311-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "WTYPKNATTQYYPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 247, "start_aa": "Trp", "end_pos": 260, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q8IWG1-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ESKPQAGTARPQDVNR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 119, "start_aa": "Glu", "end_pos": 134, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P24592-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ESKPQAGTARPQDVNRR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 119, "start_aa": "Glu", "end_pos": 135, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P24592-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SSPSLPPASPCPALAFWK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Ser", "end_pos": 313, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q9BUN1-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LLLQQVSLPELPGEYSMK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1298, "start_aa": "Leu", "end_pos": 1315, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ATEHLSTLSEK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 220, "start_aa": "Ala", "end_pos": 230, "end_aa": "Lys", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02647-1" } ], "record_id": "doi.10.1021/acs.analchem.6b02887", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 51 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 88 }, { "field": "total_sites", "count": 88 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 88 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 88 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 88 }, { "field": "exact_o_linked_sites", "count": 88 }, { "field": "exact_o_linked_glycan_sites", "count": 88 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 88 }, { "field": "total_sites", "count": 88 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 88 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 88 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 88 }, { "field": "exact_o_linked_sites", "count": 88 }, { "field": "exact_o_linked_glycan_sites", "count": 88 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unexpected crucial role of residue 225 in serine proteases.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1999", "authors": "Guinto E R, Caccia S, Rose T, F\u00fctterer K, Waksman G, Di Cera E", "reference": { "type": "PubMed", "id": "10051558", "url": "https://pubmed.ncbi.nlm.nih.gov/10051558" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10051558", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vitamin K-dependent biosynthesis of gamma-carboxyglutamic acid.", "journal": "Blood", "date": "1999", "authors": "Furie B, Bouchard BA, Furie BC", "reference": { "type": "PubMed", "id": "10068650", "url": "https://pubmed.ncbi.nlm.nih.gov/10068650" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02818-1", "protein_name": "Osteocalcin", "gene_name": "BGLAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38435-1", "protein_name": "Vitamin K-dependent gamma-carboxylase", "gene_name": "GGCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22891-1", "protein_name": "Vitamin K-dependent protein Z", "gene_name": "PROZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08709-1", "protein_name": "Coagulation factor VII", "gene_name": "F7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10068650", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of single-nucleotide polymorphisms in coding regions of human genes.", "journal": "Nature genetics", "date": "1999", "authors": "Cargill M, Altshuler D, Ireland J, Sklar P, Ardlie K, Patil N, Shaw N, Lane CR, Lim EP, Kalyanaraman N, Nemesh J, Ziaugra L, Friedland L, Rolfe A, Warrington J, Lipshutz R, Daley GQ, Lander ES", "reference": { "type": "PubMed", "id": "10391209", "url": "https://pubmed.ncbi.nlm.nih.gov/10391209" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02671-1", "protein_name": "Fibrinogen alpha chain", "gene_name": "FGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04150-1", "protein_name": "Glucocorticoid receptor", "gene_name": "NR3C1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98155-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "VLDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10646-1", "protein_name": "Tissue factor pathway inhibitor", "gene_name": "TFPI", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21964-1", "protein_name": "Catechol O-methyltransferase", "gene_name": "COMT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02679-1", "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05160-1", "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01148-1", "protein_name": "Progonadoliberin-1", "gene_name": "GNRH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17677-1", "protein_name": "Neuromodulin", "gene_name": "GAP43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25116-1", "protein_name": "Proteinase-activated receptor 1", "gene_name": "F2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P26441-1", "protein_name": "Ciliary neurotrophic factor", "gene_name": "CNTF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01138-1", "protein_name": "Beta-nerve growth factor", "gene_name": "NGF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31645-1", "protein_name": "Sodium-dependent serotonin transporter", "gene_name": "SLC6A4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04278-1", "protein_name": "Sex hormone-binding globulin", "gene_name": "SHBG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10912-1", "protein_name": "Growth hormone receptor", "gene_name": "GHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09172-1", "protein_name": "Dopamine beta-hydroxylase", "gene_name": "DBH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15538-1", "protein_name": "Cytochrome P450 11B1, mitochondrial", "gene_name": "CYP11B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16671-1", "protein_name": "Platelet glycoprotein 4", "gene_name": "CD36", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11597-1", "protein_name": "Cholesteryl ester transfer protein", "gene_name": "CETP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20151-1", "protein_name": "Kallikrein-2", "gene_name": "KLK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40238-1", "protein_name": "Thrombopoietin receptor", "gene_name": "MPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08514-1", "protein_name": "Integrin alpha-IIb", "gene_name": "ITGA2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P21918-1", "protein_name": "D(1B) dopamine receptor", "gene_name": "DRD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28221-1", "protein_name": "5-hydroxytryptamine receptor 1D", "gene_name": "HTR1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28223-1", "protein_name": "5-hydroxytryptamine receptor 2A", "gene_name": "HTR2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28335-1", "protein_name": "5-hydroxytryptamine receptor 2C", "gene_name": "HTR2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23945-1", "protein_name": "Follicle-stimulating hormone receptor", "gene_name": "FSHR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14060-1", "protein_name": "3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1", "gene_name": "HSD3B1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05090-1", "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12429-1", "protein_name": "Annexin A3", "gene_name": "ANXA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01130-1", "protein_name": "Low-density lipoprotein receptor", "gene_name": "LDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20711-1", "protein_name": "Aromatic-L-amino-acid decarboxylase", "gene_name": "DDC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08686-1", "protein_name": "Steroid 21-hydroxylase", "gene_name": "CYP21A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01241-1", "protein_name": "Somatotropin", "gene_name": "CSH1; CSH2; GH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05108-1", "protein_name": "Cholesterol side-chain cleavage enzyme, mitochondrial", "gene_name": "CYP11A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02675-1", "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05106-1", "protein_name": "Integrin beta-3", "gene_name": "ITGB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01225-1", "protein_name": "Follitropin subunit beta", "gene_name": "FSHB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23560-1", "protein_name": "Neurotrophic factor BDNF precursor form", "gene_name": "BDNF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19099-1", "protein_name": "Cytochrome P450 11B2, mitochondrial", "gene_name": "CYP11B2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05120-1", "protein_name": "Plasminogen activator inhibitor 2", "gene_name": "SERPINB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04035-1", "protein_name": "3-hydroxy-3-methylglutaryl-coenzyme A reductase", "gene_name": "HMGCR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25105-1", "protein_name": "Platelet-activating factor receptor", "gene_name": "PTAFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24557-1", "protein_name": "Thromboxane-A synthase", "gene_name": "TBXAS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04629-1", "protein_name": "High affinity nerve growth factor receptor", "gene_name": "NTRK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35462-1", "protein_name": "D(3) dopamine receptor", "gene_name": "DRD3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01959-1", "protein_name": "Sodium-dependent dopamine transporter", "gene_name": "SLC6A3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05019-1", "protein_name": "Insulin-like growth factor 1", "gene_name": "IGF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11150-1", "protein_name": "Hepatic triacylglycerol lipase", "gene_name": "LIPC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16109-1", "protein_name": "P-selectin", "gene_name": "SELP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06858-1", "protein_name": "Lipoprotein lipase", "gene_name": "LPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29120-1", "protein_name": "Neuroendocrine convertase 1", "gene_name": "PCSK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00488-1", "protein_name": "Coagulation factor XIII A chain", "gene_name": "F13A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08709-1", "protein_name": "Coagulation factor VII", "gene_name": "F7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07101-1", "protein_name": "Tyrosine 3-monooxygenase", "gene_name": "TH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29274-1", "protein_name": "Adenosine receptor A2a", "gene_name": "ADORA2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28566-1", "protein_name": "5-hydroxytryptamine receptor 1E", "gene_name": "HTR1E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05121-1", "protein_name": "Plasminogen activator inhibitor 1", "gene_name": "SERPINE1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10391209", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 66 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The vitamin K-dependent carboxylase.", "journal": "The Journal of nutrition", "date": "2000", "authors": "Berkner KL", "reference": { "type": "PubMed", "id": "10917896", "url": "https://pubmed.ncbi.nlm.nih.gov/10917896" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02818-1", "protein_name": "Osteocalcin", "gene_name": "BGLAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38435-1", "protein_name": "Vitamin K-dependent gamma-carboxylase", "gene_name": "GGCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22891-1", "protein_name": "Vitamin K-dependent protein Z", "gene_name": "PROZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08709-1", "protein_name": "Coagulation factor VII", "gene_name": "F7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10917896", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three ways to make a vesicle.", "journal": "Nature reviews. Molecular cell biology", "date": "2000", "authors": "Kirchhausen T", "reference": { "type": "PubMed", "id": "11252894", "url": "https://pubmed.ncbi.nlm.nih.gov/11252894" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02818-1", "protein_name": "Osteocalcin", "gene_name": "BGLAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22891-1", "protein_name": "Vitamin K-dependent protein Z", "gene_name": "PROZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08709-1", "protein_name": "Coagulation factor VII", "gene_name": "F7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11252894", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Model for a factor IX activation complex on blood platelets: dimeric conformation of factor XIa is essential.", "journal": "Blood", "date": "2001", "authors": "Gailani D, Ho D, Sun MF, Cheng Q, Walsh PN", "reference": { "type": "PubMed", "id": "11342438", "url": "https://pubmed.ncbi.nlm.nih.gov/11342438" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11342438", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of human alpha-thrombin by a phosphonate tripeptide proceeds via a metastable pentacoordinated phosphorus intermediate.", "journal": "J. Mol. Biol.", "date": "2001", "authors": "Skordalakes E, Dodson G G, Green D S, Goodwin C A, Scully M F, Hudson H R, Kakkar V V, Deadman J J", "reference": { "type": "PubMed", "id": "11493008", "url": "https://pubmed.ncbi.nlm.nih.gov/11493008" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11493008", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Thrombophilic gene mutations and recurrent spontaneous abortion: prothrombin mutation increases the risk in the first trimester.", "journal": "Am. J. Reprod. Immunol.", "date": "2001", "authors": "Pihusch R, Buchholz T, Lohse P, R\u00fcbsamen H, Rogenhofer N, Hasbargen U, Hiller E, Thaler C J", "reference": { "type": "PubMed", "id": "11506076", "url": "https://pubmed.ncbi.nlm.nih.gov/11506076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11506076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tethered processivity of the vitamin K-dependent carboxylase: factor IX is efficiently modified in a mechanism which distinguishes Gla's from Glu's and which accounts for comprehensive carboxylation in vivo.", "journal": "Biochemistry", "date": "2001", "authors": "Stenina O, Pudota BN, McNally BA, Hommema EL, Berkner KL", "reference": { "type": "PubMed", "id": "11513608", "url": "https://pubmed.ncbi.nlm.nih.gov/11513608" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02818-1", "protein_name": "Osteocalcin", "gene_name": "BGLAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38435-1", "protein_name": "Vitamin K-dependent gamma-carboxylase", "gene_name": "GGCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22891-1", "protein_name": "Vitamin K-dependent protein Z", "gene_name": "PROZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08709-1", "protein_name": "Coagulation factor VII", "gene_name": "F7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11513608", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epitope mapping of a monoclonal antibody against human thrombin by H/D-exchange mass spectrometry reveals selection of a diverse sequence in a highly conserved protein.", "journal": "Protein science : a publication of the Protein Society", "date": "2002-06", "authors": "Baerga-Ortiz Abel, Hughes Carrie A, Mandell Jeffrey G, Komives Elizabeth A", "reference": { "type": "PubMed", "id": "12021429", "url": "https://pubmed.ncbi.nlm.nih.gov/12021429" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12021429", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the GpIbalpha-thrombin complex essential for platelet aggregation.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Dumas JJ, Kumar R, Seehra J, Somers WS, Mosyak L", "reference": { "type": "PubMed", "id": "12855811", "url": "https://pubmed.ncbi.nlm.nih.gov/12855811" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02452-1", "protein_name": "Collagen alpha-1(I) chain", "gene_name": "COL1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40238-1", "protein_name": "Thrombopoietin receptor", "gene_name": "MPL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08123-1", "protein_name": "Collagen alpha-2(I) chain", "gene_name": "COL1A2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40225-1", "protein_name": "Thrombopoietin", "gene_name": "THPO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12855811", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Detection of a single base substitution of the gene for prothrombin Tokushima. The application of PCR-SSCP for the genetic and molecular analysis of dysprothrombinemia.", "journal": "International journal of hematology", "date": "1992", "authors": "Iwahana H, Yoshimoto K, Shigekiyo T, Shirakami A, Saito S, Itakura M", "reference": { "type": "PubMed", "id": "1349838", "url": "https://pubmed.ncbi.nlm.nih.gov/1349838" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs387906522", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387906522" }, { "id": "1349838", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1349838" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 155, "end_pos": 155, "sequence_org": "N", "sequence_mut": "*", "comment": "Germline mutation passed 1 filters: n-glyco-sequon-loss (NFC->*FC).", "chr_id": "11", "chr_pos": "46723421_46723422i", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N155", "disease": [ { "disease_id": "DOID:2235", "recommended_name": { "id": "DOID:2235", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2235", "name": "prothrombin deficiency", "description": "A thrombophilia that is characterized by bleeding symptoms due to low levels of circulating prothrombin, and has_material_basis_in autosomal recessive inheritance of homozygous or compound heterozygous mutation in the gene encoding coagulation factor II, also known as prothrombin, on chromosome 11p11." }, "synonyms": [ { "id": "DOID:2235", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2235", "name": "hypoprothrombinemia", "description": "" }, { "id": "DOID:2235", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2235", "name": "Congenital factor II deficiency", "description": "" }, { "id": "DOID:2235", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2235", "name": "Hereditary factor II deficiency disease", "description": "" }, { "id": "MONDO:0013361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013361", "name": "congenital prothrombin deficiency", "description": "Congenital factor II deficiency is an inherited bleeding disorder due to reduced activity of factor II (FII, prothrombin) and characterized by mucocutaneous bleeding symptoms." }, { "id": "MONDO:0013361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013361", "name": "factor 2 deficiency", "description": "" }, { "id": "MONDO:0013361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013361", "name": "factor II deficiency", "description": "" }, { "id": "MONDO:0013361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013361", "name": "hypoprothrombinemia", "description": "" }, { "id": "MONDO:0013361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013361", "name": "prothrombin deficiency", "description": "" }, { "id": "MONDO:0013361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013361", "name": "Dysprothrombinemia", "description": "" }, { "id": "MONDO:0013361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013361", "name": "congenital prothrombin deficiency", "description": "" }, { "id": "MONDO:0013361", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013361", "name": "hereditary prothrombin deficiency", "description": "" }, { "id": "MIM:613679", "resource": "MIM", "url": "https://www.omim.org/entry/613679", "name": "Factor II deficiency", "description": "Factor II deficiency" } ], "unlinked_id_list": [], "evidence": [ { "id": "2235", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2235" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "001000000000000000000.00010000000000.000000000001000000.01001.10.010.010", "uniprot_canonical_ac": "P00734-1" } ], "record_id": "pubmed.1349838", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prothrombin Salakta: substitution of glutamic acid-466 by alanine reduces the fibrinogen clotting activity and the esterase activity.", "journal": "Biochemistry", "date": "1992", "authors": "Miyata T, Aruga R, Umeyama H, Bezeaud A, Guillin MC, Iwanaga S", "reference": { "type": "PubMed", "id": "1354985", "url": "https://pubmed.ncbi.nlm.nih.gov/1354985" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1354985", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prothrombin Himi: a compound heterozygote for two dysfunctional prothrombin molecules (Met-337-->Thr and Arg-388-->His).", "journal": "Blood", "date": "1992", "authors": "Morishita E, Saito M, Kumabashiri I, Asakura H, Matsuda T, Yamaguchi K", "reference": { "type": "PubMed", "id": "1421398", "url": "https://pubmed.ncbi.nlm.nih.gov/1421398" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1421398", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prothrombin Shanghai: hypoprothrombinaemia caused by substitution of Gla29 by Gly.", "journal": "Haemophilia : the official journal of the World Federation of Hemophilia", "date": "2004", "authors": "Wang W, Fu Q, Zhou R, Wu W, Ding Q, Hu Y, Wang X, Wang H, Wang Z", "reference": { "type": "PubMed", "id": "14962227", "url": "https://pubmed.ncbi.nlm.nih.gov/14962227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14962227", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Meta-analysis of genetic studies in ischemic stroke: thirty-two genes involving approximately 18,000 cases and 58,000 controls.", "journal": "Arch. Neurol.", "date": "2004", "authors": "Casas Juan P, Hingorani Aroon D, Bautista Leonelo E, Sharma Pankaj", "reference": { "type": "PubMed", "id": "15534175", "url": "https://pubmed.ncbi.nlm.nih.gov/15534175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42898-1", "protein_name": "Methylenetetrahydrofolate reductase (NADPH)", "gene_name": "MTHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12821-1", "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15534175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Thrombin-catalyzed activation of factor VIII with His substituted for Arg372 at the P1 site.", "journal": "Blood", "date": "2005", "authors": "Nogami K, Zhou Q, Wakabayashi H, Fay PJ", "reference": { "type": "PubMed", "id": "15705787", "url": "https://pubmed.ncbi.nlm.nih.gov/15705787" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15705787", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "rhBMP-2, rhVEGF(165), rhPTN and thrombin-related peptide, TP508 induce chemotaxis of human osteoblasts and microvascular endothelial cells.", "journal": "J. Orthop. Res.", "date": "2005", "authors": "Li Gang, Cui Yuxin, McIlmurray Lisa, Allen William E, Wang Hali", "reference": { "type": "PubMed", "id": "15885491", "url": "https://pubmed.ncbi.nlm.nih.gov/15885491" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15885491", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protease-activated receptors in hemostasis, thrombosis and vascular biology.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2005", "authors": "Coughlin SR", "reference": { "type": "PubMed", "id": "16102047", "url": "https://pubmed.ncbi.nlm.nih.gov/16102047" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50148-1", "protein_name": "Guanine nucleotide-binding protein G(q) subunit alpha", "gene_name": "GNAQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03113-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-12", "gene_name": "GNA12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25116-1", "protein_name": "Proteinase-activated receptor 1", "gene_name": "F2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14344-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-13", "gene_name": "GNA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RI0-1", "protein_name": "Proteinase-activated receptor 4", "gene_name": "F2RL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95837-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-14", "gene_name": "GNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32121-1", "protein_name": "Beta-arrestin-2", "gene_name": "ARRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49407-1", "protein_name": "Beta-arrestin-1", "gene_name": "ARRB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00254-1", "protein_name": "Proteinase-activated receptor 3", "gene_name": "F2RL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29992-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-11", "gene_name": "GNA11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30679-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-15", "gene_name": "GNA15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16102047", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Opposing effects of beta-arrestin1 and beta-arrestin2 on activation and degradation of Src induced by protease-activated receptor 1.", "journal": "Cellular signalling", "date": "2006", "authors": "Kuo FT, Lu TL, Fu HW", "reference": { "type": "PubMed", "id": "16580177", "url": "https://pubmed.ncbi.nlm.nih.gov/16580177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50148-1", "protein_name": "Guanine nucleotide-binding protein G(q) subunit alpha", "gene_name": "GNAQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03113-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-12", "gene_name": "GNA12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25116-1", "protein_name": "Proteinase-activated receptor 1", "gene_name": "F2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14344-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-13", "gene_name": "GNA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RI0-1", "protein_name": "Proteinase-activated receptor 4", "gene_name": "F2RL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95837-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-14", "gene_name": "GNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32121-1", "protein_name": "Beta-arrestin-2", "gene_name": "ARRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49407-1", "protein_name": "Beta-arrestin-1", "gene_name": "ARRB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00254-1", "protein_name": "Proteinase-activated receptor 3", "gene_name": "F2RL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29992-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-11", "gene_name": "GNA11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30679-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-15", "gene_name": "GNA15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16580177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a functional thrombin receptor reveals a novel proteolytic mechanism of receptor activation.", "journal": "Cell", "date": "1991", "authors": "Vu TK, Hung DT, Wheaton VI, Coughlin SR", "reference": { "type": "PubMed", "id": "1672265", "url": "https://pubmed.ncbi.nlm.nih.gov/1672265" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50148-1", "protein_name": "Guanine nucleotide-binding protein G(q) subunit alpha", "gene_name": "GNAQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03113-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-12", "gene_name": "GNA12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25116-1", "protein_name": "Proteinase-activated receptor 1", "gene_name": "F2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14344-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-13", "gene_name": "GNA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RI0-1", "protein_name": "Proteinase-activated receptor 4", "gene_name": "F2RL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95837-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-14", "gene_name": "GNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32121-1", "protein_name": "Beta-arrestin-2", "gene_name": "ARRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49407-1", "protein_name": "Beta-arrestin-1", "gene_name": "ARRB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00254-1", "protein_name": "Proteinase-activated receptor 3", "gene_name": "F2RL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29992-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-11", "gene_name": "GNA11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30679-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-15", "gene_name": "GNA15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1672265", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multipolar interactions in the D pocket of thrombin: large differences between tricyclic imide and lactam inhibitors.", "journal": "Org. Biomol. Chem.", "date": "2006", "authors": "Schweizer Eliane, Hoffmann-R\u00f6der Anja, Olsen Jacob A, Seiler Paul, Obst-Sander Ulrike, Wagner Bj\u00f6rn, Kansy Manfred, Banner David W, Diederich Fran\u00e7ois", "reference": { "type": "PubMed", "id": "16763681", "url": "https://pubmed.ncbi.nlm.nih.gov/16763681" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16763681", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Thrombin peptide Chrysalin stimulates healing of diabetic foot ulcers in a placebo-controlled phase I/II study.", "journal": "Wound Repair Regen.", "date": "2007", "authors": "Fife Caroline, Mader Jon T, Stone Jeffery, Brill Leon, Satterfield Kathleen, Norfleet Andrea, Zwernemann Amber, Ryaby James T, Carney Darrell H", "reference": { "type": "PubMed", "id": "17244316", "url": "https://pubmed.ncbi.nlm.nih.gov/17244316" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17244316", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of a biosynthetic sulfo-hirudin complexed to thrombin.", "journal": "J. Am. Chem. Soc.", "date": "2007", "authors": "Liu Chang C, Brustad Eric, Liu Wenshe, Schultz Peter G", "reference": { "type": "PubMed", "id": "17685615", "url": "https://pubmed.ncbi.nlm.nih.gov/17685615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17685615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure-based design of novel groups for use in the P1 position of thrombin inhibitor scaffolds. Part 2: N-acetamidoimidazoles.", "journal": "Bioorg. Med. Chem. Lett.", "date": "2008", "authors": "Isaacs Richard C A, Solinsky Mark G, Cutrona Kellie J, Newton Christina L, Naylor-Olsen Adel M, McMasters Daniel R, Krueger Julie A, Lewis S Dale, Lucas Bobby J, Kuo Lawrence C, Yan Youwei, Lynch J J, Lyle E A", "reference": { "type": "PubMed", "id": "18291642", "url": "https://pubmed.ncbi.nlm.nih.gov/18291642" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18291642", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis of thrombin recognition by protein C inhibitor revealed by the 1.6-A structure of the heparin-bridged complex.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2008", "authors": "Li W, Adams TE, Nangalia J, Esmon CT, Huntington JA", "reference": { "type": "PubMed", "id": "18362344", "url": "https://pubmed.ncbi.nlm.nih.gov/18362344" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9N2I2-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Bovine" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 253, "end_pos": 253, "sequence_org": "R", "sequence_mut": "E", "comment": "Inhibits strongly thrombomodulin-enhanced rate of thrombin inhibition in presence of heparin.", "evidence": [ { "database": "UniProtKB", "id": "P05154", "url": "https://www.uniprot.org/uniprotkb/P05154" }, { "database": "PubMed", "id": "18362344", "url": "https://pubmed.ncbi.nlm.nih.gov/18362344" } ], "uniprot_canonical_ac": "P05154-1" }, { "start_pos": 272, "end_pos": 272, "sequence_org": "E", "sequence_mut": "K", "comment": "Does not inhibit thrombomodulin-enhanced rate of thrombin inhibition in presence of heparin.", "evidence": [ { "database": "UniProtKB", "id": "P05154", "url": "https://www.uniprot.org/uniprotkb/P05154" }, { "database": "PubMed", "id": "18362344", "url": "https://pubmed.ncbi.nlm.nih.gov/18362344" } ], "uniprot_canonical_ac": "P05154-1" }, { "start_pos": 274, "end_pos": 274, "sequence_org": "K", "sequence_mut": "E", "comment": "Does not inhibit thrombomodulin-enhanced rate of thrombin inhibition in presence of heparin.", "evidence": [ { "database": "UniProtKB", "id": "P05154", "url": "https://www.uniprot.org/uniprotkb/P05154" }, { "database": "PubMed", "id": "18362344", "url": "https://pubmed.ncbi.nlm.nih.gov/18362344" } ], "uniprot_canonical_ac": "P05154-1" }, { "start_pos": 285, "end_pos": 285, "sequence_org": "K", "sequence_mut": "E", "comment": "Does not change the rate of thrombin or activated protein C/F5 inhibition in the presence or absence of heparin. Slightly reduces the rate of thrombin inhibition in the presence of heparin. Does not inhibit thrombomodulin-enhanced rate of thrombin inhibition in presence of heparin.", "evidence": [ { "database": "UniProtKB", "id": "P05154", "url": "https://www.uniprot.org/uniprotkb/P05154" }, { "database": "PubMed", "id": "18362344", "url": "https://pubmed.ncbi.nlm.nih.gov/18362344" }, { "database": "PubMed", "id": "18974053", "url": "https://pubmed.ncbi.nlm.nih.gov/18974053" } ], "uniprot_canonical_ac": "P05154-1" }, { "start_pos": 288, "end_pos": 288, "sequence_org": "R", "sequence_mut": "E", "comment": "Does not change the rate of thrombin or activated protein C/F5 inhibition in the presence or absence of heparin. Slightly reduces the rate of thrombin inhibition in the presence of heparin. Does not inhibit thrombomodulin-enhanced rate of thrombin inhibition in presence of heparin.", "evidence": [ { "database": "UniProtKB", "id": "P05154", "url": "https://www.uniprot.org/uniprotkb/P05154" }, { "database": "PubMed", "id": "18362344", "url": "https://pubmed.ncbi.nlm.nih.gov/18362344" }, { "database": "PubMed", "id": "18974053", "url": "https://pubmed.ncbi.nlm.nih.gov/18974053" } ], "uniprot_canonical_ac": "P05154-1" }, { "start_pos": 289, "end_pos": 289, "sequence_org": "K", "sequence_mut": "E", "comment": "Does not change the rate of thrombin or activated protein C/F5 inhibition in the presence or absence of heparin. Slightly reduces the rate of thrombin inhibition in the presence of heparin. Inhibits weakly thrombomodulin-enhanced rate of thrombin inhibition in presence of heparin.", "evidence": [ { "database": "UniProtKB", "id": "P05154", "url": "https://www.uniprot.org/uniprotkb/P05154" }, { "database": "PubMed", "id": "18362344", "url": "https://pubmed.ncbi.nlm.nih.gov/18362344" }, { "database": "PubMed", "id": "18974053", "url": "https://pubmed.ncbi.nlm.nih.gov/18974053" } ], "uniprot_canonical_ac": "P05154-1" }, { "start_pos": 292, "end_pos": 292, "sequence_org": "K", "sequence_mut": "E", "comment": "Does not change the rate of thrombin or activated protein C/F5 inhibition in the presence or absence of heparin. Slightly reduces the rate of thrombin inhibition in the presence of heparin. Does not inhibit thrombomodulin-enhanced rate of thrombin inhibition in presence of heparin.", "evidence": [ { "database": "UniProtKB", "id": "P05154", "url": "https://www.uniprot.org/uniprotkb/P05154" }, { "database": "PubMed", "id": "18362344", "url": "https://pubmed.ncbi.nlm.nih.gov/18362344" }, { "database": "PubMed", "id": "18974053", "url": "https://pubmed.ncbi.nlm.nih.gov/18974053" } ], "uniprot_canonical_ac": "P05154-1" }, { "start_pos": 381, "end_pos": 381, "sequence_org": "R", "sequence_mut": "E", "comment": "Does not inhibit thrombomodulin-enhanced rate of thrombin inhibition in presence of heparin.", "evidence": [ { "database": "UniProtKB", "id": "P05154", "url": "https://www.uniprot.org/uniprotkb/P05154" }, { "database": "PubMed", "id": "18362344", "url": "https://pubmed.ncbi.nlm.nih.gov/18362344" } ], "uniprot_canonical_ac": "P05154-1" } ], "record_id": "pubmed.18362344", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Detection and characterisation of two missense mutations at a cleavage site in the factor VIII light chain.", "journal": "Thrombosis research", "date": "1991", "authors": "Schwaab R, Ludwig M, Kochhan L, Oldenburg J, McVey JH, Egli H, Brackmann HH, Olek K", "reference": { "type": "PubMed", "id": "1851341", "url": "https://pubmed.ncbi.nlm.nih.gov/1851341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1851341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cleavage at Arg-1689 influences heavy chain cleavages during thrombin-catalyzed activation of factor VIII.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Newell JL, Fay PJ", "reference": { "type": "PubMed", "id": "19240027", "url": "https://pubmed.ncbi.nlm.nih.gov/19240027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19240027", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SCH 530348: a novel oral thrombin receptor antagonist.", "journal": "Future cardiology", "date": "2009", "authors": "Bonaca MP, Morrow DA", "reference": { "type": "PubMed", "id": "19715408", "url": "https://pubmed.ncbi.nlm.nih.gov/19715408" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50148-1", "protein_name": "Guanine nucleotide-binding protein G(q) subunit alpha", "gene_name": "GNAQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03113-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-12", "gene_name": "GNA12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25116-1", "protein_name": "Proteinase-activated receptor 1", "gene_name": "F2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14344-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-13", "gene_name": "GNA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RI0-1", "protein_name": "Proteinase-activated receptor 4", "gene_name": "F2RL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95837-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-14", "gene_name": "GNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32121-1", "protein_name": "Beta-arrestin-2", "gene_name": "ARRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49407-1", "protein_name": "Beta-arrestin-1", "gene_name": "ARRB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00254-1", "protein_name": "Proteinase-activated receptor 3", "gene_name": "F2RL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29992-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-11", "gene_name": "GNA11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30679-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-15", "gene_name": "GNA15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19715408", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CRM+ haemophilia A due to a missense mutation (372----Cys) at the internal heavy chain thrombin cleavage site.", "journal": "British journal of haematology", "date": "1990", "authors": "Pattinson JK, McVey JH, Boon M, Ajani A, Tuddenham EG", "reference": { "type": "PubMed", "id": "1973901", "url": "https://pubmed.ncbi.nlm.nih.gov/1973901" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1973901", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enrichment of glycopeptides for glycan structure and attachment site identification.", "journal": "Nature methods", "date": "2009", "authors": "Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G", "reference": { "type": "PubMed", "id": "19838169", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, "referenced_glycans": [ { "glytoucan_ac": "G78644BR" }, { "glytoucan_ac": "G79568CQ" }, { "glytoucan_ac": "G72797UR" }, { "glytoucan_ac": "G20425TQ" }, { "glytoucan_ac": "G36131WL" }, { "glytoucan_ac": "G91636VS" }, { "glytoucan_ac": "G81295CK" }, { "glytoucan_ac": "G22140GZ" }, { "glytoucan_ac": "G22313SX" }, { "glytoucan_ac": "G50045TK" }, { "glytoucan_ac": "G47012YE" }, { "glytoucan_ac": "G09862LV" }, { "glytoucan_ac": "G29931IJ" }, { "glytoucan_ac": "G31118FR" }, { "glytoucan_ac": "G23863VK" }, { "glytoucan_ac": "G75798PH" }, { "glytoucan_ac": "G62165AG" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43652-1", "protein_name": "Afamin", "gene_name": "AFM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92752-1", "protein_name": "Tenascin-R", "gene_name": "TNR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10645-1", "protein_name": "Chromogranin-A", "gene_name": "CHGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41222-1", "protein_name": "Prostaglandin-H2 D-isomerase", "gene_name": "PTGDS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08603-1", "protein_name": "Complement factor H", "gene_name": "CFH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXD5-1", "protein_name": "Seizure 6-like protein 2", "gene_name": "SEZ6L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05156-1", "protein_name": "Complement factor I", "gene_name": "CFI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBP4-1", "protein_name": "Dickkopf-related protein 3", "gene_name": "DKK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02656-1", "protein_name": "Apolipoprotein C-III", "gene_name": "APOC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02649-1", "protein_name": "Apolipoprotein E", "gene_name": "APOE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00450-1", "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14118-1", "protein_name": "Dystroglycan 1", "gene_name": "DAG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20774-1", "protein_name": "Mimecan", "gene_name": "OGN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78423-1", "protein_name": "Fractalkine", "gene_name": "CX3CL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19652-1", "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02750-1", "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05090-1", "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02749-1", "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00738-1", "protein_name": "Haptoglobin", "gene_name": "HP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01034-1", "protein_name": "Cystatin-C", "gene_name": "CST3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36955-1", "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02787-1", "protein_name": "Serotransferrin", "gene_name": "TF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01042-1", "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYX4-1", "protein_name": "Neuron-specific vesicular protein calcyon", "gene_name": "CALY", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14515-1", "protein_name": "SPARC-like protein 1", "gene_name": "SPARCL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GW7-1", "protein_name": "Brevican core protein", "gene_name": "BCAN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UHG2-1", "protein_name": "ProSAAS", "gene_name": "PCSK1N", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08571-1", "protein_name": "Monocyte differentiation antigen CD14", "gene_name": "CD14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01344-1", "protein_name": "Insulin-like growth factor 2", "gene_name": "IGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24592-1", "protein_name": "Insulin-like growth factor-binding protein 6", "gene_name": "IGFBP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05543-1", "protein_name": "Thyroxine-binding globulin", "gene_name": "SERPINA7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51693-1", "protein_name": "Amyloid beta precursor like protein 1", "gene_name": "APLP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04217-1", "protein_name": "Alpha-1B-glycoprotein", "gene_name": "A1BG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02763-1", "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01009-1", "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 416, "start_aa": "Asn", "end_pos": 416, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn416", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "518", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 416, "start_aa": "Asn", "end_pos": 416, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn416", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "518", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1AE8&bu=0&command=select+.H:60;+center+selection;+zoom+selection" }, "start_pos": 416, "start_aa": "Asn", "end_pos": 416, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn416", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P00734", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00734#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "873923", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/873923" }, { "id": "E9PIT3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E9PIT3#ptm_processing" }, { "id": "PIRSR001149-3", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR001149-3" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "1AE8", "database": "PDB", "url": "https://www.rcsb.org/structure/1AE8" }, { "id": "1AFE", "database": "PDB", "url": "https://www.rcsb.org/structure/1AFE" }, { "id": "1BA8", "database": "PDB", "url": "https://www.rcsb.org/structure/1BA8" }, { "id": "1D3D", "database": "PDB", "url": "https://www.rcsb.org/structure/1D3D" }, { "id": "1D3P", "database": "PDB", "url": "https://www.rcsb.org/structure/1D3P" }, { "id": "1D3Q", "database": "PDB", "url": "https://www.rcsb.org/structure/1D3Q" }, { "id": "1D3T", "database": "PDB", "url": "https://www.rcsb.org/structure/1D3T" }, { "id": "1D4P", "database": "PDB", "url": "https://www.rcsb.org/structure/1D4P" }, { "id": "1DOJ", "database": "PDB", "url": "https://www.rcsb.org/structure/1DOJ" }, { "id": "1DX5", "database": "PDB", "url": "https://www.rcsb.org/structure/1DX5" }, { "id": "1HAG", "database": "PDB", "url": "https://www.rcsb.org/structure/1HAG" }, { "id": "1HAH", "database": "PDB", "url": "https://www.rcsb.org/structure/1HAH" }, { "id": "1HAI", "database": "PDB", "url": "https://www.rcsb.org/structure/1HAI" }, { "id": "1JOU", "database": "PDB", "url": "https://www.rcsb.org/structure/1JOU" }, { "id": "1NO9", "database": "PDB", "url": "https://www.rcsb.org/structure/1NO9" }, { "id": "1P8V", "database": "PDB", "url": "https://www.rcsb.org/structure/1P8V" }, { "id": "1RIW", "database": "PDB", "url": "https://www.rcsb.org/structure/1RIW" }, { "id": "1SFQ", "database": "PDB", "url": "https://www.rcsb.org/structure/1SFQ" }, { "id": "1SGI", "database": "PDB", "url": "https://www.rcsb.org/structure/1SGI" }, { "id": "1SHH", "database": "PDB", "url": "https://www.rcsb.org/structure/1SHH" }, { "id": "1SG8", "database": "PDB", "url": "https://www.rcsb.org/structure/1SG8" }, { "id": "1TMT", "database": "PDB", "url": "https://www.rcsb.org/structure/1TMT" }, { "id": "1TMU", "database": "PDB", "url": "https://www.rcsb.org/structure/1TMU" }, { "id": "1TQ7", "database": "PDB", "url": "https://www.rcsb.org/structure/1TQ7" }, { "id": "1UMA", "database": "PDB", "url": "https://www.rcsb.org/structure/1UMA" }, { "id": "1Z8I", "database": "PDB", "url": "https://www.rcsb.org/structure/1Z8I" }, { "id": "1Z8J", "database": "PDB", "url": "https://www.rcsb.org/structure/1Z8J" }, { "id": "2HWL", "database": "PDB", "url": "https://www.rcsb.org/structure/2HWL" }, { "id": "2PGQ", "database": "PDB", "url": "https://www.rcsb.org/structure/2PGQ" }, { "id": "3BEF", "database": "PDB", "url": "https://www.rcsb.org/structure/3BEF" }, { "id": "3BEI", "database": "PDB", "url": "https://www.rcsb.org/structure/3BEI" }, { "id": "3BIU", "database": "PDB", "url": "https://www.rcsb.org/structure/3BIU" }, { "id": "3BIV", "database": "PDB", "url": "https://www.rcsb.org/structure/3BIV" }, { "id": "2OD3", "database": "PDB", "url": "https://www.rcsb.org/structure/2OD3" }, { "id": "3HKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/3HKJ" }, { "id": "3JZ1", "database": "PDB", "url": "https://www.rcsb.org/structure/3JZ1" }, { "id": "3JZ2", "database": "PDB", "url": "https://www.rcsb.org/structure/3JZ2" }, { "id": "3LU9", "database": "PDB", "url": "https://www.rcsb.org/structure/3LU9" }, { "id": "3NXP", "database": "PDB", "url": "https://www.rcsb.org/structure/3NXP" }, { "id": "3P17", "database": "PDB", "url": "https://www.rcsb.org/structure/3P17" }, { "id": "3P6Z", "database": "PDB", "url": "https://www.rcsb.org/structure/3P6Z" }, { "id": "3P70", "database": "PDB", "url": "https://www.rcsb.org/structure/3P70" }, { "id": "3QLP", "database": "PDB", "url": "https://www.rcsb.org/structure/3QLP" }, { "id": "3QTO", "database": "PDB", "url": "https://www.rcsb.org/structure/3QTO" }, { "id": "3QTV", "database": "PDB", "url": "https://www.rcsb.org/structure/3QTV" }, { "id": "3QWC", "database": "PDB", "url": "https://www.rcsb.org/structure/3QWC" }, { "id": "3QX5", "database": "PDB", "url": "https://www.rcsb.org/structure/3QX5" }, { "id": "3R3G", "database": "PDB", "url": "https://www.rcsb.org/structure/3R3G" }, { "id": "3RLW", "database": "PDB", "url": "https://www.rcsb.org/structure/3RLW" }, { "id": "3RLY", "database": "PDB", "url": "https://www.rcsb.org/structure/3RLY" }, { "id": "3RM0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RM0" }, { "id": "3RM2", "database": "PDB", "url": "https://www.rcsb.org/structure/3RM2" }, { "id": "3RML", "database": "PDB", "url": "https://www.rcsb.org/structure/3RML" }, { "id": "3RMM", "database": "PDB", "url": "https://www.rcsb.org/structure/3RMM" }, { "id": "3RMN", "database": "PDB", "url": "https://www.rcsb.org/structure/3RMN" }, { "id": "3RMO", "database": "PDB", "url": "https://www.rcsb.org/structure/3RMO" }, { "id": "3S7H", "database": "PDB", "url": "https://www.rcsb.org/structure/3S7H" }, { "id": "3SHA", "database": "PDB", "url": "https://www.rcsb.org/structure/3SHA" }, { "id": "3SHC", "database": "PDB", "url": "https://www.rcsb.org/structure/3SHC" }, { "id": "3SI3", "database": "PDB", "url": "https://www.rcsb.org/structure/3SI3" }, { "id": "3SI4", "database": "PDB", "url": "https://www.rcsb.org/structure/3SI4" }, { "id": "3SV2", "database": "PDB", "url": "https://www.rcsb.org/structure/3SV2" }, { "id": "3T5F", "database": "PDB", "url": "https://www.rcsb.org/structure/3T5F" }, { "id": "3U69", "database": "PDB", "url": "https://www.rcsb.org/structure/3U69" }, { "id": "3U8O", "database": "PDB", "url": "https://www.rcsb.org/structure/3U8O" }, { "id": "3U8R", "database": "PDB", "url": "https://www.rcsb.org/structure/3U8R" }, { "id": "3U8T", "database": "PDB", "url": "https://www.rcsb.org/structure/3U8T" }, { "id": "3U98", "database": "PDB", "url": "https://www.rcsb.org/structure/3U98" }, { "id": "3U9A", "database": "PDB", "url": "https://www.rcsb.org/structure/3U9A" }, { "id": "3UWJ", "database": "PDB", "url": "https://www.rcsb.org/structure/3UWJ" }, { "id": "3VXE", "database": "PDB", "url": "https://www.rcsb.org/structure/3VXE" }, { "id": "3VXF", "database": "PDB", "url": "https://www.rcsb.org/structure/3VXF" }, { "id": "4AX9", "database": "PDB", "url": "https://www.rcsb.org/structure/4AX9" }, { "id": "4AYV", "database": "PDB", "url": "https://www.rcsb.org/structure/4AYV" }, { "id": "4AYY", "database": "PDB", "url": "https://www.rcsb.org/structure/4AYY" }, { "id": "4AZ2", "database": "PDB", "url": "https://www.rcsb.org/structure/4AZ2" }, { "id": "4BAH", "database": "PDB", "url": "https://www.rcsb.org/structure/4BAH" }, { "id": "4BAK", "database": "PDB", "url": "https://www.rcsb.org/structure/4BAK" }, { "id": "4BAM", "database": "PDB", "url": "https://www.rcsb.org/structure/4BAM" }, { "id": "4BAN", "database": "PDB", "url": "https://www.rcsb.org/structure/4BAN" }, { "id": "4BAQ", "database": "PDB", "url": "https://www.rcsb.org/structure/4BAQ" }, { "id": "4BOH", "database": "PDB", "url": "https://www.rcsb.org/structure/4BOH" }, { "id": "4DIH", "database": "PDB", "url": "https://www.rcsb.org/structure/4DIH" }, { "id": "4DII", "database": "PDB", "url": "https://www.rcsb.org/structure/4DII" }, { "id": "4E05", "database": "PDB", "url": "https://www.rcsb.org/structure/4E05" }, { "id": "4E06", "database": "PDB", "url": "https://www.rcsb.org/structure/4E06" }, { "id": "4E7R", "database": "PDB", "url": "https://www.rcsb.org/structure/4E7R" }, { "id": "3QGN", "database": "PDB", "url": "https://www.rcsb.org/structure/3QGN" }, { "id": "4HTC", "database": "PDB", "url": "https://www.rcsb.org/structure/4HTC" }, { "id": "4HZH", "database": "PDB", "url": "https://www.rcsb.org/structure/4HZH" }, { "id": "4I7Y", "database": "PDB", "url": "https://www.rcsb.org/structure/4I7Y" }, { "id": "4LOY", "database": "PDB", "url": "https://www.rcsb.org/structure/4LOY" }, { "id": "4LZ1", "database": "PDB", "url": "https://www.rcsb.org/structure/4LZ1" }, { "id": "4LZ4", "database": "PDB", "url": "https://www.rcsb.org/structure/4LZ4" }, { "id": "4MLF", "database": "PDB", "url": "https://www.rcsb.org/structure/4MLF" }, { "id": "4RKO", "database": "PDB", "url": "https://www.rcsb.org/structure/4RKO" }, { "id": "4THN", "database": "PDB", "url": "https://www.rcsb.org/structure/4THN" }, { "id": "4UD9", "database": "PDB", "url": "https://www.rcsb.org/structure/4UD9" }, { "id": "4UDW", "database": "PDB", "url": "https://www.rcsb.org/structure/4UDW" }, { "id": "4UE7", "database": "PDB", "url": "https://www.rcsb.org/structure/4UE7" }, { "id": "4UEH", "database": "PDB", "url": "https://www.rcsb.org/structure/4UEH" }, { "id": "4UFD", "database": "PDB", "url": "https://www.rcsb.org/structure/4UFD" }, { "id": "4UFE", "database": "PDB", "url": "https://www.rcsb.org/structure/4UFE" }, { "id": "4UFF", "database": "PDB", "url": "https://www.rcsb.org/structure/4UFF" }, { "id": "4UFG", "database": "PDB", "url": "https://www.rcsb.org/structure/4UFG" }, { "id": "4YES", "database": "PDB", "url": "https://www.rcsb.org/structure/4YES" }, { "id": "4LXB", "database": "PDB", "url": "https://www.rcsb.org/structure/4LXB" }, { "id": "5A2M", "database": "PDB", "url": "https://www.rcsb.org/structure/5A2M" }, { "id": "5AFY", "database": "PDB", "url": "https://www.rcsb.org/structure/5AFY" }, { "id": "5AFZ", "database": "PDB", "url": "https://www.rcsb.org/structure/5AFZ" }, { "id": "5AHG", "database": "PDB", "url": "https://www.rcsb.org/structure/5AHG" }, { "id": "5DO4", "database": "PDB", "url": "https://www.rcsb.org/structure/5DO4" }, { "id": "5GDS", "database": "PDB", "url": "https://www.rcsb.org/structure/5GDS" }, { "id": "5L6N", "database": "PDB", "url": "https://www.rcsb.org/structure/5L6N" }, { "id": "5LCE", "database": "PDB", "url": "https://www.rcsb.org/structure/5LCE" }, { "id": "5NHU", "database": "PDB", "url": "https://www.rcsb.org/structure/5NHU" }, { "id": "5TO3", "database": "PDB", "url": "https://www.rcsb.org/structure/5TO3" }, { "id": "5JFD", "database": "PDB", "url": "https://www.rcsb.org/structure/5JFD" }, { "id": "5AF9", "database": "PDB", "url": "https://www.rcsb.org/structure/5AF9" }, { "id": "6BJR", "database": "PDB", "url": "https://www.rcsb.org/structure/6BJR" }, { "id": "6C2W", "database": "PDB", "url": "https://www.rcsb.org/structure/6C2W" }, { "id": "6EO6", "database": "PDB", "url": "https://www.rcsb.org/structure/6EO6" }, { "id": "6EO7", "database": "PDB", "url": "https://www.rcsb.org/structure/6EO7" }, { "id": "6FJT", "database": "PDB", "url": "https://www.rcsb.org/structure/6FJT" }, { "id": "6HSX", "database": "PDB", "url": "https://www.rcsb.org/structure/6HSX" }, { "id": "6I51", "database": "PDB", "url": "https://www.rcsb.org/structure/6I51" }, { "id": "6CYM", "database": "PDB", "url": "https://www.rcsb.org/structure/6CYM" }, { "id": "6P9U", "database": "PDB", "url": "https://www.rcsb.org/structure/6P9U" }, { "id": "6PXQ", "database": "PDB", "url": "https://www.rcsb.org/structure/6PXQ" }, { "id": "6ROT", "database": "PDB", "url": "https://www.rcsb.org/structure/6ROT" }, { "id": "6T3M", "database": "PDB", "url": "https://www.rcsb.org/structure/6T3M" }, { "id": "6T3Q", "database": "PDB", "url": "https://www.rcsb.org/structure/6T3Q" }, { "id": "6T4A", "database": "PDB", "url": "https://www.rcsb.org/structure/6T4A" }, { "id": "6T52", "database": "PDB", "url": "https://www.rcsb.org/structure/6T52" }, { "id": "6T53", "database": "PDB", "url": "https://www.rcsb.org/structure/6T53" }, { "id": "6T54", "database": "PDB", "url": "https://www.rcsb.org/structure/6T54" }, { "id": "6T55", "database": "PDB", "url": "https://www.rcsb.org/structure/6T55" }, { "id": "6T56", "database": "PDB", "url": "https://www.rcsb.org/structure/6T56" }, { "id": "6T57", "database": "PDB", "url": "https://www.rcsb.org/structure/6T57" }, { "id": "6T7H", "database": "PDB", "url": "https://www.rcsb.org/structure/6T7H" }, { "id": "6T89", "database": "PDB", "url": "https://www.rcsb.org/structure/6T89" }, { "id": "6T8A", "database": "PDB", "url": "https://www.rcsb.org/structure/6T8A" }, { "id": "6TDT", "database": "PDB", "url": "https://www.rcsb.org/structure/6TDT" }, { "id": "6TKG", "database": "PDB", "url": "https://www.rcsb.org/structure/6TKG" }, { "id": "6TKH", "database": "PDB", "url": "https://www.rcsb.org/structure/6TKH" }, { "id": "6TKJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6TKJ" }, { "id": "6TKL", "database": "PDB", "url": "https://www.rcsb.org/structure/6TKL" }, { "id": "6TKI", "database": "PDB", "url": "https://www.rcsb.org/structure/6TKI" }, { "id": "6Y02", "database": "PDB", "url": "https://www.rcsb.org/structure/6Y02" }, { "id": "6Y9H", "database": "PDB", "url": "https://www.rcsb.org/structure/6Y9H" }, { "id": "6YB6", "database": "PDB", "url": "https://www.rcsb.org/structure/6YB6" }, { "id": "6YHG", "database": "PDB", "url": "https://www.rcsb.org/structure/6YHG" }, { "id": "6YHJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6YHJ" }, { "id": "6YMP", "database": "PDB", "url": "https://www.rcsb.org/structure/6YMP" }, { "id": "6YSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/6YSJ" }, { "id": "6YSX", "database": "PDB", "url": "https://www.rcsb.org/structure/6YSX" }, { "id": "6ZUG", "database": "PDB", "url": "https://www.rcsb.org/structure/6ZUG" }, { "id": "6ZUH", "database": "PDB", "url": "https://www.rcsb.org/structure/6ZUH" }, { "id": "6ZUN", "database": "PDB", "url": "https://www.rcsb.org/structure/6ZUN" }, { "id": "6ZUW", "database": "PDB", "url": "https://www.rcsb.org/structure/6ZUW" }, { "id": "6ZUX", "database": "PDB", "url": "https://www.rcsb.org/structure/6ZUX" }, { "id": "6ZV7", "database": "PDB", "url": "https://www.rcsb.org/structure/6ZV7" }, { "id": "6ZV8", "database": "PDB", "url": "https://www.rcsb.org/structure/6ZV8" }, { "id": "7AC9", "database": "PDB", "url": "https://www.rcsb.org/structure/7AC9" }, { "id": "6ZUU", "database": "PDB", "url": "https://www.rcsb.org/structure/6ZUU" }, { "id": "6ZGO", "database": "PDB", "url": "https://www.rcsb.org/structure/6ZGO" }, { "id": "6YQV", "database": "PDB", "url": "https://www.rcsb.org/structure/6YQV" }, { "id": "6YN3", "database": "PDB", "url": "https://www.rcsb.org/structure/6YN3" }, { "id": "7MJ5", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJ5" }, { "id": "7NTU", "database": "PDB", "url": "https://www.rcsb.org/structure/7NTU" }, { "id": "7PHX", "database": "PDB", "url": "https://www.rcsb.org/structure/7PHX" }, { "id": "7SR9", "database": "PDB", "url": "https://www.rcsb.org/structure/7SR9" }, { "id": "8ASE", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASE" }, { "id": "8RTN", "database": "PDB", "url": "https://www.rcsb.org/structure/8RTN" }, { "id": "9CTH", "database": "PDB", "url": "https://www.rcsb.org/structure/9CTH" }, { "id": "9H5N", "database": "PDB", "url": "https://www.rcsb.org/structure/9H5N" }, { "id": "9H79", "database": "PDB", "url": "https://www.rcsb.org/structure/9H79" }, { "id": "9R8Q", "database": "PDB", "url": "https://www.rcsb.org/structure/9R8Q" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "37268159", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37268159" }, { "id": "TP6640575", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6FAK&bu=0&command=select+.A:88;+center+selection;+zoom+selection" }, "start_pos": 109, "start_aa": "Asn", "end_pos": 109, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn109", "evidence": [ { "id": "P43652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P43652#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "6FAK", "database": "PDB", "url": "https://www.rcsb.org/structure/6FAK" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 383, "start_aa": "Asn", "end_pos": 383, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn383", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 383, "start_aa": "Asn", "end_pos": 383, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn383", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": {}, "start_pos": 383, "start_aa": "Asn", "end_pos": 383, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn383", "evidence": [ { "id": "P43652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P43652#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5OKL&bu=0&command=select+.B:381;+center+selection;+zoom+selection" }, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P43652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P43652#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "26902720", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26902720" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "5OKL", "database": "PDB", "url": "https://www.rcsb.org/structure/5OKL" }, { "id": "6FAK", "database": "PDB", "url": "https://www.rcsb.org/structure/6FAK" }, { "id": "6RQ7", "database": "PDB", "url": "https://www.rcsb.org/structure/6RQ7" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1AZX&bu=0&command=select+.L:155;+center+selection;+zoom+selection" }, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01008", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01008#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "1AZX", "database": "PDB", "url": "https://www.rcsb.org/structure/1AZX" }, { "id": "2B4X", "database": "PDB", "url": "https://www.rcsb.org/structure/2B4X" }, { "id": "2B5T", "database": "PDB", "url": "https://www.rcsb.org/structure/2B5T" }, { "id": "2HIJ", "database": "PDB", "url": "https://www.rcsb.org/structure/2HIJ" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010100000011111000.00001.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "P10909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P10909#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "9336835", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9336835" }, { "id": "18780401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18780401" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "1551440", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1551440" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "16263699", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16263699" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "25855029", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25855029" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "35975084", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35975084" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 36, "start_aa": "Thr", "end_pos": 36, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr36", "evidence": [ { "id": "Q92752", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q92752#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "Q92752-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 37, "start_aa": "Thr", "end_pos": 37, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr37", "evidence": [ { "id": "Q92752", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q92752#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "Q92752-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "P02765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02765#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02765", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02765#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G09862LV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G22313SX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 51, "start_aa": "Asn", "end_pos": 51, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn51", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "7525874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7525874" }, { "id": "P41222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P41222#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "8336134", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8336134" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "17259069", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17259069" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "20954982", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20954982" }, { "id": "34743203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34743203" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G09862LV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G22313SX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "685", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/685" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 78, "start_aa": "Asn", "end_pos": 78, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn78", "evidence": [ { "id": "7525874", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7525874" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "P41222", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P41222#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "8336134", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8336134" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "20954982", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20954982" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34743203", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34743203" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P41222-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "17591618", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17591618" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08603#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "742", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/742" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P05156-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "742", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/742" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P05156-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=2XRC&bu=0&command=select+.D:85;+center+selection;+zoom+selection" }, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "P05156", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P05156#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "21768352", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21768352" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "2XRC", "database": "PDB", "url": "https://www.rcsb.org/sequence/2XRC" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "5O32", "database": "PDB", "url": "https://www.rcsb.org/structure/5O32" } ], "filter_code": "001000000000000000000.10000000000000.00.01000", "uniprot_canonical_ac": "P05156-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 94, "start_aa": "Thr", "end_pos": 94, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr94", "evidence": [ { "id": "23234360", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23234360" }, { "id": "58", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/58" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01011", "uniprot_canonical_ac": "P02656-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 94, "start_aa": "Thr", "end_pos": 94, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr94", "evidence": [ { "id": "P02656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02656#ptm_processing" }, { "id": "23527852", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23527852" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "3123586", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3123586" } ], "filter_code": "000000000000000010000.00000010000000.00.01011", "uniprot_canonical_ac": "P02656-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Thr", "end_pos": 212, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr212", "evidence": [ { "id": "23234360", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23234360" }, { "id": "648", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/648" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01100", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 212, "start_aa": "Thr", "end_pos": 212, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr212", "evidence": [ { "id": "P02649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02649#ptm_processing" }, { "id": "2498325", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2498325" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "17154273", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17154273" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000010000.00000010000000.00.01100", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 307, "start_aa": "Thr", "end_pos": 307, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr307", "evidence": [ { "id": "P02649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02649#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 308, "start_aa": "Ser", "end_pos": 308, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser308", "evidence": [ { "id": "P02649", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02649#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "20511397", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20511397" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1KCW&bu=0&command=select+.A:119;+center+selection;+zoom+selection" }, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "P00450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00450#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "4EJX", "database": "PDB", "url": "https://www.rcsb.org/sequence/4EJX" }, { "id": "1KCW", "database": "PDB", "url": "https://www.rcsb.org/sequence/1KCW" }, { "id": "17242517", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17242517" }, { "id": "4ENZ", "database": "PDB", "url": "https://www.rcsb.org/sequence/4ENZ" }, { "id": "2J5W", "database": "PDB", "url": "https://www.rcsb.org/sequence/2J5W" }, { "id": "23843990", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23843990" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 358, "start_aa": "Asn", "end_pos": 358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn358", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 358, "start_aa": "Asn", "end_pos": 358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn358", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 358, "start_aa": "Asn", "end_pos": 358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn358", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 358, "start_aa": "Asn", "end_pos": 358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn358", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 358, "start_aa": "Asn", "end_pos": 358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn358", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "P00450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00450#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=2J5W&bu=0&command=select+.A:378;+center+selection;+zoom+selection" }, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "P00450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00450#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "4EJX", "database": "PDB", "url": "https://www.rcsb.org/sequence/4EJX" }, { "id": "17242517", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17242517" }, { "id": "4ENZ", "database": "PDB", "url": "https://www.rcsb.org/sequence/4ENZ" }, { "id": "2J5W", "database": "PDB", "url": "https://www.rcsb.org/sequence/2J5W" }, { "id": "23843990", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23843990" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 352, "start_aa": "Asn", "end_pos": 352, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn352", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "749", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/749" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 352, "start_aa": "Asn", "end_pos": 352, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn352", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "749", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/749" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": {}, "start_pos": 352, "start_aa": "Asn", "end_pos": 352, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn352", "evidence": [ { "id": "P05155", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P05155#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "3756141", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3756141" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 80, "start_aa": "Thr", "end_pos": 80, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr80", "evidence": [ { "id": "23234360", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23234360" }, { "id": "767", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/767" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P20774-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 80, "start_aa": "Thr", "end_pos": 80, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr80", "evidence": [ { "id": "P20774", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P20774#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P20774-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 253, "start_aa": "Ser", "end_pos": 253, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser253", "evidence": [ { "id": "P78423", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P78423#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "P78423-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 329, "start_aa": "Thr", "end_pos": 329, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr329", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "698", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/698" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P78423-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 329, "start_aa": "Thr", "end_pos": 329, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr329", "evidence": [ { "id": "P78423", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P78423#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P78423-1" }, { "glytoucan_ac": "G09862LV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6UE7&bu=0&command=select+.B:263;+center+selection;+zoom+selection" }, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01876#ptm_processing" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "36677706", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36677706" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "28679431", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28679431" }, { "id": "6UE7", "database": "PDB", "url": "https://www.rcsb.org/structure/6UE7" }, { "id": "8SKU", "database": "PDB", "url": "https://www.rcsb.org/structure/8SKU" }, { "id": "8SKV", "database": "PDB", "url": "https://www.rcsb.org/structure/8SKV" }, { "id": "9OFR", "database": "PDB", "url": "https://www.rcsb.org/structure/9OFR" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "14", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/14" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P19652-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "14", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/14" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P19652-1" }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "14", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/14" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "P19652-1" }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "14", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/14" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010100000011111000.00001.01001", "uniprot_canonical_ac": "P19652-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P19652", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P19652#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "15253437", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15253437" }, { "id": "1567356", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1567356" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P19652-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 186, "start_aa": "Asn", "end_pos": 186, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn186", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 186, "start_aa": "Asn", "end_pos": 186, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn186", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 186, "start_aa": "Asn", "end_pos": 186, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn186", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01001", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 186, "start_aa": "Asn", "end_pos": 186, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn186", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8H24&bu=0&command=select+.A:186;+center+selection;+zoom+selection" }, "start_pos": 186, "start_aa": "Asn", "end_pos": 186, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn186", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "P02750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02750#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "18780401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18780401" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "8H24", "database": "PDB", "url": "https://www.rcsb.org/structure/8H24" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 79, "start_aa": "Asn", "end_pos": 79, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn79", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 79, "start_aa": "Asn", "end_pos": 79, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn79", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01000", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 79, "start_aa": "Asn", "end_pos": 79, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn79", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 79, "start_aa": "Asn", "end_pos": 79, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn79", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010100000011111000.00001.01000", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8H24&bu=0&command=select+.A:79;+center+selection;+zoom+selection" }, "start_pos": 79, "start_aa": "Asn", "end_pos": 79, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn79", "evidence": [ { "id": "P02750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02750#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "8H24", "database": "PDB", "url": "https://www.rcsb.org/structure/8H24" } ], "filter_code": "001000000000000000000.10000000000000.00.01000", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P05090-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P05090-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P05090-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P05090-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P05090", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P05090#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "7918467", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7918467" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "7613477", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7613477" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P05090-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010100000011111000.00001.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1QUB&bu=0&command=select+.A:143;+center+selection;+zoom+selection" }, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02749#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6587378", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6587378" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "1QUB", "database": "PDB", "url": "https://www.rcsb.org/structure/1QUB" }, { "id": "6V09", "database": "PDB", "url": "https://www.rcsb.org/structure/6V09" }, { "id": "6XSD", "database": "PDB", "url": "https://www.rcsb.org/structure/6XSD" }, { "id": "6XST", "database": "PDB", "url": "https://www.rcsb.org/structure/6XST" }, { "id": "7KG4", "database": "PDB", "url": "https://www.rcsb.org/structure/7KG4" }, { "id": "7JIK", "database": "PDB", "url": "https://www.rcsb.org/structure/7JIK" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "18214858", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18214858" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "37268159", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37268159" }, { "id": "TP6640575", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5HU6&bu=0&command=select+.C:241;+center+selection;+zoom+selection" }, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "18214858", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18214858" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "P00738", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00738#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "17803183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17803183" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "21692080", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21692080" }, { "id": "21780104", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21780104" }, { "id": "26869352", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26869352" }, { "id": "32412768", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32412768" }, { "id": "34207451", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34207451" }, { "id": "35811936", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35811936" }, { "id": "36324280", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36324280" }, { "id": "19714880", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19714880" }, { "id": "30370771", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30370771" }, { "id": "5HU6", "database": "PDB", "url": "https://www.rcsb.org/structure/5HU6" }, { "id": "8XMP", "database": "PDB", "url": "https://www.rcsb.org/structure/8XMP" }, { "id": "8XMQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XMQ" }, { "id": "8XMW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XMW" }, { "id": "9FHB", "database": "PDB", "url": "https://www.rcsb.org/structure/9FHB" }, { "id": "9FMU", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMU" }, { "id": "9FNM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FNM" }, { "id": "9FNO", "database": "PDB", "url": "https://www.rcsb.org/structure/9FNO" }, { "id": "9HEJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9HEJ" }, { "id": "9HEK", "database": "PDB", "url": "https://www.rcsb.org/structure/9HEK" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3QYT&bu=0&command=select+.A:413;+center+selection;+zoom+selection" }, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "15536627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15536627" }, { "id": "P02787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02787#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "22327295", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22327295" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "6SOZ", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SOZ" }, { "id": "6SOY", "database": "PDB", "url": "https://www.rcsb.org/sequence/6SOY" }, { "id": "31636418", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31636418" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "24780636", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24780636" }, { "id": "25425657", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25425657" }, { "id": "15474009", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15474009" }, { "id": "36543268", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36543268" }, { "id": "3QYT", "database": "PDB", "url": "https://www.rcsb.org/structure/3QYT" }, { "id": "4H0W", "database": "PDB", "url": "https://www.rcsb.org/structure/4H0W" }, { "id": "8BRC", "database": "PDB", "url": "https://www.rcsb.org/structure/8BRC" }, { "id": "9H4V", "database": "PDB", "url": "https://www.rcsb.org/structure/9H4V" }, { "id": "9THQ", "database": "PDB", "url": "https://www.rcsb.org/structure/9THQ" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3QYT&bu=0&command=select+.A:611;+center+selection;+zoom+selection" }, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "15536627", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15536627" }, { "id": "P02787", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02787#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "22327295", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22327295" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "24780636", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24780636" }, { "id": "25425657", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25425657" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "15474009", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15474009" }, { "id": "36543268", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36543268" }, { "id": "3QYT", "database": "PDB", "url": "https://www.rcsb.org/structure/3QYT" }, { "id": "6D03", "database": "PDB", "url": "https://www.rcsb.org/structure/6D03" }, { "id": "6D04", "database": "PDB", "url": "https://www.rcsb.org/structure/6D04" }, { "id": "6D05", "database": "PDB", "url": "https://www.rcsb.org/structure/6D05" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01000", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010100000011111000.00001.01000", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01042#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 398, "start_aa": "Thr", "end_pos": 398, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr398", "evidence": [ { "id": "Q14515", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q14515#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "23234360", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23234360" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "Q14515-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 905, "start_aa": "Ser", "end_pos": 905, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser905", "evidence": [ { "id": "Q96GW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q96GW7#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "Q96GW7-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 906, "start_aa": "Ser", "end_pos": 906, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser906", "evidence": [ { "id": "Q96GW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q96GW7#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "Q96GW7-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 247, "start_aa": "Thr", "end_pos": 247, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr247", "evidence": [ { "id": "23234360", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23234360" }, { "id": "743", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/743" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "Q9UHG2-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 247, "start_aa": "Thr", "end_pos": 247, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr247", "evidence": [ { "id": "Q9UHG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9UHG2#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "Q9UHG2-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Thr", "end_pos": 53, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr53", "evidence": [ { "id": "23234360", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23234360" }, { "id": "743", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/743" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "Q9UHG2-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 53, "start_aa": "Thr", "end_pos": 53, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr53", "evidence": [ { "id": "Q9UHG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9UHG2#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "Q9UHG2-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010100000011111000.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02790#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6371807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6371807" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0;GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" }, { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 24, "start_aa": "Thr", "end_pos": 24, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr24", "evidence": [ { "id": "23234360", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23234360" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 24, "start_aa": "Thr", "end_pos": 24, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr24", "evidence": [ { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02790#ptm_processing" }, { "id": "6510521", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6510521" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "6371807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6371807" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02790#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "6371807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6371807" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "25265424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25265424" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 64, "start_aa": "Asn", "end_pos": 64, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn64", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02790#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6371807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6371807" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 336, "start_aa": "Thr", "end_pos": 336, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr336", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "774", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/774" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P08571-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 336, "start_aa": "Thr", "end_pos": 336, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr336", "evidence": [ { "id": "P08571", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08571#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P08571-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 163, "start_aa": "Thr", "end_pos": 163, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr163", "evidence": [ { "id": "23234360", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23234360" }, { "id": "760", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/760" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01001", "uniprot_canonical_ac": "P01344-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 163, "start_aa": "Thr", "end_pos": 163, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr163", "evidence": [ { "id": "P01344", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01344#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P01344-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 126, "start_aa": "Thr", "end_pos": 126, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr126", "evidence": [ { "id": "23234360", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23234360" }, { "id": "656", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/656" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P24592-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "Other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (HexNAc...) threonine;Other", "icn3d_view": {}, "start_pos": 126, "start_aa": "Thr", "end_pos": 126, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr126", "evidence": [ { "id": "P24592", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P24592#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "9572875", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9572875" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "P24592-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 36, "start_aa": "Asn", "end_pos": 36, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn36", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "750", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/750" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P05543-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 36, "start_aa": "Asn", "end_pos": 36, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn36", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "750", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/750" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P05543-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": {}, "start_pos": 36, "start_aa": "Asn", "end_pos": 36, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn36", "evidence": [ { "id": "P05543", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P05543#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.10000000000000.00.01000", "uniprot_canonical_ac": "P05543-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 215, "start_aa": "Thr", "end_pos": 215, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr215", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "716", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/716" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "P51693-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 215, "start_aa": "Thr", "end_pos": 215, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr215", "evidence": [ { "id": "P51693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P51693#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_001151", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001151" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "P51693-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 227, "start_aa": "Ser", "end_pos": 227, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser227", "evidence": [ { "id": "P51693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P51693#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000100000.00000010000000.00.01000", "uniprot_canonical_ac": "P51693-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 228, "start_aa": "Thr", "end_pos": 228, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr228", "evidence": [ { "id": "P51693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P51693#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P51693-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Asn", "end_pos": 44, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn44", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Asn", "end_pos": 44, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn44", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Asn", "end_pos": 44, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn44", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Asn", "end_pos": 44, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn44", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": {}, "start_pos": 44, "start_aa": "Asn", "end_pos": 44, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn44", "evidence": [ { "id": "P04217", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P04217#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "3458201", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3458201" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.10000000000000.00.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G78644BR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010100000011111000.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02763#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "15253437", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15253437" }, { "id": "1567356", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1567356" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010101000011101100.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G62165AG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.000100000001101100.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02763#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "15253437", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15253437" }, { "id": "1567356", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1567356" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G36131WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100000000.010100000001101000.00001.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "Complex", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) (complex) asparagine;Complex", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "P01009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01009#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "16622833", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16622833" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "29405331", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29405331" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" } ], "mining_tool": "RLIMS-G_1.0;GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" }, { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.10000000000000.00.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5IO1&bu=0&command=select+.B:247;+center+selection;+zoom+selection" }, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01009#ptm_processing" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "16622833", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16622833" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "29405331", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29405331" }, { "id": "38455847", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38455847" }, { "id": "5IO1", "database": "PDB", "url": "https://www.rcsb.org/structure/5IO1" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G31118FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01009#ptm_processing" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "16622833", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16622833" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "16263699", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16263699" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "29405331", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29405331" }, { "id": "2016749", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2016749" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01009-1" } ], "glycan_expression": [ { "glytoucan_ac": "G78644BR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P19652-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G78644BR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 79, "end_pos": 79 }, { "glytoucan_ac": "G78644BR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G78644BR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G78644BR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G78644BR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G78644BR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G79568CQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Asn", "start_pos": 144, "end_pos": 144 }, { "glytoucan_ac": "G79568CQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 51, "end_pos": 51 }, { "glytoucan_ac": "G79568CQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G72797UR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P19652-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G72797UR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 79, "end_pos": 79 }, { "glytoucan_ac": "G72797UR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G72797UR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G72797UR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G72797UR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G72797UR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P19652-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 107, "end_pos": 107 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 79, "end_pos": 79 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 402, "end_pos": 402 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 64, "end_pos": 64 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 44, "end_pos": 44 }, { "glytoucan_ac": "G20425TQ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P19652-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 107, "end_pos": 107 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 79, "end_pos": 79 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 402, "end_pos": 402 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 64, "end_pos": 64 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 44, "end_pos": 44 }, { "glytoucan_ac": "G36131WL", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G91636VS", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 51, "end_pos": 51 }, { "glytoucan_ac": "G91636VS", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 70, "end_pos": 70 }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 186, "end_pos": 186 }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 402, "end_pos": 402 }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 64, "end_pos": 64 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 107, "end_pos": 107 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 70, "end_pos": 70 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Asn", "start_pos": 144, "end_pos": 144 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 186, "end_pos": 186 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05090-1", "residue": "Asn", "start_pos": 98, "end_pos": 98 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 882, "end_pos": 882 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 109, "end_pos": 109 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 383, "end_pos": 383 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 402, "end_pos": 402 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05156-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 352, "end_pos": 352 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05543-1", "residue": "Asn", "start_pos": 36, "end_pos": 36 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 64, "end_pos": 64 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 44, "end_pos": 44 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 358, "end_pos": 358 }, { "glytoucan_ac": "G22140GZ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G22313SX", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 51, "end_pos": 51 }, { "glytoucan_ac": "G22313SX", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 107, "end_pos": 107 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 70, "end_pos": 70 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Asn", "start_pos": 144, "end_pos": 144 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 186, "end_pos": 186 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05090-1", "residue": "Asn", "start_pos": 98, "end_pos": 98 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 882, "end_pos": 882 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 109, "end_pos": 109 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 383, "end_pos": 383 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 402, "end_pos": 402 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05156-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 352, "end_pos": 352 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05543-1", "residue": "Asn", "start_pos": 36, "end_pos": 36 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 64, "end_pos": 64 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 44, "end_pos": 44 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 358, "end_pos": 358 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G47012YE", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G09862LV", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Asn", "start_pos": 144, "end_pos": 144 }, { "glytoucan_ac": "G09862LV", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 51, "end_pos": 51 }, { "glytoucan_ac": "G09862LV", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02656-1", "residue": "Thr", "start_pos": 94, "end_pos": 94 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02649-1", "residue": "Thr", "start_pos": 212, "end_pos": 212 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P24592-1", "residue": "Thr", "start_pos": 126, "end_pos": 126 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9UHG2-1", "residue": "Thr", "start_pos": 247, "end_pos": 247 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q9UHG2-1", "residue": "Thr", "start_pos": 53, "end_pos": 53 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Thr", "start_pos": 24, "end_pos": 24 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01344-1", "residue": "Thr", "start_pos": 163, "end_pos": 163 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P20774-1", "residue": "Thr", "start_pos": 80, "end_pos": 80 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P78423-1", "residue": "Thr", "start_pos": 329, "end_pos": 329 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P51693-1", "residue": "Thr", "start_pos": 215, "end_pos": 215 }, { "glytoucan_ac": "G29931IJ", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08571-1", "residue": "Thr", "start_pos": 336, "end_pos": 336 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 70, "end_pos": 70 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05090-1", "residue": "Asn", "start_pos": 98, "end_pos": 98 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 51, "end_pos": 51 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 402, "end_pos": 402 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 64, "end_pos": 64 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G31118FR", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 358, "end_pos": 358 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 70, "end_pos": 70 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05090-1", "residue": "Asn", "start_pos": 98, "end_pos": 98 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 51, "end_pos": 51 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P41222-1", "residue": "Asn", "start_pos": 78, "end_pos": 78 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 402, "end_pos": 402 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 64, "end_pos": 64 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 358, "end_pos": 358 }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 70, "end_pos": 70 }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 186, "end_pos": 186 }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 402, "end_pos": 402 }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G75798PH", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 64, "end_pos": 64 }, { "glytoucan_ac": "G62165AG", "abundance": "", "tissue": { "name": "cerebrospinal fluid", "namespace": "UBERON", "id": "0001359", "url": "http://purl.obolibrary.org/obo/UBERON_0001359" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 } ], "record_id": "pubmed.19838169", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 43 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 230 }, { "field": "total_sites", "count": 57 }, { "field": "n_linked_sites", "count": 36 }, { "field": "o_linked_sites", "count": 21 }, { "field": "n_linked_glycan_sites", "count": 36 }, { "field": "o_linked_glycan_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 16 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 57 }, { "field": "exact_n_linked_sites", "count": 36 }, { "field": "exact_n_linked_glycan_sites", "count": 36 }, { "field": "exact_n_linked_glycans", "count": 16 }, { "field": "exact_o_linked_sites", "count": 21 }, { "field": "exact_o_linked_glycan_sites", "count": 11 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 57 }, { "field": "total_sites", "count": 57 }, { "field": "n_linked_sites", "count": 36 }, { "field": "o_linked_sites", "count": 21 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 57 }, { "field": "exact_n_linked_sites", "count": 36 }, { "field": "exact_o_linked_sites", "count": 21 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 173 }, { "field": "total_sites", "count": 47 }, { "field": "n_linked_sites", "count": 36 }, { "field": "o_linked_sites", "count": 11 }, { "field": "n_linked_glycan_sites", "count": 36 }, { "field": "o_linked_glycan_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 16 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 47 }, { "field": "exact_n_linked_sites", "count": 36 }, { "field": "exact_n_linked_glycan_sites", "count": 36 }, { "field": "exact_n_linked_glycans", "count": 16 }, { "field": "exact_o_linked_sites", "count": 11 }, { "field": "exact_o_linked_glycan_sites", "count": 11 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 15 }, { "field": "n_linked_sites", "count": 13 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 15 }, { "field": "exact_n_linked_sites", "count": 13 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] } ] }, { "title": "Structural basis of the cofactor- and substrate-assisted activation of human coagulation factor IXa.", "journal": "Structure (London, England : 1993)", "date": "2009", "authors": "Zogg T, Brandstetter H", "reference": { "type": "PubMed", "id": "20004170", "url": "https://pubmed.ncbi.nlm.nih.gov/20004170" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20004170", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Quantitative characterization of the thrombin-heparin interaction. Discrimination between specific and nonspecific binding models.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Olson ST, Halvorson HR, Bjork I", "reference": { "type": "PubMed", "id": "2007587", "url": "https://pubmed.ncbi.nlm.nih.gov/2007587" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2007587", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of human blood coagulation factor XI independent of factor XII. Factor XI is activated by thrombin and factor XIa in the presence of negatively charged surfaces.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Naito K, Fujikawa K", "reference": { "type": "PubMed", "id": "2019570", "url": "https://pubmed.ncbi.nlm.nih.gov/2019570" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00748-1", "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2019570", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteolysis of human thrombin generates novel host defense peptides.", "journal": "PLoS pathogens", "date": "2010", "authors": "Papareddy P, Rydengard V, Pasupuleti M, Walse B, Morgelin M, Chalupka A, Malmsten M, Schmidtchen A", "reference": { "type": "PubMed", "id": "20421939", "url": "https://pubmed.ncbi.nlm.nih.gov/20421939" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20421939", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism of action and clinical development of platelet thrombin receptor antagonists.", "journal": "Expert review of cardiovascular therapy", "date": "2010", "authors": "Ueno M, Ferreiro JL, Angiolillo DJ", "reference": { "type": "PubMed", "id": "20670195", "url": "https://pubmed.ncbi.nlm.nih.gov/20670195" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50148-1", "protein_name": "Guanine nucleotide-binding protein G(q) subunit alpha", "gene_name": "GNAQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03113-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-12", "gene_name": "GNA12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25116-1", "protein_name": "Proteinase-activated receptor 1", "gene_name": "F2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14344-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-13", "gene_name": "GNA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RI0-1", "protein_name": "Proteinase-activated receptor 4", "gene_name": "F2RL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95837-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-14", "gene_name": "GNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32121-1", "protein_name": "Beta-arrestin-2", "gene_name": "ARRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49407-1", "protein_name": "Beta-arrestin-1", "gene_name": "ARRB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00254-1", "protein_name": "Proteinase-activated receptor 3", "gene_name": "F2RL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29992-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-11", "gene_name": "GNA11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30679-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-15", "gene_name": "GNA15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20670195", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a thrombin cleavage site mutation (Arg 1689 to Cys) in the factor VIII gene of two unrelated patients with cross-reacting material-positive hemophilia A.", "journal": "Blood", "date": "1990", "authors": "Arai M, Higuchi M, Antonarakis SE, Kazazian HH Jr, Phillips JA 3rd, Janco RL, Hoyer LW", "reference": { "type": "PubMed", "id": "2104766", "url": "https://pubmed.ncbi.nlm.nih.gov/2104766" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2104766", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of human factor VIII to phospholipid vesicles.", "journal": "The Journal of biological chemistry", "date": "1990", "authors": "Gilbert GE, Furie BC, Furie B", "reference": { "type": "PubMed", "id": "2104832", "url": "https://pubmed.ncbi.nlm.nih.gov/2104832" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2104832", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification and characterization of factor VIII 372-Cys: a hypofunctional cofactor from a patient with moderately severe hemophilia A.", "journal": "Blood", "date": "1990", "authors": "O'Brien DP, Pattinson JK, Tuddenham EG", "reference": { "type": "PubMed", "id": "2109644", "url": "https://pubmed.ncbi.nlm.nih.gov/2109644" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2109644", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kinetics of coagulation factor X activation by platelet-bound factor IXa.", "journal": "Biochemistry", "date": "1990", "authors": "Rawala-Sheikh R, Ahmad SS, Ashby B, Walsh PN", "reference": { "type": "PubMed", "id": "2110473", "url": "https://pubmed.ncbi.nlm.nih.gov/2110473" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2110473", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Calcium-dependent phospholipid scrambling by TMEM16F.", "journal": "Nature", "date": "2010-12-09", "authors": "Suzuki Jun, Umeda Masato, Sims Peter J, Nagata Shigekazu", "reference": { "type": "PubMed", "id": "21107324", "url": "https://pubmed.ncbi.nlm.nih.gov/21107324" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21107324", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polyphosphate is a cofactor for the activation of factor XI by thrombin.", "journal": "Blood", "date": "2011-12-22", "authors": "Choi Sharon H, Smith Stephanie A, Morrissey James H", "reference": { "type": "PubMed", "id": "21976677", "url": "https://pubmed.ncbi.nlm.nih.gov/21976677" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21976677", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Quantitative detection of single amino acid polymorphisms by targeted proteomics.", "journal": "Journal of molecular cell biology", "date": "2011", "authors": "Su ZD, Sun L, Yu DX, Li RX, Li HX, Yu ZJ, Sheng QH, Lin X, Zeng R, Wu JR", "reference": { "type": "PubMed", "id": "22028381", "url": "https://pubmed.ncbi.nlm.nih.gov/22028381" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08603-1", "protein_name": "Complement factor H", "gene_name": "CFH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35542-1", "protein_name": "Serum amyloid A-4 protein", "gene_name": "SAA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02649-1", "protein_name": "Apolipoprotein E", "gene_name": "APOE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00736-1", "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01031-1", "protein_name": "Complement C5", "gene_name": "C5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10643-1", "protein_name": "Complement component C7", "gene_name": "C7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36955-1", "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01024-1", "protein_name": "Complement C3", "gene_name": "C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22028381", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of thrombin in complex with S-variegin: insights of a novel mechanism of inhibition and design of tunable thrombin inhibitors.", "journal": "PLoS ONE", "date": "2011", "authors": "Koh Cho Yeow, Kumar Sundramurthy, Kazimirova Maria, Nuttall Patricia A, Radhakrishnan Uvaraj P, Kim Seongcheol, Jagadeeswaran Pudur, Imamura Takayuki, Mizuguchi Jun, Iwanaga Sadaaki, Swaminathan Kunchithapadam, Kini R Manjunatha", "reference": { "type": "PubMed", "id": "22053189", "url": "https://pubmed.ncbi.nlm.nih.gov/22053189" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22053189", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A sequential mechanism for exosite-mediated factor IX activation by factor XIa.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Geng Y, Verhamme IM, Messer A, Sun MF, Smith SB, Bajaj SP, Gailani D", "reference": { "type": "PubMed", "id": "22961984", "url": "https://pubmed.ncbi.nlm.nih.gov/22961984" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22961984", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TMEM16F forms a Ca2+-activated cation channel required for lipid scrambling in platelets during blood coagulation.", "journal": "Cell", "date": "2012", "authors": "Yang H, Kim A, David T, Palmer D, Jin T, Tien J, Huang F, Cheng T, Coughlin SR, Jan YN, Jan LY", "reference": { "type": "PubMed", "id": "23021219", "url": "https://pubmed.ncbi.nlm.nih.gov/23021219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BHY3-1", "protein_name": "Anoctamin-1", "gene_name": "Ano1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 409, "end_pos": 409, "sequence_org": "D", "sequence_mut": "G", "comment": "Reduced channel activity and sensitivity to Ca(2+).", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "23021219", "url": "https://pubmed.ncbi.nlm.nih.gov/23021219" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 559, "end_pos": 559, "sequence_org": "Q", "sequence_mut": "K", "comment": "Slower channel activation. Increased permeability to chloride ions.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "23021219", "url": "https://pubmed.ncbi.nlm.nih.gov/23021219" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 667, "end_pos": 667, "sequence_org": "E", "sequence_mut": "Q", "comment": "Requires much higher calcium levels for the activation of scramblase and ion channel activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P9J9", "url": "https://www.uniprot.org/uniprotkb/Q6P9J9" }, { "database": "PubMed", "id": "23021219", "url": "https://pubmed.ncbi.nlm.nih.gov/23021219" }, { "database": "PubMed", "id": "30785399", "url": "https://pubmed.ncbi.nlm.nih.gov/30785399" } ], "uniprot_canonical_ac": "Q6P9J9-1" }, { "start_pos": 588, "end_pos": 588, "sequence_org": "K", "sequence_mut": "A", "comment": "Decreased permeability to chloride ions.", "evidence": [ { "database": "UniProtKB", "id": "Q8BHY3", "url": "https://www.uniprot.org/uniprotkb/Q8BHY3" }, { "database": "PubMed", "id": "23021219", "url": "https://pubmed.ncbi.nlm.nih.gov/23021219" }, { "database": "PubMed", "id": "28561733", "url": "https://pubmed.ncbi.nlm.nih.gov/28561733" } ], "uniprot_canonical_ac": "Q8BHY3-1" }, { "start_pos": 588, "end_pos": 588, "sequence_org": "K", "sequence_mut": "Q", "comment": "Decreased permeability to chloride ions.", "evidence": [ { "database": "UniProtKB", "id": "Q8BHY3", "url": "https://www.uniprot.org/uniprotkb/Q8BHY3" }, { "database": "PubMed", "id": "23021219", "url": "https://pubmed.ncbi.nlm.nih.gov/23021219" }, { "database": "PubMed", "id": "28561733", "url": "https://pubmed.ncbi.nlm.nih.gov/28561733" } ], "uniprot_canonical_ac": "Q8BHY3-1" } ], "record_id": "pubmed.23021219", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unique thrombin inhibition mechanism by anophelin, an anticoagulant from the malaria vector.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2012", "authors": "Figueiredo Ana C, de Sanctis Daniele, Guti\u00e9rrez-Gallego Ricardo, Cereija Tatiana B, Macedo-Ribeiro Sandra, Fuentes-Prior Pablo, Pereira Pedro Jos\u00e9 Barbosa", "reference": { "type": "PubMed", "id": "23223529", "url": "https://pubmed.ncbi.nlm.nih.gov/23223529" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23223529", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the thrombin-hirudin complex: a novel mode of serine protease inhibition.", "journal": "EMBO J.", "date": "1990", "authors": "Gr\u00fctter M G, Priestle J P, Rahuel J, Grossenbacher H, Bode W, Hofsteenge J, Stone S R", "reference": { "type": "PubMed", "id": "2369893", "url": "https://pubmed.ncbi.nlm.nih.gov/2369893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2369893", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure of a complex of recombinant hirudin and human alpha-thrombin.", "journal": "Science", "date": "1990", "authors": "Rydel T J, Ravichandran K G, Tulinsky A, Bode W, Huber R, Roitsch C, Fenton J W", "reference": { "type": "PubMed", "id": "2374926", "url": "https://pubmed.ncbi.nlm.nih.gov/2374926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2374926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Computational framework for identification of intact glycopeptides in complex samples.", "journal": "Analytical chemistry", "date": "2014", "authors": "Mayampurath A, Yu CY, Song E, Balan J, Mechref Y, Tang H", "reference": { "type": "PubMed", "id": "24279413", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, "referenced_glycans": [ { "glytoucan_ac": "G00875VP" }, { "glytoucan_ac": "G51941GC" }, { "glytoucan_ac": "G52527GH" }, { "glytoucan_ac": "G82463GQ" }, { "glytoucan_ac": "G83204BU" }, { "glytoucan_ac": "G42358LZ" }, { "glytoucan_ac": "G14572XX" }, { "glytoucan_ac": "G11629QQ" }, { "glytoucan_ac": "G74772YG" }, { "glytoucan_ac": "G37868ZX" }, { "glytoucan_ac": "G67895PX" }, { "glytoucan_ac": "G60853DO" }, { "glytoucan_ac": "G61302NC" }, { "glytoucan_ac": "G05724UK" }, { "glytoucan_ac": "G06110VR" }, { "glytoucan_ac": "G06356OH" }, { "glytoucan_ac": "G83624CJ" }, { "glytoucan_ac": "G84452RH" }, { "glytoucan_ac": "G22208HN" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G15169WU" }, { "glytoucan_ac": "G70160EA" }, { "glytoucan_ac": "G56903ZB" }, { "glytoucan_ac": "G93860XO" }, { "glytoucan_ac": "G08146BT" }, { "glytoucan_ac": "G47518TP" }, { "glytoucan_ac": "G55412XP" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G49874UX" }, { "glytoucan_ac": "G10471FG" }, { "glytoucan_ac": "G45495MK" }, { "glytoucan_ac": "G39188ZX" }, { "glytoucan_ac": "G23294PN" }, { "glytoucan_ac": "G31916IQ" }, { "glytoucan_ac": "G32104JU" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02751-15", "protein_name": "Fibronectin", "gene_name": "FN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12763-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "Q58D62-1", "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "P08603-1", "protein_name": "Complement factor H", "gene_name": "CFH", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PD5-1", "protein_name": "N-acetylmuramoyl-L-alanine amidase", "gene_name": "PGLYRP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00736-1", "protein_name": "Complement C1r subcomponent", "gene_name": "C1R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08185-1", "protein_name": "Corticosteroid-binding globulin", "gene_name": "SERPINA6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00450-1", "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13671-1", "protein_name": "Complement component C6", "gene_name": "C6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03952-1", "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27169-1", "protein_name": "Serum paraoxonase/arylesterase 1", "gene_name": "PON1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02750-1", "protein_name": "Leucine-rich alpha-2-glycoprotein", "gene_name": "LRG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02749-1", "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00738-1", "protein_name": "Haptoglobin", "gene_name": "HP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P36955-1", "protein_name": "Pigment epithelium-derived factor", "gene_name": "SERPINF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01042-1", "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04196-1", "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19827-1", "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H1", "gene_name": "ITIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14624-1", "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01024-1", "protein_name": "Complement C3", "gene_name": "C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01023-1", "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04217-1", "protein_name": "Alpha-1B-glycoprotein", "gene_name": "A1BG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01011-1", "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02763-1", "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01009-1", "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 143, "start_aa": "Asn", "end_pos": 143, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn143", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "518", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/518" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 143, "start_aa": "Asn", "end_pos": 143, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn143", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "518", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/518" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 416, "start_aa": "Asn", "end_pos": 416, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn416", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "518", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/518" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 416, "start_aa": "Asn", "end_pos": 416, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn416", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "518", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/518" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1007, "start_aa": "Asn", "end_pos": 1007, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1007", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1007, "start_aa": "Asn", "end_pos": 1007, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1007", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1007, "start_aa": "Asn", "end_pos": 1007, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1007", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1007, "start_aa": "Asn", "end_pos": 1007, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1007", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1007, "start_aa": "Asn", "end_pos": 1007, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1007", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02751", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02751#ptm_processing" }, { "id": "16037490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16037490" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "35484284", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35484284" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 528, "start_aa": "Asn", "end_pos": 528, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn528", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 528, "start_aa": "Asn", "end_pos": 528, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn528", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3M7P&bu=0&command=select+.A:528;+center+selection;+zoom+selection" }, "start_pos": 528, "start_aa": "Asn", "end_pos": 528, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn528", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P02751", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02751#ptm_processing" }, { "id": "16037490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16037490" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "3M7P", "database": "PDB", "url": "https://www.rcsb.org/structure/3M7P" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 542, "start_aa": "Asn", "end_pos": 542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn542", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 542, "start_aa": "Asn", "end_pos": 542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn542", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 542, "start_aa": "Asn", "end_pos": 542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn542", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 542, "start_aa": "Asn", "end_pos": 542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn542", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "161", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/161" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3EJH&bu=0&command=select+.B:542;+center+selection;+zoom+selection" }, "start_pos": 542, "start_aa": "Asn", "end_pos": 542, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn542", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P02751", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02751#ptm_processing" }, { "id": "16037490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16037490" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "3EJH", "database": "PDB", "url": "https://www.rcsb.org/structure/3EJH" }, { "id": "3GXE", "database": "PDB", "url": "https://www.rcsb.org/structure/3GXE" }, { "id": "3M7P", "database": "PDB", "url": "https://www.rcsb.org/structure/3M7P" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02751-15" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 128, "start_aa": "Asn", "end_pos": 128, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn128", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 128, "start_aa": "Asn", "end_pos": 128, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn128", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 128, "start_aa": "Asn", "end_pos": 128, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn128", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 128, "start_aa": "Asn", "end_pos": 128, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn128", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1DZG&bu=0&command=select+.I:96;+center+selection;+zoom+selection" }, "start_pos": 128, "start_aa": "Asn", "end_pos": 128, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn128", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01008", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01008#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "1DZG", "database": "PDB", "url": "https://www.rcsb.org/structure/1DZG" }, { "id": "1DZH", "database": "PDB", "url": "https://www.rcsb.org/structure/1DZH" }, { "id": "1E03", "database": "PDB", "url": "https://www.rcsb.org/structure/1E03" }, { "id": "1E05", "database": "PDB", "url": "https://www.rcsb.org/structure/1E05" }, { "id": "1NQ9", "database": "PDB", "url": "https://www.rcsb.org/structure/1NQ9" }, { "id": "1OYH", "database": "PDB", "url": "https://www.rcsb.org/structure/1OYH" }, { "id": "1TB6", "database": "PDB", "url": "https://www.rcsb.org/structure/1TB6" }, { "id": "2B4X", "database": "PDB", "url": "https://www.rcsb.org/structure/2B4X" }, { "id": "2BEH", "database": "PDB", "url": "https://www.rcsb.org/structure/2BEH" }, { "id": "2GD4", "database": "PDB", "url": "https://www.rcsb.org/structure/2GD4" }, { "id": "2HIJ", "database": "PDB", "url": "https://www.rcsb.org/structure/2HIJ" }, { "id": "2ZNH", "database": "PDB", "url": "https://www.rcsb.org/structure/2ZNH" }, { "id": "3EVJ", "database": "PDB", "url": "https://www.rcsb.org/structure/3EVJ" }, { "id": "4EB1", "database": "PDB", "url": "https://www.rcsb.org/structure/4EB1" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1AZX&bu=0&command=select+.L:155;+center+selection;+zoom+selection" }, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01008", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01008#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "1AZX", "database": "PDB", "url": "https://www.rcsb.org/structure/1AZX" }, { "id": "2B4X", "database": "PDB", "url": "https://www.rcsb.org/structure/2B4X" }, { "id": "2B5T", "database": "PDB", "url": "https://www.rcsb.org/structure/2B5T" }, { "id": "2HIJ", "database": "PDB", "url": "https://www.rcsb.org/structure/2HIJ" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "id": "23345538", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23345538" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "id": "23345538", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23345538" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G60853DO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010000000000000000.00001.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101000.00001.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G14572XX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001000000.00001.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101000.00001.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 99, "start_aa": "Asn", "end_pos": 99, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn99", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 99, "start_aa": "Asn", "end_pos": 99, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn99", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 99, "start_aa": "Asn", "end_pos": 99, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn99", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 99, "start_aa": "Asn", "end_pos": 99, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn99", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "22", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/22" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101000.00001.01000", "uniprot_canonical_ac": "P12763-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 137, "start_aa": "Asn", "end_pos": 137, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn137", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "644", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/644" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "Q58D62-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 137, "start_aa": "Asn", "end_pos": 137, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn137", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "644", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/644" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "Q58D62-1" }, { "glytoucan_ac": "G00875VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1029, "start_aa": "Asn", "end_pos": 1029, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1029", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08603#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "17591618", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17591618" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G00875VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "17591618", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17591618" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P08603", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P08603#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "17591618", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17591618" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 911, "start_aa": "Asn", "end_pos": 911, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn911", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 367, "start_aa": "Asn", "end_pos": 367, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn367", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "784", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/784" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "Q96PD5-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 367, "start_aa": "Asn", "end_pos": 367, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn367", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "784", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/784" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "Q96PD5-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 485, "start_aa": "Asn", "end_pos": 485, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn485", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "784", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/784" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "Q96PD5-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 485, "start_aa": "Asn", "end_pos": 485, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn485", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "784", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/784" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "Q96PD5-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 514, "start_aa": "Asn", "end_pos": 514, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn514", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "713", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/713" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00736-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 514, "start_aa": "Asn", "end_pos": 514, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn514", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "713", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/713" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00736-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Asn", "end_pos": 96, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn96", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "788", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/788" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P08185-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Asn", "end_pos": 96, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn96", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "788", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/788" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P08185-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G74772YG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000000.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1KCW&bu=0&command=select+.A:119;+center+selection;+zoom+selection" }, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "P00450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00450#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "4EJX", "database": "PDB", "url": "https://www.rcsb.org/sequence/4EJX" }, { "id": "1KCW", "database": "PDB", "url": "https://www.rcsb.org/sequence/1KCW" }, { "id": "17242517", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17242517" }, { "id": "4ENZ", "database": "PDB", "url": "https://www.rcsb.org/sequence/4ENZ" }, { "id": "2J5W", "database": "PDB", "url": "https://www.rcsb.org/sequence/2J5W" }, { "id": "23843990", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23843990" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 358, "start_aa": "Asn", "end_pos": 358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn358", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 358, "start_aa": "Asn", "end_pos": 358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn358", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G55412XP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001101000.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G67895PX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=2J5W&bu=0&command=select+.A:378;+center+selection;+zoom+selection" }, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "P00450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00450#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "4EJX", "database": "PDB", "url": "https://www.rcsb.org/sequence/4EJX" }, { "id": "17242517", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17242517" }, { "id": "4ENZ", "database": "PDB", "url": "https://www.rcsb.org/sequence/4ENZ" }, { "id": "2J5W", "database": "PDB", "url": "https://www.rcsb.org/sequence/2J5W" }, { "id": "23843990", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23843990" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 762, "start_aa": "Asn", "end_pos": 762, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn762", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 762, "start_aa": "Asn", "end_pos": 762, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn762", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 762, "start_aa": "Asn", "end_pos": 762, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn762", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 762, "start_aa": "Asn", "end_pos": 762, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn762", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1KCW&bu=0&command=select+.A:743;+center+selection;+zoom+selection" }, "start_pos": 762, "start_aa": "Asn", "end_pos": 762, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn762", "evidence": [ { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P00450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00450#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "1KCW", "database": "PDB", "url": "https://www.rcsb.org/sequence/1KCW" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "35372033", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35372033" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 324, "start_aa": "Asn", "end_pos": 324, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn324", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "791", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/791" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P13671-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 324, "start_aa": "Asn", "end_pos": 324, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn324", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "791", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/791" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P13671-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 127, "start_aa": "Asn", "end_pos": 127, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn127", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "714", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/714" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P03952-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 127, "start_aa": "Asn", "end_pos": 127, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn127", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "714", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/714" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P03952-1" }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "714", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/714" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P03952-1" }, { "glytoucan_ac": "G56903ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 396, "start_aa": "Asn", "end_pos": 396, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn396", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "714", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/714" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010100100001111100.00001.01001", "uniprot_canonical_ac": "P03952-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "726", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/726" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P27169-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "726", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/726" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P27169-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 324, "start_aa": "Asn", "end_pos": 324, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn324", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "726", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/726" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01000", "uniprot_canonical_ac": "P27169-1" }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 324, "start_aa": "Asn", "end_pos": 324, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn324", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "726", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/726" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101000.00001.01000", "uniprot_canonical_ac": "P27169-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "749", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/749" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "749", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/749" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 186, "start_aa": "Asn", "end_pos": 186, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn186", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 186, "start_aa": "Asn", "end_pos": 186, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn186", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "676", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/676" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8H24&bu=0&command=select+.A:186;+center+selection;+zoom+selection" }, "start_pos": 186, "start_aa": "Asn", "end_pos": 186, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn186", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "P02750", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02750#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "18780401", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18780401" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "8H24", "database": "PDB", "url": "https://www.rcsb.org/structure/8H24" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02750-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02749#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6587378", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6587378" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "18214858", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18214858" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "18214858", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18214858" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4WJG&bu=0&command=select+.W:180;+center+selection;+zoom+selection" }, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "18214858", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18214858" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P00738", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00738#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "17803183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17803183" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "26869352", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26869352" }, { "id": "32412768", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32412768" }, { "id": "31014754", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31014754" }, { "id": "35811936", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35811936" }, { "id": "30370771", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30370771" }, { "id": "4WJG", "database": "PDB", "url": "https://www.rcsb.org/structure/4WJG" }, { "id": "5HU6", "database": "PDB", "url": "https://www.rcsb.org/structure/5HU6" }, { "id": "8XMP", "database": "PDB", "url": "https://www.rcsb.org/structure/8XMP" }, { "id": "8XMQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XMQ" }, { "id": "8XMW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XMW" }, { "id": "9FHB", "database": "PDB", "url": "https://www.rcsb.org/structure/9FHB" }, { "id": "9FMU", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMU" }, { "id": "9FNO", "database": "PDB", "url": "https://www.rcsb.org/structure/9FNO" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "18214858", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18214858" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "18214858", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18214858" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G51941GC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010100000011111000.00001.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101000.00001.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5HU6&bu=0&command=select+.C:241;+center+selection;+zoom+selection" }, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "18214858", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18214858" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "P00738", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00738#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "17803183", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17803183" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "21692080", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21692080" }, { "id": "21780104", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21780104" }, { "id": "26869352", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26869352" }, { "id": "32412768", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32412768" }, { "id": "34207451", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34207451" }, { "id": "35811936", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35811936" }, { "id": "36324280", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/36324280" }, { "id": "19714880", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19714880" }, { "id": "30370771", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30370771" }, { "id": "5HU6", "database": "PDB", "url": "https://www.rcsb.org/structure/5HU6" }, { "id": "8XMP", "database": "PDB", "url": "https://www.rcsb.org/structure/8XMP" }, { "id": "8XMQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XMQ" }, { "id": "8XMW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XMW" }, { "id": "9FHB", "database": "PDB", "url": "https://www.rcsb.org/structure/9FHB" }, { "id": "9FMU", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMU" }, { "id": "9FNM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FNM" }, { "id": "9FNO", "database": "PDB", "url": "https://www.rcsb.org/structure/9FNO" }, { "id": "9HEJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9HEJ" }, { "id": "9HEK", "database": "PDB", "url": "https://www.rcsb.org/structure/9HEK" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 285, "start_aa": "Asn", "end_pos": 285, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn285", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/645" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P36955-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 285, "start_aa": "Asn", "end_pos": 285, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn285", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "645", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/645" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01000", "uniprot_canonical_ac": "P36955-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1IMV&bu=0&command=select+.A:265;+center+selection;+zoom+selection" }, "start_pos": 285, "start_aa": "Asn", "end_pos": 285, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn285", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P36955", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P36955#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "11562499", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11562499" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "1IMV", "database": "PDB", "url": "https://www.rcsb.org/structure/1IMV" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P36955-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011100101.00100.01000", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G83624CJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P04004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P04004#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "19899825", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19899825" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G14572XX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001000000.00001.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G51941GC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010100000011111000.00001.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" }, { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "625", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/625" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101000.00001.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 242, "start_aa": "Asn", "end_pos": 242, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn242", "evidence": [ { "id": "25374123", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25374123" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P04004", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P04004#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G00875VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000000.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G14572XX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001000000.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G74772YG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000000.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02790#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "6371807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6371807" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0;GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" }, { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "P02790", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02790#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "6371807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/6371807" }, { "id": "16740002", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16740002" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "805", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/805" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "805", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/805" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "805", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/805" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "805", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/805" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P04196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P04196#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G00875VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 188, "start_aa": "Asn", "end_pos": 188, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn188", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "695", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/695" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "P05546-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 188, "start_aa": "Asn", "end_pos": 188, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn188", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "695", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/695" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P05546-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1JMO&bu=0&command=select+.A:169;+center+selection;+zoom+selection" }, "start_pos": 188, "start_aa": "Asn", "end_pos": 188, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn188", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P05546", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P05546#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "12169660", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12169660" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "1JMO", "database": "PDB", "url": "https://www.rcsb.org/structure/1JMO" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P05546-1" }, { "glytoucan_ac": "G00875VP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "695", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/695" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "P05546-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "695", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/695" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P05546-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 49, "start_aa": "Asn", "end_pos": 49, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn49", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P05546", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P05546#ptm_processing" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P05546-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 285, "start_aa": "Asn", "end_pos": 285, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn285", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "284", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/284" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P19827-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 285, "start_aa": "Asn", "end_pos": 285, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn285", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "284", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/284" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P19827-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 285, "start_aa": "Asn", "end_pos": 285, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn285", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P19827", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P19827#ptm_processing" }, { "id": "9425062", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9425062" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "9677337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/9677337" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P19827-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 517, "start_aa": "Asn", "end_pos": 517, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn517", "evidence": [ { "id": "24884609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24884609" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "711", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/711" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "Q14624-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 517, "start_aa": "Asn", "end_pos": 517, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn517", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "711", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/711" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24884609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24884609" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "Q14624-1" }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111110.00010.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G10471FG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.110100100001111100.00001.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G32104JU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010000100001101100.00001.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.111111100011111110.00010.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G61302NC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000100000001001100.00001.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G70160EA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100100001111000.00001.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5FO9&bu=0&command=select+.D:85;+center+selection;+zoom+selection" }, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "4077844", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/4077844" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01024#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "17051150", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17051150" }, { "id": "2579379", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2579379" }, { "id": "17684013", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17684013" }, { "id": "16263699", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16263699" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "5FO9", "database": "PDB", "url": "https://www.rcsb.org/structure/5FO9" }, { "id": "6RU5", "database": "PDB", "url": "https://www.rcsb.org/structure/6RU5" }, { "id": "7QIV", "database": "PDB", "url": "https://www.rcsb.org/structure/7QIV" }, { "id": "8UH2", "database": "PDB", "url": "https://www.rcsb.org/structure/8UH2" }, { "id": "8UIN", "database": "PDB", "url": "https://www.rcsb.org/structure/8UIN" }, { "id": "9U61", "database": "PDB", "url": "https://www.rcsb.org/structure/9U61" }, { "id": "9U62", "database": "PDB", "url": "https://www.rcsb.org/structure/9U62" }, { "id": "9QK2", "database": "PDB", "url": "https://www.rcsb.org/structure/9QK2" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01001", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G22208HN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000011000000.00001.01001", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=6TAV&bu=0&command=select+.A:1424;+center+selection;+zoom+selection" }, "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01023#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24285556", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24285556" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "6TAV", "database": "PDB", "url": "https://www.rcsb.org/structure/6TAV" }, { "id": "7O7L", "database": "PDB", "url": "https://www.rcsb.org/structure/7O7L" }, { "id": "7O7N", "database": "PDB", "url": "https://www.rcsb.org/structure/7O7N" }, { "id": "7O7S", "database": "PDB", "url": "https://www.rcsb.org/structure/7O7S" }, { "id": "7O7M", "database": "PDB", "url": "https://www.rcsb.org/structure/7O7M" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001100100.00100.01000", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G83204BU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000100000001000000.00001.01000", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7O7L&bu=0&command=select+.C:869;+center+selection;+zoom+selection" }, "start_pos": 869, "start_aa": "Asn", "end_pos": 869, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn869", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01023", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01023#ptm_processing" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "7O7L", "database": "PDB", "url": "https://www.rcsb.org/structure/7O7L" }, { "id": "7O7N", "database": "PDB", "url": "https://www.rcsb.org/structure/7O7N" }, { "id": "7O7O", "database": "PDB", "url": "https://www.rcsb.org/structure/7O7O" }, { "id": "7O7S", "database": "PDB", "url": "https://www.rcsb.org/structure/7O7S" }, { "id": "7O7M", "database": "PDB", "url": "https://www.rcsb.org/structure/7O7M" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 179, "start_aa": "Asn", "end_pos": 179, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn179", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 179, "start_aa": "Asn", "end_pos": 179, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn179", "evidence": [ { "id": "37268159", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37268159" }, { "id": "TP6640575", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP6640575" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 371, "start_aa": "Asn", "end_pos": 371, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn371", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 371, "start_aa": "Asn", "end_pos": 371, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn371", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "780", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/780" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P04217-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "19", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P01011-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "19", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/19" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P01011-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "19", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/19" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01011-1" }, { "glytoucan_ac": "G93860XO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "19", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/19" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101000.00001.01001", "uniprot_canonical_ac": "P01011-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G51941GC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010100000011111000.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02763", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P02763#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "15253437", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15253437" }, { "id": "1567356", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1567356" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011100101.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G83624CJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000000000001000000.00001.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=5IO1&bu=0&command=select+.B:247;+center+selection;+zoom+selection" }, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P01009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P01009#ptm_processing" }, { "id": "12754519", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12754519" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "16622833", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16622833" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "29405331", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29405331" }, { "id": "38455847", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38455847" }, { "id": "5IO1", "database": "PDB", "url": "https://www.rcsb.org/structure/5IO1" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P01009-1" } ], "glycan_expression": [ { "glytoucan_ac": "G00875VP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05546-1", "residue": "Asn", "start_pos": 188, "end_pos": 188 }, { "glytoucan_ac": "G00875VP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05546-1", "residue": "Asn", "start_pos": 49, "end_pos": 49 }, { "glytoucan_ac": "G00875VP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G00875VP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 882, "end_pos": 882 }, { "glytoucan_ac": "G00875VP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G51941GC", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G51941GC", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G51941GC", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G52527GH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G52527GH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G52527GH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G82463GQ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G82463GQ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 169, "end_pos": 169 }, { "glytoucan_ac": "G83204BU", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01023-1", "residue": "Asn", "start_pos": 869, "end_pos": 869 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 99, "end_pos": 99 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "Q58D62-1", "residue": "Asn", "start_pos": 137, "end_pos": 137 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 1007, "end_pos": 1007 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 542, "end_pos": 542 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01011-1", "residue": "Asn", "start_pos": 106, "end_pos": 106 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 143, "end_pos": 143 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 169, "end_pos": 169 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 517, "end_pos": 517 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00736-1", "residue": "Asn", "start_pos": 514, "end_pos": 514 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P03952-1", "residue": "Asn", "start_pos": 127, "end_pos": 127 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 911, "end_pos": 911 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P27169-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 179, "end_pos": 179 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 371, "end_pos": 371 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD5-1", "residue": "Asn", "start_pos": 367, "end_pos": 367 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD5-1", "residue": "Asn", "start_pos": 485, "end_pos": 485 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08185-1", "residue": "Asn", "start_pos": 96, "end_pos": 96 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13671-1", "residue": "Asn", "start_pos": 324, "end_pos": 324 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04196-1", "residue": "Asn", "start_pos": 125, "end_pos": 125 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 358, "end_pos": 358 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G14572XX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G14572XX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G14572XX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G11629QQ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01023-1", "residue": "Asn", "start_pos": 1424, "end_pos": 1424 }, { "glytoucan_ac": "G74772YG", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G74772YG", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 1007, "end_pos": 1007 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 542, "end_pos": 542 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P19827-1", "residue": "Asn", "start_pos": 285, "end_pos": 285 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P36955-1", "residue": "Asn", "start_pos": 285, "end_pos": 285 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 186, "end_pos": 186 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 882, "end_pos": 882 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01023-1", "residue": "Asn", "start_pos": 1424, "end_pos": 1424 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04196-1", "residue": "Asn", "start_pos": 125, "end_pos": 125 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G37868ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G67895PX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G60853DO", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G61302NC", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G05724UK", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 1007, "end_pos": 1007 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 528, "end_pos": 528 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 542, "end_pos": 542 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P19827-1", "residue": "Asn", "start_pos": 285, "end_pos": 285 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P36955-1", "residue": "Asn", "start_pos": 285, "end_pos": 285 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02750-1", "residue": "Asn", "start_pos": 186, "end_pos": 186 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 882, "end_pos": 882 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01023-1", "residue": "Asn", "start_pos": 1424, "end_pos": 1424 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04196-1", "residue": "Asn", "start_pos": 125, "end_pos": 125 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G83624CJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G83624CJ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 169, "end_pos": 169 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G22208HN", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01023-1", "residue": "Asn", "start_pos": 1424, "end_pos": 1424 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G70160EA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G56903ZB", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P03952-1", "residue": "Asn", "start_pos": 396, "end_pos": 396 }, { "glytoucan_ac": "G93860XO", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G93860XO", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G93860XO", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 99, "end_pos": 99 }, { "glytoucan_ac": "G93860XO", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01011-1", "residue": "Asn", "start_pos": 106, "end_pos": 106 }, { "glytoucan_ac": "G93860XO", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G93860XO", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P27169-1", "residue": "Asn", "start_pos": 324, "end_pos": 324 }, { "glytoucan_ac": "G93860XO", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G08146BT", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G08146BT", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G08146BT", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 99, "end_pos": 99 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01011-1", "residue": "Asn", "start_pos": 106, "end_pos": 106 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P27169-1", "residue": "Asn", "start_pos": 324, "end_pos": 324 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G55412XP", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "P12763-1", "residue": "Asn", "start_pos": 99, "end_pos": 99 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood", "namespace": "UBERON", "id": "0000178", "url": "http://purl.obolibrary.org/obo/UBERON_0000178" }, "species": { "name": "Bos taurus", "taxid": 9913, "reference_species": "Bos taurus [9913]", "common_name": "Bovine", "glygen_name": "Bovine" }, "cell_line": {}, "uniprot_canonical_ac": "Q58D62-1", "residue": "Asn", "start_pos": 137, "end_pos": 137 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 1007, "end_pos": 1007 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02751-15", "residue": "Asn", "start_pos": 542, "end_pos": 542 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01011-1", "residue": "Asn", "start_pos": 106, "end_pos": 106 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 143, "end_pos": 143 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 416, "end_pos": 416 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 169, "end_pos": 169 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04004-1", "residue": "Asn", "start_pos": 242, "end_pos": 242 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05546-1", "residue": "Asn", "start_pos": 188, "end_pos": 188 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05546-1", "residue": "Asn", "start_pos": 49, "end_pos": 49 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 517, "end_pos": 517 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00736-1", "residue": "Asn", "start_pos": 514, "end_pos": 514 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P03952-1", "residue": "Asn", "start_pos": 127, "end_pos": 127 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 1029, "end_pos": 1029 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 882, "end_pos": 882 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 911, "end_pos": 911 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P27169-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 238, "end_pos": 238 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 179, "end_pos": 179 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04217-1", "residue": "Asn", "start_pos": 371, "end_pos": 371 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD5-1", "residue": "Asn", "start_pos": 367, "end_pos": 367 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q96PD5-1", "residue": "Asn", "start_pos": 485, "end_pos": 485 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08185-1", "residue": "Asn", "start_pos": 96, "end_pos": 96 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P13671-1", "residue": "Asn", "start_pos": 324, "end_pos": 324 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04196-1", "residue": "Asn", "start_pos": 125, "end_pos": 125 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 358, "end_pos": 358 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G49874UX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P03952-1", "residue": "Asn", "start_pos": 396, "end_pos": 396 }, { "glytoucan_ac": "G10471FG", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G45495MK", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G45495MK", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G39188ZX", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G23294PN", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G31916IQ", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01023-1", "residue": "Asn", "start_pos": 869, "end_pos": 869 }, { "glytoucan_ac": "G32104JU", "abundance": "", "tissue": { "name": "blood plasma", "namespace": "UBERON", "id": "0001969", "url": "http://purl.obolibrary.org/obo/UBERON_0001969" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 } ], "record_id": "pubmed.24279413", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 35 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 208 }, { "field": "total_sites", "count": 52 }, { "field": "n_linked_sites", "count": 52 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 52 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 35 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 52 }, { "field": "exact_n_linked_sites", "count": 52 }, { "field": "exact_n_linked_glycan_sites", "count": 52 }, { "field": "exact_n_linked_glycans", "count": 35 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 28 }, { "field": "total_sites", "count": 28 }, { "field": "n_linked_sites", "count": 28 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 28 }, { "field": "exact_n_linked_sites", "count": 28 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 180 }, { "field": "total_sites", "count": 52 }, { "field": "n_linked_sites", "count": 52 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 52 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 35 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 52 }, { "field": "exact_n_linked_sites", "count": 52 }, { "field": "exact_n_linked_glycan_sites", "count": 52 }, { "field": "exact_n_linked_glycans", "count": 35 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 10 }, { "field": "n_linked_sites", "count": 10 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 10 }, { "field": "exact_n_linked_sites", "count": 10 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool", "icn3d_view.label", "icn3d_view.url" ] } ] }, { "title": "Selective glycopeptide profiling by acetone enrichment and LC/MS.", "journal": "Journal of proteomics", "date": "2014", "authors": "Takakura D, Harazono A, Hashii N, Kawasaki N", "reference": { "type": "PubMed", "id": "24530628", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, "referenced_glycans": [ { "glytoucan_ac": "G59536GA" }, { "glytoucan_ac": "G79568CQ" }, { "glytoucan_ac": "G52527GH" }, { "glytoucan_ac": "G82463GQ" }, { "glytoucan_ac": "G83213GG" }, { "glytoucan_ac": "G42358LZ" }, { "glytoucan_ac": "G72309KR" }, { "glytoucan_ac": "G66088HZ" }, { "glytoucan_ac": "G24835MQ" }, { "glytoucan_ac": "G11629QQ" }, { "glytoucan_ac": "G11870QZ" }, { "glytoucan_ac": "G12793SR" }, { "glytoucan_ac": "G66760KM" }, { "glytoucan_ac": "G81295CK" }, { "glytoucan_ac": "G05724UK" }, { "glytoucan_ac": "G06110VR" }, { "glytoucan_ac": "G06356OH" }, { "glytoucan_ac": "G54682XF" }, { "glytoucan_ac": "G84452RH" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G14994KB" }, { "glytoucan_ac": "G15169WU" }, { "glytoucan_ac": "G70101JE" }, { "glytoucan_ac": "G64394MX" }, { "glytoucan_ac": "G64527OM" }, { "glytoucan_ac": "G02030ZB" }, { "glytoucan_ac": "G93656SY" }, { "glytoucan_ac": "G94854LT" }, { "glytoucan_ac": "G50045TK" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G47518TP" }, { "glytoucan_ac": "G03382KH" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G49874UX" }, { "glytoucan_ac": "G10256JP" }, { "glytoucan_ac": "G31153XO" }, { "glytoucan_ac": "G39188ZX" }, { "glytoucan_ac": "G39595FH" }, { "glytoucan_ac": "G23432EQ" }, { "glytoucan_ac": "G23863VK" }, { "glytoucan_ac": "G31936TA" }, { "glytoucan_ac": "G69834CE" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10909-1", "protein_name": "Clusterin", "gene_name": "CLU", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08603-1", "protein_name": "Complement factor H", "gene_name": "CFH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00450-1", "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L4-1", "protein_name": "Complement C4-A", "gene_name": "C4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P19652-1", "protein_name": "Alpha-1-acid glycoprotein 2", "gene_name": "ORM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05090-1", "protein_name": "Apolipoprotein D", "gene_name": "APOD", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02749-1", "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00738-1", "protein_name": "Haptoglobin", "gene_name": "HP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02787-1", "protein_name": "Serotransferrin", "gene_name": "TF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01042-1", "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04196-1", "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14624-1", "protein_name": "Inter-alpha-trypsin inhibitor heavy chain H4", "gene_name": "ITIH4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01024-1", "protein_name": "Complement C3", "gene_name": "C3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00751-1", "protein_name": "Complement factor B", "gene_name": "CFB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01023-1", "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01011-1", "protein_name": "Alpha-1-antichymotrypsin", "gene_name": "SERPINA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02763-1", "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01009-1", "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 143, "start_aa": "Asn", "end_pos": 143, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn143", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "518", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/518" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 143, "start_aa": "Asn", "end_pos": 143, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn143", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "518", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/518" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 128, "start_aa": "Asn", "end_pos": 128, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn128", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Asn", "end_pos": 374, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn374", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "759", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/759" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01100", "uniprot_canonical_ac": "P10909-1" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "24706782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706782" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "24706782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706782" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 46, "start_aa": "Asn", "end_pos": 46, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn46", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "24706782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706782" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 46, "start_aa": "Asn", "end_pos": 46, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn46", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "24706782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706782" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 46, "start_aa": "Asn", "end_pos": 46, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn46", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "24706782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706782" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 882, "start_aa": "Asn", "end_pos": 882, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn882", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "722", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/722" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P08603-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 358, "start_aa": "Asn", "end_pos": 358, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn358", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 762, "start_aa": "Asn", "end_pos": 762, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn762", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 762, "start_aa": "Asn", "end_pos": 762, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn762", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 762, "start_aa": "Asn", "end_pos": 762, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn762", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 762, "start_aa": "Asn", "end_pos": 762, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn762", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1328, "start_aa": "Asn", "end_pos": 1328, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1328", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "651", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/651" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P0C0L4-1" }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 226, "start_aa": "Asn", "end_pos": 226, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn226", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "651", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/651" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.110111100001111110.00010.01000", "uniprot_canonical_ac": "P0C0L4-1" }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "749", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/749" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01001", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "749", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/749" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "749", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/749" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01001", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "14", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/14" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001100100.00100.01001", "uniprot_canonical_ac": "P19652-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "14", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/14" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P19652-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 98, "start_aa": "Asn", "end_pos": 98, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn98", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "677", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/677" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P05090-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 162, "start_aa": "Asn", "end_pos": 162, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn162", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 253, "start_aa": "Asn", "end_pos": 253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn253", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "678", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/678" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010110000011100100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "1456441", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1456441" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 169, "start_aa": "Asn", "end_pos": 169, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn169", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 294, "start_aa": "Asn", "end_pos": 294, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn294", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "810", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/810" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "805", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/805" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 125, "start_aa": "Asn", "end_pos": 125, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn125", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "805", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/805" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001101100.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000111000001100100.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011100101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 517, "start_aa": "Asn", "end_pos": 517, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn517", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "711", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/711" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24884609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24884609" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "Q14624-1" }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "688", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/688" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "25759508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25759508" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "688", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/688" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "25759508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25759508" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "688", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/688" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "25759508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25759508" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "688", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/688" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "25759508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25759508" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "688", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/688" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "25759508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25759508" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "688", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/688" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "25759508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25759508" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111110.00010.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 85, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn85", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "110", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/110" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.111111100011111110.00010.01000", "uniprot_canonical_ac": "P01024-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 122, "start_aa": "Asn", "end_pos": 122, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn122", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "753", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/753" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00751-1" }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "3661998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3661998" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "3661998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3661998" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" }, { "id": "2977", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2977" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" }, { "id": "2977", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2977" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "19358553", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19358553" }, { "id": "2977", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/2977" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "2363690", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/2363690" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "3567160", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3567160" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1424, "start_aa": "Asn", "end_pos": 1424, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1424", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "730", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/730" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G69834CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 106, "start_aa": "Asn", "end_pos": 106, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn106", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "19", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/19" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011101101.00100.01001", "uniprot_canonical_ac": "P01011-1" }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "19", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/19" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01001", "uniprot_canonical_ac": "P01011-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "19", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/19" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01001", "uniprot_canonical_ac": "P01011-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "19", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/19" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01011-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "19", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/19" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01001", "uniprot_canonical_ac": "P01011-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01000", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G54682XF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101000.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001100100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000011100100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G72309KR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000001000000.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G83213GG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000001000100.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 72, "start_aa": "Asn", "end_pos": 72, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn72", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001100100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G31153XO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000100.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G54682XF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101000.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G66088HZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000011100100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G72309KR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000001000000.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G83213GG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000100000001000100.00001.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 107, "start_aa": "Asn", "end_pos": 107, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn107", "evidence": [ { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01009-1" } ], "glycan_expression": [ { "glytoucan_ac": "G59536GA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G79568CQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G52527GH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G52527GH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01011-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G52527GH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01011-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G52527GH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G82463GQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G83213GG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G83213GG", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G42358LZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 56, "end_pos": 56 }, { "glytoucan_ac": "G72309KR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G72309KR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G66088HZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G66088HZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G24835MQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G11629QQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01011-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G11629QQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G11870QZ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 46, "end_pos": 46 }, { "glytoucan_ac": "G12793SR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G12793SR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P19652-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G12793SR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G66760KM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G81295CK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G05724UK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G06110VR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 143, "end_pos": 143 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01023-1", "residue": "Asn", "start_pos": 1424, "end_pos": 1424 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04196-1", "residue": "Asn", "start_pos": 125, "end_pos": 125 }, { "glytoucan_ac": "G54682XF", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G54682XF", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 209, "end_pos": 209 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2", "residue": "Asn", "start_pos": 177, "end_pos": 177 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 46, "end_pos": 46 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 107, "end_pos": 107 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 70, "end_pos": 70 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05090-1", "residue": "Asn", "start_pos": 98, "end_pos": 98 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01023-1", "residue": "Asn", "start_pos": 1424, "end_pos": 1424 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G14994KB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G14994KB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2", "residue": "Asn", "start_pos": 177, "end_pos": 177 }, { "glytoucan_ac": "G14994KB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 107, "end_pos": 107 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G70101JE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P0C0L4-1", "residue": "Asn", "start_pos": 226, "end_pos": 226 }, { "glytoucan_ac": "G64394MX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 209, "end_pos": 209 }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 46, "end_pos": 46 }, { "glytoucan_ac": "G93656SY", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G93656SY", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G94854LT", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G50045TK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G46687AB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2", "residue": "Asn", "start_pos": 177, "end_pos": 177 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P19652-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 107, "end_pos": 107 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 72, "end_pos": 72 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 103, "end_pos": 103 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G03382KH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G03382KH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 56, "end_pos": 56 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01011-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 107, "end_pos": 107 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 70, "end_pos": 70 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 143, "end_pos": 143 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P0C0L4-1", "residue": "Asn", "start_pos": 1328, "end_pos": 1328 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 162, "end_pos": 162 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02749-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "Q14624-1", "residue": "Asn", "start_pos": 517, "end_pos": 517 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P08603-1", "residue": "Asn", "start_pos": 882, "end_pos": 882 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01023-1", "residue": "Asn", "start_pos": 1424, "end_pos": 1424 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P05155-1", "residue": "Asn", "start_pos": 253, "end_pos": 253 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00751-1", "residue": "Asn", "start_pos": 122, "end_pos": 122 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P10909-1", "residue": "Asn", "start_pos": 374, "end_pos": 374 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 128, "end_pos": 128 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P04196-1", "residue": "Asn", "start_pos": 125, "end_pos": 125 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 169, "end_pos": 169 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01042-1", "residue": "Asn", "start_pos": 294, "end_pos": 294 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 358, "end_pos": 358 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 762, "end_pos": 762 }, { "glytoucan_ac": "G49874UX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G49874UX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G49874UX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2", "residue": "Asn", "start_pos": 177, "end_pos": 177 }, { "glytoucan_ac": "G10256JP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G31153XO", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G39188ZX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01024-1", "residue": "Asn", "start_pos": 85, "end_pos": 85 }, { "glytoucan_ac": "G39595FH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G23432EQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G23863VK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2", "residue": "Asn", "start_pos": 177, "end_pos": 177 }, { "glytoucan_ac": "G31936TA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G69834CE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01011-1", "residue": "Asn", "start_pos": 106, "end_pos": 106 } ], "record_id": "pubmed.24530628", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 42 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 133 }, { "field": "total_sites", "count": 50 }, { "field": "n_linked_sites", "count": 50 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 50 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 41 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 50 }, { "field": "exact_n_linked_sites", "count": 50 }, { "field": "exact_n_linked_glycan_sites", "count": 50 }, { "field": "exact_n_linked_glycans", "count": 41 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 133 }, { "field": "total_sites", "count": 50 }, { "field": "n_linked_sites", "count": 50 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 50 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 41 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 50 }, { "field": "exact_n_linked_sites", "count": 50 }, { "field": "exact_n_linked_glycan_sites", "count": 50 }, { "field": "exact_n_linked_glycans", "count": 41 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparison of sialylated N-glycopeptide levels in serum of pancreatic cancer patients, acute pancreatitis patients, and healthy controls.", "journal": "Proteomics", "date": "2014", "authors": "Kontro H, Joenvaara S, Haglund C, Renkonen R", "reference": { "type": "PubMed", "id": "24841998", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, "referenced_glycans": [ { "glytoucan_ac": "G59536GA" }, { "glytoucan_ac": "G59937CP" }, { "glytoucan_ac": "G88725PI" }, { "glytoucan_ac": "G59626AS" }, { "glytoucan_ac": "G52162PS" }, { "glytoucan_ac": "G52527GH" }, { "glytoucan_ac": "G06853GH" }, { "glytoucan_ac": "G27126ED" }, { "glytoucan_ac": "G14440NQ" }, { "glytoucan_ac": "G72291OX" }, { "glytoucan_ac": "G72667IM" }, { "glytoucan_ac": "G72787SB" }, { "glytoucan_ac": "G72791KH" }, { "glytoucan_ac": "G35029YA" }, { "glytoucan_ac": "G83646BJ" }, { "glytoucan_ac": "G40926MX" }, { "glytoucan_ac": "G44211QA" }, { "glytoucan_ac": "G24835MQ" }, { "glytoucan_ac": "G25079LO" }, { "glytoucan_ac": "G25987BV" }, { "glytoucan_ac": "G02815KT" }, { "glytoucan_ac": "G12580WI" }, { "glytoucan_ac": "G12793SR" }, { "glytoucan_ac": "G31852PQ" }, { "glytoucan_ac": "G19379ID" }, { "glytoucan_ac": "G36670VW" }, { "glytoucan_ac": "G37818NZ" }, { "glytoucan_ac": "G10486CT" }, { "glytoucan_ac": "G27947YN" }, { "glytoucan_ac": "G67324HN" }, { "glytoucan_ac": "G60923RB" }, { "glytoucan_ac": "G61613II" }, { "glytoucan_ac": "G90734RJ" }, { "glytoucan_ac": "G91473PK" }, { "glytoucan_ac": "G80475RE" }, { "glytoucan_ac": "G06356OH" }, { "glytoucan_ac": "G53959KE" }, { "glytoucan_ac": "G54600FO" }, { "glytoucan_ac": "G83555HU" }, { "glytoucan_ac": "G83633GK" }, { "glytoucan_ac": "G84452RH" }, { "glytoucan_ac": "G99679NM" }, { "glytoucan_ac": "G40792UP" }, { "glytoucan_ac": "G40834TG" }, { "glytoucan_ac": "G41044JW" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G22769FQ" }, { "glytoucan_ac": "G14994KB" }, { "glytoucan_ac": "G15038BD" }, { "glytoucan_ac": "G15169WU" }, { "glytoucan_ac": "G15508AW" }, { "glytoucan_ac": "G16175ZV" }, { "glytoucan_ac": "G60033FS" }, { "glytoucan_ac": "G57317CE" }, { "glytoucan_ac": "G58001LT" }, { "glytoucan_ac": "G02030ZB" }, { "glytoucan_ac": "G02886BB" }, { "glytoucan_ac": "G93656SY" }, { "glytoucan_ac": "G94917XT" }, { "glytoucan_ac": "G95865ZB" }, { "glytoucan_ac": "G08293MJ" }, { "glytoucan_ac": "G09197ZW" }, { "glytoucan_ac": "G49955PK" }, { "glytoucan_ac": "G50073PQ" }, { "glytoucan_ac": "G50143PC" }, { "glytoucan_ac": "G28603RA" }, { "glytoucan_ac": "G28937TW" }, { "glytoucan_ac": "G86752LQ" }, { "glytoucan_ac": "G88374WZ" }, { "glytoucan_ac": "G47518TP" }, { "glytoucan_ac": "G47737VJ" }, { "glytoucan_ac": "G01650EU" }, { "glytoucan_ac": "G72790NZ" }, { "glytoucan_ac": "G04055MU" }, { "glytoucan_ac": "G28681TP" }, { "glytoucan_ac": "G00912UN" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G49018RC" }, { "glytoucan_ac": "G49284IH" }, { "glytoucan_ac": "G10339FR" }, { "glytoucan_ac": "G65184UU" }, { "glytoucan_ac": "G85282JO" }, { "glytoucan_ac": "G85582CB" }, { "glytoucan_ac": "G85740DB" }, { "glytoucan_ac": "G86182NS" }, { "glytoucan_ac": "G44953PJ" }, { "glytoucan_ac": "G45504EY" }, { "glytoucan_ac": "G39595FH" }, { "glytoucan_ac": "G62765YT" }, { "glytoucan_ac": "G06247RL" }, { "glytoucan_ac": "G23505EP" }, { "glytoucan_ac": "G57776ZU" }, { "glytoucan_ac": "G31986NC" }, { "glytoucan_ac": "G32392SM" }, { "glytoucan_ac": "G37399XV" }, { "glytoucan_ac": "G68318VE" }, { "glytoucan_ac": "G61855PQ" }, { "glytoucan_ac": "G62595EF" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43652-1", "protein_name": "Afamin", "gene_name": "AFM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01871-2", "protein_name": "Immunoglobulin heavy constant mu", "gene_name": "IGHM", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00450-1", "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01861-2", "protein_name": "Immunoglobulin heavy constant gamma 4", "gene_name": "IGHG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00738-1", "protein_name": "Haptoglobin", "gene_name": "HP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02787-1", "protein_name": "Serotransferrin", "gene_name": "TF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01877-2", "protein_name": "Immunoglobulin heavy constant alpha 2", "gene_name": "IGHA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01591-1", "protein_name": "Immunoglobulin J chain", "gene_name": "JCHAIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01859-2", "protein_name": "Immunoglobulin heavy constant gamma 2", "gene_name": "IGHG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01857-2", "protein_name": "Immunoglobulin heavy constant gamma 1", "gene_name": "IGHG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02763-1", "protein_name": "Alpha-1-acid glycoprotein 1", "gene_name": "ORM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01009-1", "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 121, "start_aa": "Asn", "end_pos": 121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn121", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 121, "start_aa": "Asn", "end_pos": 121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn121", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 121, "start_aa": "Asn", "end_pos": 121, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn121", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "518", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/518" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "23345538", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23345538" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P43652@N33", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P43652@N33" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 33, "start_aa": "Asn", "end_pos": 33, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn33", "evidence": [ { "id": "23345538", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23345538" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P43652@N402", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P43652@N402" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 402, "start_aa": "Asn", "end_pos": 402, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn402", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "731", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/731" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P43652-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 224, "start_aa": "Asn", "end_pos": 224, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn224", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01008@N224", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01008@N224" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 224, "start_aa": "Asn", "end_pos": 224, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn224", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "766", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/766" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01008-1" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "24706782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706782" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "P01871@N209", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01871@N209" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01871@N209", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01871@N209" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "24706782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706782" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G36670VW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01871@N209", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01871@N209" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01871@N209", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01871@N209" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010110000011100100.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01871@N209", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01871@N209" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "24706782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706782" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01871@N209", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01871@N209" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 209, "start_aa": "Asn", "end_pos": 209, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn209", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "280", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/280" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" }, { "id": "24706782", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24706782" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01001", "uniprot_canonical_ac": "P01871-2" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P02765@N156", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02765@N156" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "P02765@N156", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02765@N156" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P02765@N156", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02765@N156" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010110100001100100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P02765@N156", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02765@N156" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Asn", "end_pos": 156, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn156", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "P02765@N156", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02765@N156" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P02765@N176", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02765@N176" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P02765@N176", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02765@N176" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "1457416", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1457416" }, { "id": "23", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/23" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P02765@N176", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02765@N176" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P00450@N138", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00450@N138" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P00450@N138", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00450@N138" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=1KCW&bu=0&command=select+.A:119;+center+selection;+zoom+selection" }, "start_pos": 138, "start_aa": "Asn", "end_pos": 138, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn138", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "P00450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00450#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "4EJX", "database": "PDB", "url": "https://www.rcsb.org/sequence/4EJX" }, { "id": "1KCW", "database": "PDB", "url": "https://www.rcsb.org/sequence/1KCW" }, { "id": "17242517", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17242517" }, { "id": "4ENZ", "database": "PDB", "url": "https://www.rcsb.org/sequence/4ENZ" }, { "id": "2J5W", "database": "PDB", "url": "https://www.rcsb.org/sequence/2J5W" }, { "id": "23843990", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23843990" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P00450@N397", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00450@N397" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "85", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/85" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=2J5W&bu=0&command=select+.A:378;+center+selection;+zoom+selection" }, "start_pos": 397, "start_aa": "Asn", "end_pos": 397, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn397", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "16321355", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16321355" }, { "id": "P00450", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P00450#ptm_processing" }, { "id": "19838169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19838169" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "14760718", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14760718" }, { "id": "16335952", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/16335952" }, { "id": "4EJX", "database": "PDB", "url": "https://www.rcsb.org/sequence/4EJX" }, { "id": "17242517", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17242517" }, { "id": "4ENZ", "database": "PDB", "url": "https://www.rcsb.org/sequence/4ENZ" }, { "id": "2J5W", "database": "PDB", "url": "https://www.rcsb.org/sequence/2J5W" }, { "id": "23843990", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23843990" }, { "id": "19139490", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19139490" }, { "id": "23090970", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24190977" }, { "id": "29427759", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29427759" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G10339FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100111111100.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000011110101.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G16175ZV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000101000001100100.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000011110101.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100001.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G49284IH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100001.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G54600FO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G59937CP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G61855PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000100001111100.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01861@N177", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01861@N177" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "770", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/770" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 177, "start_aa": "Asn", "end_pos": 177, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn177", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01861-2" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "230", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/230" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" }, { "id": "227", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/227" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001101100.00100.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01876@N144", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01876@N144" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 144, "start_aa": "Asn", "end_pos": 144, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn144", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P00738@N184", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00738@N184" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P00738@N184", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00738@N184" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P00738@N241", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00738@N241" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P00738@N241", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00738@N241" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P00738@N241", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00738@N241" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P00738@N241", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00738@N241" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "24103369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24103369" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010110000011100100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P00738@N241", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00738@N241" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "744", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/744" }, { "id": "23829323", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23829323" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010110100001100100.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P00738@N241", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P00738@N241" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 241, "start_aa": "Asn", "end_pos": 241, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn241", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P00738-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "26791533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26791533" }, { "id": "P02787@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N432" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G04055MU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.00100.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G15508AW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.00100.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G22769FQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.00100.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "1456441", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1456441" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G50143PC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.00100.01000", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "26791533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26791533" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P02787@N630", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02787@N630" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "1456441", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1456441" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 630, "start_aa": "Asn", "end_pos": 630, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn630", "evidence": [ { "id": "1456441", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1456441" }, { "id": "558", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/558" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "29992770", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29992770" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02787-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P02790@N187", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N187" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 187, "start_aa": "Asn", "end_pos": 187, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn187", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "26791533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26791533" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P02790@N453", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02790@N453" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Asn", "end_pos": 453, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn453", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "757", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/757" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 131, "start_aa": "Asn", "end_pos": 131, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn131", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G06853GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010001000001100100.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G14440NQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001100000.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G31986NC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100100.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101100.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G49018RC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G59937CP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G61613II", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001101100.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "647", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/647" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 205, "start_aa": "Asn", "end_pos": 205, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn205", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01877@N205", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01877@N205" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01877-2" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01591@N71", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01591@N71" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "N", "end_pos": 71, "end_aa": "N", "residue": "N", "site_lbl": "N71", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "108268", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/108268" }, { "id": "277", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/277" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01591@N71", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01591@N71" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G09197ZW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010010000001111101.00010.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "277", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/277" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G23505EP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000101000001100100.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G27126ED", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000011110101.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G32392SM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101000.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "N", "end_pos": 71, "end_aa": "N", "residue": "N", "site_lbl": "N71", "evidence": [ { "id": "40667337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40667337" }, { "id": "TP5868669", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP5868669" }, { "id": "108268", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/108268" }, { "id": "277", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/277" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G49018RC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00010.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01591@N71", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01591@N71" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G62595EF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010000000011111100.00010.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "277", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/277" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "20030399", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20030399" }, { "id": "25802287", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25802287" }, { "id": "26510530", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26510530" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G85282JO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001100100.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G86182NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01591@N71", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01591@N71" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01591-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01859@N176", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01859@N176" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "688", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/688" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "25759508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25759508" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G28681TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G54600FO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01859@N176", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01859@N176" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 176, "start_aa": "Asn", "end_pos": 176, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn176", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "688", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/688" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "25759508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25759508" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "P01859-2" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G09197ZW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010010000001111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G10339FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100111111100.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.000111000001101100.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G25987BV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G28603RA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100000.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100111111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G40834TG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100001.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001101100.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G52162PS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.000000000001000000.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G54600FO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G59937CP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G61855PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000100001111100.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G67324HN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101101.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G83633GK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "671", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/671" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" }, { "id": "23944609", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23944609" }, { "id": "21609021", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21609021" }, { "id": "31467031", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/31467031" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "30659065", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30659065" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G90734RJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000011000001100100.00100.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G95865ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 180, "start_aa": "Asn", "end_pos": 180, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn180", "evidence": [ { "id": "24766575", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24766575" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01857@N180", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01857@N180" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01101", "uniprot_canonical_ac": "P01857-2" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 56, "start_aa": "Asn", "end_pos": 56, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn56", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G06247RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "26791533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26791533" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001100100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G28937TW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G37818NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G41044JW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "25153361", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25153361" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G53959KE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000000.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "718", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/718" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G94917XT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G99679NM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 93, "start_aa": "Asn", "end_pos": 93, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn93", "evidence": [ { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P02763@N93", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P02763@N93" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1100100000.000101000001101100.00100.01001", "uniprot_canonical_ac": "P02763-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "26791533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26791533" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "P01009@N271", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N271" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "22171320", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22171320" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "P01009@N271", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/P01009@N271" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "P01009-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "24279413", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24279413" }, { "id": "20", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/20" }, { "id": "24841998", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24841998" }, { "id": "24417605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24417605" }, { "id": "24530628", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24530628" }, { "id": "18514042", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18514042" }, { "id": "29741879", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29741879" }, { "id": "29391424", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29391424" }, { "id": "30237853", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30237853" }, { "id": "29671580", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32125861" }, { "id": "34725484", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34725484" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01001", "uniprot_canonical_ac": "P01009-1" } ], "glycan_expression": [ { "glytoucan_ac": "G59536GA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 209, "end_pos": 209 }, { "glytoucan_ac": "G59536GA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G52527GH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G72291OX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G72291OX", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G72667IM", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 209, "end_pos": 209 }, { "glytoucan_ac": "G24835MQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Asn", "start_pos": 144, "end_pos": 144 }, { "glytoucan_ac": "G12793SR", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G91473PK", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 209, "end_pos": 209 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01591-1", "residue": "Asn", "start_pos": 71, "end_pos": 71 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01876-2", "residue": "Asn", "start_pos": 144, "end_pos": 144 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 131, "end_pos": 131 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G06356OH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G53959KE", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01591-1", "residue": "Asn", "start_pos": 71, "end_pos": 71 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 209, "end_pos": 209 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01857-2", "residue": "Asn", "start_pos": 180, "end_pos": 180 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G84452RH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2", "residue": "Asn", "start_pos": 177, "end_pos": 177 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01591-1", "residue": "Asn", "start_pos": 71, "end_pos": 71 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 209, "end_pos": 209 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G22310AV", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G22769FQ", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G14994KB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01859-2", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G14994KB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01861-2", "residue": "Asn", "start_pos": 177, "end_pos": 177 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G15169WU", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G15508AW", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01871-2", "residue": "Asn", "start_pos": 209, "end_pos": 209 }, { "glytoucan_ac": "G02030ZB", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01877-2", "residue": "Asn", "start_pos": 205, "end_pos": 205 }, { "glytoucan_ac": "G93656SY", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 }, { "glytoucan_ac": "G47518TP", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01591-1", "residue": "Asn", "start_pos": 71, "end_pos": 71 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01009-1", "residue": "Asn", "start_pos": 271, "end_pos": 271 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 156, "end_pos": 156 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02765-1", "residue": "Asn", "start_pos": 176, "end_pos": 176 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00734-1", "residue": "Asn", "start_pos": 121, "end_pos": 121 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 432, "end_pos": 432 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02787-1", "residue": "Asn", "start_pos": 630, "end_pos": 630 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 56, "end_pos": 56 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 33, "end_pos": 33 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P43652-1", "residue": "Asn", "start_pos": 402, "end_pos": 402 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 184, "end_pos": 184 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00738-1", "residue": "Asn", "start_pos": 241, "end_pos": 241 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 187, "end_pos": 187 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02790-1", "residue": "Asn", "start_pos": 453, "end_pos": 453 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P01008-1", "residue": "Asn", "start_pos": 224, "end_pos": 224 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 138, "end_pos": 138 }, { "glytoucan_ac": "G48414YA", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P00450-1", "residue": "Asn", "start_pos": 397, "end_pos": 397 }, { "glytoucan_ac": "G39595FH", "abundance": "", "tissue": { "name": "blood serum", "namespace": "UBERON", "id": "0001977", "url": "http://purl.obolibrary.org/obo/UBERON_0001977" }, "species": { "name": "Homo sapiens", "taxid": 9606, "reference_species": "Homo sapiens [9606]", "common_name": "Human", "glygen_name": "Human" }, "cell_line": {}, "uniprot_canonical_ac": "P02763-1", "residue": "Asn", "start_pos": 93, "end_pos": 93 } ], "record_id": "pubmed.24841998", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 98 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 231 }, { "field": "total_sites", "count": 25 }, { "field": "n_linked_sites", "count": 25 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 25 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 95 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 25 }, { "field": "exact_n_linked_sites", "count": 25 }, { "field": "exact_n_linked_glycan_sites", "count": 25 }, { "field": "exact_n_linked_glycans", "count": 95 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 229 }, { "field": "total_sites", "count": 25 }, { "field": "n_linked_sites", "count": 25 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 25 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 95 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 25 }, { "field": "exact_n_linked_sites", "count": 25 }, { "field": "exact_n_linked_glycan_sites", "count": 25 }, { "field": "exact_n_linked_glycans", "count": 95 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] } ] }, { "title": "In situ-generated thrombin is the only enzyme that effectively activates factor VIII and factor V in thromboplastin-activated plasma.", "journal": "Blood", "date": "1989", "authors": "Pieters J, Lindhout T, Hemker HC", "reference": { "type": "PubMed", "id": "2502206", "url": "https://pubmed.ncbi.nlm.nih.gov/2502206" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2502206", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential proteolytic activation of factor VIII-von Willebrand factor complex by thrombin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Hill-Eubanks DC, Parker CG, Lollar P", "reference": { "type": "PubMed", "id": "2505252", "url": "https://pubmed.ncbi.nlm.nih.gov/2505252" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2505252", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein C Thr315Ala variant results in gain of function but manifests as type II deficiency in diagnostic assays.", "journal": "Blood", "date": "2015", "authors": "Ding Q, Yang L, Dinarvand P, Wang X, Rezaie AR", "reference": { "type": "PubMed", "id": "25651845", "url": "https://pubmed.ncbi.nlm.nih.gov/25651845" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 315, "start_aa": "Thr", "end_pos": 315, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr315", "evidence": [ { "id": "25651845", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/25651845" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000010000.00000000001000.00.01001", "uniprot_canonical_ac": "P00734-1" } ], "record_id": "pubmed.25651845", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "GGCX and VKORC1 inhibit osteocalcin endocrine functions.", "journal": "The Journal of cell biology", "date": "2015", "authors": "Ferron M, Lacombe J, Germain A, Oury F, Karsenty G", "reference": { "type": "PubMed", "id": "25753038", "url": "https://pubmed.ncbi.nlm.nih.gov/25753038" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02818-1", "protein_name": "Osteocalcin", "gene_name": "BGLAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38435-1", "protein_name": "Vitamin K-dependent gamma-carboxylase", "gene_name": "GGCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22891-1", "protein_name": "Vitamin K-dependent protein Z", "gene_name": "PROZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08709-1", "protein_name": "Coagulation factor VII", "gene_name": "F7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25753038", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The refined 1.9 A crystal structure of human alpha-thrombin: interaction with D-Phe-Pro-Arg chloromethylketone and significance of the Tyr-Pro-Pro-Trp insertion segment.", "journal": "EMBO J.", "date": "1989", "authors": "Bode W, Mayr I, Baumann U, Huber R, Stone S R, Hofsteenge J", "reference": { "type": "PubMed", "id": "2583108", "url": "https://pubmed.ncbi.nlm.nih.gov/2583108" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2583108", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epitope characterization of an anti-PIVKA-II antibody and evaluation of a fully automated chemiluminescent immunoassay for PIVKA-II.", "journal": "Clinical biochemistry", "date": "2015-11", "authors": "Kinukawa Hideki, Shirakawa Takuma, Yoshimura Toru", "reference": { "type": "PubMed", "id": "26297114", "url": "https://pubmed.ncbi.nlm.nih.gov/26297114" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26297114", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Factor VIII Is Synthesized in Human Endothelial Cells, Packaged in Weibel-Palade Bodies and Secreted Bound to ULVWF Strings.", "journal": "PloS one", "date": "2015", "authors": "Turner NA, Moake JL", "reference": { "type": "PubMed", "id": "26473492", "url": "https://pubmed.ncbi.nlm.nih.gov/26473492" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26473492", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Osteocalcin and matrix Gla protein: vitamin K-dependent proteins in bone.", "journal": "Physiological reviews", "date": "1989", "authors": "Hauschka PV, Lian JB, Cole DE, Gundberg CM", "reference": { "type": "PubMed", "id": "2664828", "url": "https://pubmed.ncbi.nlm.nih.gov/2664828" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02818-1", "protein_name": "Osteocalcin", "gene_name": "BGLAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38435-1", "protein_name": "Vitamin K-dependent gamma-carboxylase", "gene_name": "GGCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22891-1", "protein_name": "Vitamin K-dependent protein Z", "gene_name": "PROZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08709-1", "protein_name": "Coagulation factor VII", "gene_name": "F7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2664828", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amino acid sequence of human prothrombin fragments 1 and 2.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1977", "authors": "Walz DA, Hewett-Emmett D, Seegers WH", "reference": { "type": "PubMed", "id": "266717", "url": "https://pubmed.ncbi.nlm.nih.gov/266717" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.266717", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plasmin is a natural trigger for bradykinin production in patients with hereditary angioedema with factor XII mutations.", "journal": "The Journal of allergy and clinical immunology", "date": "2016", "authors": "de Maat S, Bjorkqvist J, Suffritti C, Wiesenekker CP, Nagtegaal W, Koekman A, van Dooremalen S, Pasterkamp G, de Groot PG, Cicardi M, Renne T, Maas C", "reference": { "type": "PubMed", "id": "27130860", "url": "https://pubmed.ncbi.nlm.nih.gov/27130860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03952-1", "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00748-1", "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27130860", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Substitution of valine for glycine-558 in the congenital dysthrombin thrombin Quick II alters primary substrate specificity.", "journal": "Biochemistry", "date": "1989", "authors": "Henriksen RA, Mann KG", "reference": { "type": "PubMed", "id": "2719946", "url": "https://pubmed.ncbi.nlm.nih.gov/2719946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2719946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coagulation Factor XIIIA Subunit Missense Mutations Affect Structure and Function at the Various Steps of Factor XIII Action.", "journal": "Human mutation", "date": "2016", "authors": "Thomas A, Biswas A, Dodt J, Philippou H, Hethershaw E, Ensikat HJ, Ivaskevicius V, Oldenburg J", "reference": { "type": "PubMed", "id": "27363989", "url": "https://pubmed.ncbi.nlm.nih.gov/27363989" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02671-1", "protein_name": "Fibrinogen alpha chain", "gene_name": "FGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02679-1", "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05160-1", "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08514-1", "protein_name": "Integrin alpha-IIb", "gene_name": "ITGA2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02675-1", "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05106-1", "protein_name": "Integrin beta-3", "gene_name": "ITGB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00488-1", "protein_name": "Coagulation factor XIII A chain", "gene_name": "F13A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27363989", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Factor IX San Dimas. Substitution of glutamine for Arg-4 in the propeptide leads to incomplete gamma-carboxylation and altered phospholipid binding properties.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Ware J, Diuguid DL, Liebman HA, Rabiet MJ, Kasper CK, Furie BC, Furie B, Stafford DW", "reference": { "type": "PubMed", "id": "2738071", "url": "https://pubmed.ncbi.nlm.nih.gov/2738071" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14393-2", "protein_name": "Growth arrest-specific protein 6", "gene_name": "GAS6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02818-1", "protein_name": "Osteocalcin", "gene_name": "BGLAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38435-1", "protein_name": "Vitamin K-dependent gamma-carboxylase", "gene_name": "GGCX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22891-1", "protein_name": "Vitamin K-dependent protein Z", "gene_name": "PROZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08709-1", "protein_name": "Coagulation factor VII", "gene_name": "F7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2738071", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "High-resolution NMR studies of fibrinogen-like peptides in solution: interaction of thrombin with residues 1-23 of the A alpha chain of human fibrinogen.", "journal": "Biochemistry", "date": "1989", "authors": "Ni F, Konishi Y, Frazier RB, Scheraga HA, Lord ST", "reference": { "type": "PubMed", "id": "2742826", "url": "https://pubmed.ncbi.nlm.nih.gov/2742826" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02671-1", "protein_name": "Fibrinogen alpha chain", "gene_name": "FGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02679-1", "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05160-1", "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08514-1", "protein_name": "Integrin alpha-IIb", "gene_name": "ITGA2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02675-1", "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05106-1", "protein_name": "Integrin beta-3", "gene_name": "ITGB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00488-1", "protein_name": "Coagulation factor XIII A chain", "gene_name": "F13A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2742826", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteomics Analysis of O-GalNAc Glycosylation in Human Serum by an Integrated Strategy.", "journal": "Analytical chemistry", "date": "2017", "authors": "Qin H, Cheng K, Zhu J, Mao J, Wang F, Dong M, Chen R, Guo Z, Liang X, Ye M, Zou H", "reference": { "type": "PubMed", "id": "28035807", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, "referenced_glycans": [ { "glytoucan_ac": "G57321FI" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04180-1", "protein_name": "Phosphatidylcholine-sterol acyltransferase", "gene_name": "LCAT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09666-1", "protein_name": "Neuroblast differentiation-associated protein AHNAK", "gene_name": "AHNAK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q712K3-1", "protein_name": "Ubiquitin-conjugating enzyme E2 R2", "gene_name": "UBE2R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04114-1", "protein_name": "Apolipoprotein B-100", "gene_name": "APOB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02765-1", "protein_name": "Alpha-2-HS-glycoprotein", "gene_name": "AHSG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96C57-1", "protein_name": "Protein CUSTOS", "gene_name": "C12orf43; CUSTOS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05160-1", "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04264-1", "protein_name": "Keratin, type II cytoskeletal 1", "gene_name": "KRT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13201-1", "protein_name": "Multimerin-1", "gene_name": "MMRN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXB8-1", "protein_name": "Peptidase inhibitor 16", "gene_name": "PI16", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13790-1", "protein_name": "Apolipoprotein F", "gene_name": "APOF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02656-1", "protein_name": "Apolipoprotein C-III", "gene_name": "APOC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02649-1", "protein_name": "Apolipoprotein E", "gene_name": "APOE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07996-1", "protein_name": "Thrombospondin-1", "gene_name": "THBS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00450-1", "protein_name": "Ceruloplasmin", "gene_name": "CP", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0C0L5-1", "protein_name": "Complement C4-B", "gene_name": "C4B_2; C4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03952-1", "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05155-1", "protein_name": "Plasma protease C1 inhibitor", "gene_name": "SERPING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78423-1", "protein_name": "Fractalkine", "gene_name": "CX3CL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01860-2", "protein_name": "Immunoglobulin heavy constant gamma 3", "gene_name": "IGHG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01876-2", "protein_name": "Immunoglobulin heavy constant alpha 1", "gene_name": "IGHA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35442-1", "protein_name": "Thrombospondin-2", "gene_name": "THBS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02749-1", "protein_name": "Beta-2-glycoprotein 1", "gene_name": "APOH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06727-1", "protein_name": "Apolipoprotein A-IV", "gene_name": "APOA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00747-1", "protein_name": "Plasminogen", "gene_name": "PLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02768-1", "protein_name": "Albumin", "gene_name": "ALB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02786-1", "protein_name": "Transferrin receptor protein 1", "gene_name": "TFRC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10643-1", "protein_name": "Complement component C7", "gene_name": "C7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01042-1", "protein_name": "Kininogen-1", "gene_name": "KNG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZP8-1", "protein_name": "Complement C1r subcomponent-like protein", "gene_name": "C1RL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04004-1", "protein_name": "Vitronectin", "gene_name": "VTN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00748-1", "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14515-1", "protein_name": "SPARC-like protein 1", "gene_name": "SPARCL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13727-1", "protein_name": "Bone marrow proteoglycan", "gene_name": "PRG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04756-1", "protein_name": "Hepatocyte growth factor activator serine protease", "gene_name": "HGFAC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02790-1", "protein_name": "Hemopexin", "gene_name": "HPX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04196-1", "protein_name": "Histidine-rich glycoprotein", "gene_name": "HRG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01834-1", "protein_name": "Immunoglobulin kappa constant", "gene_name": "IGKC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25311-1", "protein_name": "Zinc-alpha-2-glycoprotein", "gene_name": "AZGP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWG1-1", "protein_name": "Dynein axonemal intermediate chain 3", "gene_name": "DNAI3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24592-1", "protein_name": "Insulin-like growth factor-binding protein 6", "gene_name": "IGFBP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUN1-1", "protein_name": "Protein MENT", "gene_name": "MENT", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01023-1", "protein_name": "Alpha-2-macroglobulin", "gene_name": "A2M", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02647-1", "protein_name": "Apolipoprotein A-I", "gene_name": "APOA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SEGSSVNLSPPLEQCVPDR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 199, "start_aa": "Ser", "end_pos": 217, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00734-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QGPPASPTASPEPPPPE", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 424, "start_aa": "Gln", "end_pos": 440, "end_aa": "Glu", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P04180-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "MKGNVDISAPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1081, "start_aa": "Met", "end_pos": 1091, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q09666-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AQQQMTSSQK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2, "start_aa": "Ala", "end_pos": 11, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q712K3-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NNALDFVTK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 3213, "start_aa": "Asn", "end_pos": 3221, "end_aa": "Lys", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P04114-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NNALDFVTKSYNETK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 3213, "start_aa": "Asn", "end_pos": 3227, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P04114-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVVQPSVGAAAGPVVPPCPGR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 341, "start_aa": "Thr", "end_pos": 361, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P02765-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EKEESPQPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 134, "start_aa": "Glu", "end_pos": 142, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q96C57-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QSTLSYQEPLRT", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 650, "start_aa": "Gln", "end_pos": 661, "end_aa": "Thr", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05160-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "MSGECAPNVSVSVSTSHTTISGGGSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 493, "start_aa": "Met", "end_pos": 518, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P04264-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NQTLTSTEKAEGVVK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 97, "start_aa": "Asn", "end_pos": 111, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "Q13201-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SADKVTDKTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 318, "start_aa": "Ser", "end_pos": 327, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q6UXB8-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SGVQQLIQYYQDQKDANISQPETTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 251, "start_aa": "Ser", "end_pos": 275, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q13790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SGVQQLIQYYQDQKDANISQPETTKEGLR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 251, "start_aa": "Ser", "end_pos": 279, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q13790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DANISQPETTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 265, "start_aa": "Asp", "end_pos": 275, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q13790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DANISQPETTKEGLR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 265, "start_aa": "Asp", "end_pos": 279, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q13790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DKFSEFWDLDPEVRPTSAVAA", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 79, "start_aa": "Asp", "end_pos": 99, "end_aa": "Ala", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02656-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FSEFWDLDPEVRPTSAVAA", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 81, "start_aa": "Phe", "end_pos": 99, "end_aa": "Ala", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02656-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TVGS", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 212, "start_aa": "Thr", "end_pos": 215, "end_aa": "Ser", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01100", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VQAAVGTSAAPVPSDNH", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 301, "start_aa": "Val", "end_pos": 317, "end_aa": "His", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QQTEWQSGQR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 34, "start_aa": "Gln", "end_pos": 43, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02649-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "KVNCTTQPCPTAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2288, "start_aa": "Lys", "end_pos": 2300, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P04275-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "KVNCTTQPCPTAKAPTCGLCEVAR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 2288, "start_aa": "Lys", "end_pos": 2311, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P04275-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CGACPPGYSGNGIQCTDVDECK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 572, "start_aa": "Cys", "end_pos": 593, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P07996-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EHEGAIYPDNTTDFQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 129, "start_aa": "Glu", "end_pos": 144, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EHEGAIYPDNTTDFQRADDK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 129, "start_aa": "Glu", "end_pos": 148, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NNEGTYYSPNYNPQSR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 485, "start_aa": "Asn", "end_pos": 500, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P00450-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GVAHNNLMAMAQETGDNLYWGSVTGSQSNAVSPTPAPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1211, "start_aa": "Gly", "end_pos": 1248, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P0C0L5-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LCNTGDNSVCTTK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Leu", "end_pos": 386, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P03952-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LCNTGDNSVCTTKTSTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 374, "start_aa": "Leu", "end_pos": 390, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P03952-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "RVEDLHVGATVAPSSRR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 30, "start_aa": "Arg", "end_pos": 46, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05154-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VEDLHVGATVAPSSR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 31, "start_aa": "Val", "end_pos": 45, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05154-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ASSNPNATSSSSQDPESLQDR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 20, "start_aa": "Ala", "end_pos": 40, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ASSNPNATSSSSQDPESLQDRGEGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 20, "start_aa": "Ala", "end_pos": 44, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GEGKVATTVISK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 41, "start_aa": "Gly", "end_pos": 52, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VATTVISK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 45, "start_aa": "Val", "end_pos": 52, "end_aa": "Lys", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "MLFVEPILEVSSLPTTNSTTNSATK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Met", "end_pos": 77, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05155-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AQDGGPVGTELFR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 175, "start_aa": "Ala", "end_pos": 187, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P78423-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CPEPKSCDTPPPCPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 114, "start_aa": "Cys", "end_pos": 128, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CPEPKSCDTPPPCPRCPEPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 114, "start_aa": "Cys", "end_pos": 133, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SCDTPPPCPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 119, "start_aa": "Ser", "end_pos": 128, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SCDTPPPCPRCPEPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 119, "start_aa": "Ser", "end_pos": 133, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SCDTPPPCPRCPEPKSCDTPPPCPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 119, "start_aa": "Ser", "end_pos": 143, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01860-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "HYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "His", "end_pos": 126, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01876-2" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "KGCQQGQGAEINAISENTETLR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 224, "start_aa": "Lys", "end_pos": 245, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P35442-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QYVDGDQCESNPCLNGGSCK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Gln", "end_pos": 109, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00740-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TCPKPDDLPFSTVVPLK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 22, "start_aa": "Thr", "end_pos": 38, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02749-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ENADSLQASLRPHADELK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 170, "start_aa": "Glu", "end_pos": 187, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P06727-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CTTPPPSSGPTYQCLK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 262, "start_aa": "Cys", "end_pos": 277, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00747-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 349, "start_aa": "Ile", "end_pos": 386, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00747-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TCVADESAENCDK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 76, "start_aa": "Thr", "end_pos": 88, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02768-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LAGTESPVREEPGEDFPAAR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 101, "start_aa": "Leu", "end_pos": 120, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02786-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CVQKENPLTQAVPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 688, "start_aa": "Cys", "end_pos": 701, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P10643-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "CVQKENPLTQAVPKCQR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 688, "start_aa": "Cys", "end_pos": 704, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P10643-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ENPLTQAVPK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 692, "start_aa": "Glu", "end_pos": 701, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P10643-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SSSPELSEMLEYDR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 1148, "start_aa": "Ser", "end_pos": 1161, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01011", "uniprot_canonical_ac": "P12259-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "FTVNNLAEPQKAPSHQQATTAGSPLR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 786, "start_aa": "Phe", "end_pos": 811, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P12259-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "APSHQQATTAGSPLR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 797, "start_aa": "Ala", "end_pos": 811, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P12259-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IGEIKEETTVSPPHTSMAPAQDEER", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 393, "start_aa": "Ile", "end_pos": 417, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "IGEIKEETTVSPPHTSMAPAQDEERDSGK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 393, "start_aa": "Ile", "end_pos": 421, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EETTVSPPHTSMAPAQDEER", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 398, "start_aa": "Glu", "end_pos": 417, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "EETTVSPPHTSMAPAQDEERDSGKEQGHTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 398, "start_aa": "Glu", "end_pos": 427, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DSGKEQGHTR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 418, "start_aa": "Asp", "end_pos": 427, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TEHLASSSEDSTTPSAQTQEK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 521, "start_aa": "Thr", "end_pos": 541, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SVSEINPTTQMK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 621, "start_aa": "Ser", "end_pos": 632, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01042-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VQNHCQEPYYQAAAAGALTCATPGTWK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 191, "start_aa": "Val", "end_pos": 217, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q9NZP8-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NNATVHEQVGGPSLTSDLQAQSK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 85, "start_aa": "Asn", "end_pos": 107, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P04004-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LSWEYCDLAQCQTPTQAAPPTPVSPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 285, "start_aa": "Leu", "end_pos": 310, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00748-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LHVPLMPAQPAPPKPQPTTRTPPQSQTPGALPAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 311, "start_aa": "Leu", "end_pos": 344, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00748-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TPPQSQTPGALPAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 331, "start_aa": "Thr", "end_pos": 344, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00748-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "TPPQSQTPGALPAKR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 331, "start_aa": "Thr", "end_pos": 345, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P00748-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QEEDNTQSDDILEESDQPTQVSK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 233, "start_aa": "Gln", "end_pos": 255, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q14515-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VHENENIGTTEPGEHQEAK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 390, "start_aa": "Val", "end_pos": 408, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q14515-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "QSTNAYPDLR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 102, "start_aa": "Gln", "end_pos": 111, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P07225-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SETSTFETPLGAK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 21, "start_aa": "Ser", "end_pos": 33, "end_aa": "Lys", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P13727-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "AVPSSSSPQAQALTEDGRPCR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 89, "start_aa": "Ala", "end_pos": 109, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q04756-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "NGTGHGNSTHHGPEYMR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 240, "start_aa": "Asn", "end_pos": 256, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01000", "uniprot_canonical_ac": "P02790-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SSTTKPPFKPHGSR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Ser", "end_pos": 284, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SSTTKPPFKPHGSRDHHHPHKPHEHGPPPPPDER", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 271, "start_aa": "Ser", "end_pos": 304, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.01001", "uniprot_canonical_ac": "P04196-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "GGETAQSADPQWEQLNNK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 31, "start_aa": "Gly", "end_pos": 48, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P05546-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "VQWKVDNALQSGNSQESVTEQDSK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 39, "start_aa": "Val", "end_pos": 62, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.00001", "uniprot_canonical_ac": "P01834-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "DIVEYYNDSNGSHVLQGR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asp", "end_pos": 120, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P25311-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "WTYPKNATTQYYPR", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 247, "start_aa": "Trp", "end_pos": 260, "end_aa": "Arg", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q8IWG1-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ESKPQAGTARPQDVNR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 119, "start_aa": "Glu", "end_pos": 134, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P24592-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ESKPQAGTARPQDVNRR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 119, "start_aa": "Glu", "end_pos": 135, "end_aa": "Arg", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P24592-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "SSPSLPPASPCPALAFWK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Ser", "end_pos": 313, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "Q9BUN1-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "LLLQQVSLPELPGEYSMK", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 1298, "start_aa": "Leu", "end_pos": 1315, "end_aa": "Lys", "evidence": [ { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P01023-1" }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "ATEHLSTLSEK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "icn3d_view": {}, "start_pos": 220, "start_aa": "Ala", "end_pos": 230, "end_aa": "Lys", "evidence": [ { "id": "23584533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23584533" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://doi.org/10.1038/emboj.2013.79" }, { "id": "28035807", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28035807" }, { "id": "10.1021/acs.analchem.6b02887", "database": "DOI", "url": "https://doi.org/10.1021/acs.analchem.6b02887" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.0100000000.010100100011111110.10000.xxxxx", "uniprot_canonical_ac": "P02647-1" } ], "record_id": "pubmed.28035807", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 51 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 88 }, { "field": "total_sites", "count": 88 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 88 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 88 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 88 }, { "field": "exact_o_linked_sites", "count": 88 }, { "field": "exact_o_linked_glycan_sites", "count": 88 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 88 }, { "field": "total_sites", "count": 88 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 88 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 88 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 88 }, { "field": "exact_o_linked_sites", "count": 88 }, { "field": "exact_o_linked_glycan_sites", "count": 88 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequence of the gene for human prothrombin.", "journal": "Biochemistry", "date": "1987", "authors": "Degen S J, Davie E W", "reference": { "type": "PubMed", "id": "2825773", "url": "https://pubmed.ncbi.nlm.nih.gov/2825773" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2825773", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Synthetic peptides bind to high-affinity thrombin receptors and modulate thrombin mitogenesis.", "journal": "Peptide research", "date": "1988", "authors": "Glenn K C, Frost G H, Bergmann J S, Carney D H", "reference": { "type": "PubMed", "id": "2856554", "url": "https://pubmed.ncbi.nlm.nih.gov/2856554" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2856554", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analyses yield detailed insight into the mechanism of thrombin inhibition by the antihemostatic salivary protein cE5 from Anopheles gambiae.", "journal": "J. Biol. Chem.", "date": "2017", "authors": "Pirone Luciano, Ripoll-Rozada Jorge, Leone Marilisa, Ronca Raffaele, Lombardo Fabrizio, Fiorentino Gabriella, Andersen John F, Pereira Pedro Jos\u00e9 Barbosa, Arc\u00e0 Bruno, Pedone Emilia", "reference": { "type": "PubMed", "id": "28592490", "url": "https://pubmed.ncbi.nlm.nih.gov/28592490" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28592490", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of formation of factor XIIIa by its fibrin substrates.", "journal": "Biochemistry", "date": "1985", "authors": "Lewis SD, Janus TJ, Lorand L, Shafer JA", "reference": { "type": "PubMed", "id": "2866798", "url": "https://pubmed.ncbi.nlm.nih.gov/2866798" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02671-1", "protein_name": "Fibrinogen alpha chain", "gene_name": "FGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02679-1", "protein_name": "Fibrinogen gamma chain", "gene_name": "FGG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05160-1", "protein_name": "Coagulation factor XIII B chain", "gene_name": "F13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08514-1", "protein_name": "Integrin alpha-IIb", "gene_name": "ITGA2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02675-1", "protein_name": "Fibrinogen beta chain", "gene_name": "FGB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05106-1", "protein_name": "Integrin beta-3", "gene_name": "ITGB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00488-1", "protein_name": "Coagulation factor XIII A chain", "gene_name": "F13A1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2866798", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An update on factor XI structure and function.", "journal": "Thrombosis research", "date": "2018", "authors": "Mohammed BM, Matafonov A, Ivanov I, Sun MF, Cheng Q, Dickeson SK, Li C, Sun D, Verhamme IM, Emsley J, Gailani D", "reference": { "type": "PubMed", "id": "29223926", "url": "https://pubmed.ncbi.nlm.nih.gov/29223926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29223926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of coagulation factor XI to washed human platelets.", "journal": "Biochemistry", "date": "1986", "authors": "Greengard JS, Heeb MJ, Ersdal E, Walsh PN, Griffin JH", "reference": { "type": "PubMed", "id": "3017409", "url": "https://pubmed.ncbi.nlm.nih.gov/3017409" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3017409", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Factor XII truncation accelerates activation in solution.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2019", "authors": "de Maat S, Clark CC, Boertien M, Parr N, Sanrattana W, Hofman ZLM, Maas C", "reference": { "type": "PubMed", "id": "30394658", "url": "https://pubmed.ncbi.nlm.nih.gov/30394658" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03952-1", "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00748-1", "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30394658", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TAK-442, a Direct Factor Xa Inhibitor, Inhibits Monocyte Chemoattractant Protein 1 Production in Endothelial Cells via Involvement of Protease-Activated Receptor 1.", "journal": "Frontiers in pharmacology", "date": "2018", "authors": "Shinozawa Emiko, Nakayama Masaharu, Imura Yoshimi", "reference": { "type": "PubMed", "id": "30568593", "url": "https://pubmed.ncbi.nlm.nih.gov/30568593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25116-1", "protein_name": "Proteinase-activated receptor 1", "gene_name": "F2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13500-1", "protein_name": "C-C motif chemokine 2", "gene_name": "CCL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30568593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mechanism for hereditary angioedema with normal C1 inhibitor: an inhibitory regulatory role for the factor XII heavy chain.", "journal": "Blood", "date": "2019", "authors": "Ivanov I, Matafonov A, Sun MF, Mohammed BM, Cheng Q, Dickeson SK, Kundu S, Verhamme IM, Gruber A, McCrae K, Gailani D", "reference": { "type": "PubMed", "id": "30591525", "url": "https://pubmed.ncbi.nlm.nih.gov/30591525" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03952-1", "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00748-1", "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30591525", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteolytic processing of human factor VIII. Correlation of specific cleavages by thrombin, factor Xa, and activated protein C with activation and inactivation of factor VIII coagulant activity.", "journal": "Biochemistry", "date": "1986", "authors": "Eaton D, Rodriguez H, Vehar GA", "reference": { "type": "PubMed", "id": "3082357", "url": "https://pubmed.ncbi.nlm.nih.gov/3082357" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3082357", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Synthesis, processing, and secretion of recombinant human factor VIII expressed in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Kaufman RJ, Wasley LC, Dorner AJ", "reference": { "type": "PubMed", "id": "3129422", "url": "https://pubmed.ncbi.nlm.nih.gov/3129422" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3129422", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of the factor VIII light chain with von Willebrand factor.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Lollar P, Hill-Eubanks DC, Parker CG", "reference": { "type": "PubMed", "id": "3134349", "url": "https://pubmed.ncbi.nlm.nih.gov/3134349" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3134349", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the primary structural defect in the dysthrombin thrombin Quick I: substitution of cysteine for arginine-382.", "journal": "Biochemistry", "date": "1988", "authors": "Henriksen RA, Mann KG", "reference": { "type": "PubMed", "id": "3242619", "url": "https://pubmed.ncbi.nlm.nih.gov/3242619" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3242619", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteinase-activated receptor 1: A target for repurposing in the treatment of COVID-19?", "journal": "British journal of pharmacology", "date": "2020", "authors": "Sriram K, Insel PA", "reference": { "type": "PubMed", "id": "32639031", "url": "https://pubmed.ncbi.nlm.nih.gov/32639031" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28482-1", "protein_name": "Mitogen-activated protein kinase 1", "gene_name": "MAPK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50148-1", "protein_name": "Guanine nucleotide-binding protein G(q) subunit alpha", "gene_name": "GNAQ", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62873-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1", "gene_name": "GNB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63211-1", "protein_name": "Guanine nucleotide-binding protein G(T) subunit gamma-T1", "gene_name": "GNGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59768-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2", "gene_name": "GNG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60262-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7", "gene_name": "GNG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50150-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-4", "gene_name": "GNG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50151-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10", "gene_name": "GNG10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q03113-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-12", "gene_name": "GNA12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W3-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13", "gene_name": "GNG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25116-1", "protein_name": "Proteinase-activated receptor 1", "gene_name": "F2R", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14344-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-13", "gene_name": "GNA13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96RI0-1", "protein_name": "Proteinase-activated receptor 4", "gene_name": "F2RL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95837-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-14", "gene_name": "GNA14", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32121-1", "protein_name": "Beta-arrestin-2", "gene_name": "ARRB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49407-1", "protein_name": "Beta-arrestin-1", "gene_name": "ARRB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63218-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5", "gene_name": "GNG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UK08-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-8", "gene_name": "GNG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBI6-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12", "gene_name": "GNG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00254-1", "protein_name": "Proteinase-activated receptor 3", "gene_name": "F2RL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27361-1", "protein_name": "Mitogen-activated protein kinase 3", "gene_name": "MAPK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61952-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-11", "gene_name": "GNG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62879-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2", "gene_name": "GNB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63215-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3", "gene_name": "GNG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29992-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-11", "gene_name": "GNA11", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14610-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "GNGT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30679-1", "protein_name": "Guanine nucleotide-binding protein subunit alpha-15", "gene_name": "GNA15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32639031", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 31 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Iripin-3, a New Salivary Protein Isolated From Ixodes ricinus Ticks, Displays Immunomodulatory and Anti-Hemostatic Properties In Vitro.", "journal": "Front. Immunol.", "date": "2021", "authors": "Chlast\u00e1kov\u00e1 Ad\u00e9la, Kot\u00e1l Jan, Ber\u00e1nkov\u00e1 Zuzana, Ka\u0161\u010d\u00e1kov\u00e1 Barbora, Martins Larissa Almeida, Langhansov\u00e1 Helena, Prudnikova Tatyana, Ederov\u00e1 Monika, Kut\u00e1 Smatanov\u00e1 Ivana, Kotsyfakis Michail, Chmela\u0159 Jind\u0159ich", "reference": { "type": "PubMed", "id": "33732248", "url": "https://pubmed.ncbi.nlm.nih.gov/33732248" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03952-1", "protein_name": "Plasma kallikrein", "gene_name": "KLKB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5Y6-1", "protein_name": "Suppressor of tumorigenicity 14 protein", "gene_name": "ST14", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33732248", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of sequence and position of the cleavage sites in prothrombin activation.", "journal": "The Journal of biological chemistry", "date": "2021-08", "authors": "Stojanovski Bosko M, Di Cera Enrico", "reference": { "type": "PubMed", "id": "34265300", "url": "https://pubmed.ncbi.nlm.nih.gov/34265300" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 314, "end_pos": 314, "sequence_org": "R", "sequence_mut": "Q", "comment": "Loss of cleavage by factor Xa.", "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" }, { "database": "PubMed", "id": "34265300", "url": "https://pubmed.ncbi.nlm.nih.gov/34265300" } ], "uniprot_canonical_ac": "P00734-1" }, { "start_pos": 363, "end_pos": 363, "sequence_org": "R", "sequence_mut": "Q", "comment": "Loss of cleavage by factor Xa.", "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" }, { "database": "PubMed", "id": "34265300", "url": "https://pubmed.ncbi.nlm.nih.gov/34265300" } ], "uniprot_canonical_ac": "P00734-1" }, { "start_pos": 568, "end_pos": 568, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of catalytic activity; no effect on cleavage at R-198 by factor Xa.", "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" }, { "database": "PubMed", "id": "34265300", "url": "https://pubmed.ncbi.nlm.nih.gov/34265300" } ], "uniprot_canonical_ac": "P00734-1" } ], "record_id": "pubmed.34265300", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ixodes ricinus Salivary Serpin Iripin-8 Inhibits the Intrinsic Pathway of Coagulation and Complement.", "journal": "Int. J. Mol. Sci.", "date": "2021", "authors": "Kot\u00e1l Jan, Polderdijk St\u00e9phanie G I, Langhansov\u00e1 Helena, Ederov\u00e1 Monika, Martins Larissa A, Ber\u00e1nkov\u00e1 Zuzana, Chlast\u00e1kov\u00e1 Ad\u00e9la, Hajdu\u0161ek Ond\u0159ej, Kotsyfakis Michail, Huntington James A, Chmela\u0159 Jind\u0159ich", "reference": { "type": "PubMed", "id": "34502392", "url": "https://pubmed.ncbi.nlm.nih.gov/34502392" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00747-1", "protein_name": "Plasminogen", "gene_name": "PLG", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00748-1", "protein_name": "Coagulation factor XII", "gene_name": "F12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08709-1", "protein_name": "Coagulation factor VII", "gene_name": "F7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34502392", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a substrate-like cleavage-resistant thrombin inhibitor from the saliva of the flea Xenopsylla cheopis.", "journal": "J. Biol. Chem.", "date": "2021", "authors": "Lu Stephen, Tirloni Lucas, Oliveira Markus Berger, Bosio Christopher F, Nardone Glenn A, Zhang Yixiang, Hinnebusch B Joseph, Ribeiro Jos\u00e9 M, Andersen John F", "reference": { "type": "PubMed", "id": "34688666", "url": "https://pubmed.ncbi.nlm.nih.gov/34688666" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34688666", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Amino acid sequence of human von Willebrand factor.", "journal": "Biochemistry", "date": "1986", "authors": "Titani K, Kumar S, Takio K, Ericsson LH, Wade RD, Ashida K, Walsh KA, Chopek MW, Sadler JE, Fujikawa K", "reference": { "type": "PubMed", "id": "3524673", "url": "https://pubmed.ncbi.nlm.nih.gov/3524673" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc...) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 1263, "start_aa": "Ser", "end_pos": 1263, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1263", "evidence": [ { "id": "P04275", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P04275#ptm_processing" }, { "id": "3524673", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/3524673" }, { "id": "26784534", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26784534" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "P04275-1" } ], "record_id": "pubmed.3524673", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Prothrombin Tokushima, a replacement of arginine-418 by tryptophan that impairs the fibrinogen clotting activity of derived thrombin Tokushima.", "journal": "Biochemistry", "date": "1987", "authors": "Miyata T, Morita T, Inomoto T, Kawauchi S, Shirakami A, Iwanaga S", "reference": { "type": "PubMed", "id": "3567158", "url": "https://pubmed.ncbi.nlm.nih.gov/3567158" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3567158", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression, purification, and characterization of recombinant gamma-carboxylated factor IX synthesized in Chinese hamster ovary cells.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Kaufman RJ, Wasley LC, Furie BC, Furie B, Shoemaker CB", "reference": { "type": "PubMed", "id": "3733688", "url": "https://pubmed.ncbi.nlm.nih.gov/3733688" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01008-1", "protein_name": "Antithrombin-III", "gene_name": "SERPINC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07093-1", "protein_name": "Glia-derived nexin", "gene_name": "SERPINE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07359-1", "protein_name": "Platelet glycoprotein Ib alpha chain", "gene_name": "GP1BA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13224-1", "protein_name": "Platelet glycoprotein Ib beta chain", "gene_name": "GP1BB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04275-1", "protein_name": "von Willebrand factor", "gene_name": "VWF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05154-1", "protein_name": "Plasma serine protease inhibitor", "gene_name": "SERPINA5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P03951-1", "protein_name": "Coagulation factor XI", "gene_name": "F11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00740-1", "protein_name": "Coagulation factor IX", "gene_name": "F9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04070-1", "protein_name": "Vitamin K-dependent protein C", "gene_name": "PROC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07225-1", "protein_name": "Vitamin K-dependent protein S", "gene_name": "PROS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05546-1", "protein_name": "Heparin cofactor 2", "gene_name": "SERPIND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00742-1", "protein_name": "Coagulation factor X", "gene_name": "F10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14770-1", "protein_name": "Platelet glycoprotein IX", "gene_name": "GP9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40197-1", "protein_name": "Platelet glycoprotein V", "gene_name": "GP5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3733688", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prothrombin fragment 1 X 2 X 3, a major product of prothrombin activation in human plasma.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Rabiet MJ, Blashill A, Furie B, Furie BC", "reference": { "type": "PubMed", "id": "3759958", "url": "https://pubmed.ncbi.nlm.nih.gov/3759958" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P00734-1", "protein_name": "Prothrombin", "gene_name": "F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P00734", "url": "https://www.uniprot.org/uniprotkb/P00734" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3759958", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]