[ { "title": "The possible roles of AtERF71 in the defense response against the Fusarium graminearum.", "journal": "Plant biotechnology (Tokyo, Japan)", "date": "2018-09-25", "authors": "Yelli Fitri, Kato Tomoaki, Nishiuchi Takumi", "reference": { "type": "PubMed", "id": "31819723", "url": "https://pubmed.ncbi.nlm.nih.gov/31819723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22259-1", "protein_name": "Ethylene-responsive transcription factor ERF071", "gene_name": "ERF071", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22259", "url": "https://www.uniprot.org/uniprotkb/O22259" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.31819723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis transcription factor MYB12 is a flavonol-specific regulator of phenylpropanoid biosynthesis.", "journal": "Plant physiology", "date": "2005-06", "authors": "Mehrtens Frank, Kranz Harald, Bednarek Pawel, Weisshaar Bernd", "reference": { "type": "PubMed", "id": "15923334", "url": "https://pubmed.ncbi.nlm.nih.gov/15923334" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22264-1", "protein_name": "Transcription factor MYB12", "gene_name": "MYB12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22264", "url": "https://www.uniprot.org/uniprotkb/O22264" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15923334", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nitrogen deficiency enhances expression of specific MYB and bHLH transcription factors and accumulation of end products in the flavonoid pathway.", "journal": "Planta", "date": "2007", "authors": "Lea Unni S, Slimestad Rune, Smedvig P\u00e5l, Lillo Cathrine", "reference": { "type": "PubMed", "id": "17053893", "url": "https://pubmed.ncbi.nlm.nih.gov/17053893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22264-1", "protein_name": "Transcription factor MYB12", "gene_name": "MYB12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FN69-1", "protein_name": "Transcription factor GLABRA 3", "gene_name": "GL3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FE25-1", "protein_name": "Transcription factor MYB75", "gene_name": "MYB75", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZTC3-1", "protein_name": "Transcription factor MYB90", "gene_name": "MYB90", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22264", "url": "https://www.uniprot.org/uniprotkb/O22264" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17053893", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential regulation of closely related R2R3-MYB transcription factors controls flavonol accumulation in different parts of the Arabidopsis thaliana seedling.", "journal": "The Plant journal : for cell and molecular biology", "date": "2007-05", "authors": "Stracke Ralf, Ishihara Hirofumi, Huep Gunnar, Barsch Aiko, Mehrtens Frank, Niehaus Karsten, Weisshaar Bernd", "reference": { "type": "PubMed", "id": "17419845", "url": "https://pubmed.ncbi.nlm.nih.gov/17419845" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22264-1", "protein_name": "Transcription factor MYB12", "gene_name": "MYB12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FJ07-1", "protein_name": "Transcription factor MYB111", "gene_name": "MYB111", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZK4-1", "protein_name": "Transcription factor MYB11", "gene_name": "MYB11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22264", "url": "https://www.uniprot.org/uniprotkb/O22264" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17419845", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtMYB12 regulates caffeoyl quinic acid and flavonol synthesis in tomato: expression in fruit results in very high levels of both types of polyphenol.", "journal": "Plant J.", "date": "2008", "authors": "Luo Jie, Butelli Eugenio, Hill Lionel, Parr Adrian, Niggeweg Ricarda, Bailey Paul, Weisshaar Bernd, Martin Cathie", "reference": { "type": "PubMed", "id": "18643978", "url": "https://pubmed.ncbi.nlm.nih.gov/18643978" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22264-1", "protein_name": "Transcription factor MYB12", "gene_name": "MYB12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22264", "url": "https://www.uniprot.org/uniprotkb/O22264" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18643978", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis bZIP transcription factor HY5 regulates expression of the PFG1/MYB12 gene in response to light and ultraviolet-B radiation.", "journal": "Plant, cell & environment", "date": "2010-01", "authors": "Stracke Ralf, Favory Jean-Jacques, Gruber Henriette, Bartelniewoehner Lutz, Bartels Sebastian, Binkert Melanie, Funk Markus, Weisshaar Bernd, Ulm Roman", "reference": { "type": "PubMed", "id": "19895401", "url": "https://pubmed.ncbi.nlm.nih.gov/19895401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22264-1", "protein_name": "Transcription factor MYB12", "gene_name": "MYB12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FJ07-1", "protein_name": "Transcription factor MYB111", "gene_name": "MYB111", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZK4-1", "protein_name": "Transcription factor MYB11", "gene_name": "MYB11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22264", "url": "https://www.uniprot.org/uniprotkb/O22264" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19895401", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of transcriptome and metabolome of tobacco by Arabidopsis transcription factor, AtMYB12, leads to insect resistance.", "journal": "Plant Physiol.", "date": "2010", "authors": "Misra Prashant, Pandey Ashutosh, Tiwari Manish, Chandrashekar K, Sidhu Om Prakash, Asif Mehar Hasan, Chakrabarty Debasis, Singh Pradhyumna Kumar, Trivedi Prabodh Kumar, Nath Pravendra, Tuli Rakesh", "reference": { "type": "PubMed", "id": "20190095", "url": "https://pubmed.ncbi.nlm.nih.gov/20190095" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22264-1", "protein_name": "Transcription factor MYB12", "gene_name": "MYB12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22264", "url": "https://www.uniprot.org/uniprotkb/O22264" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20190095", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of PRODUCTION OF FLAVONOL GLYCOSIDES-dependent flavonol glycoside accumulation in Arabidopsis thaliana plants reveals MYB11-, MYB12- and MYB111-independent flavonol glycoside accumulation.", "journal": "The New phytologist", "date": "2010-12", "authors": "Stracke Ralf, Jahns Oliver, Keck Matthias, Tohge Takayuki, Niehaus Karsten, Fernie Alisdair R, Weisshaar Bernd", "reference": { "type": "PubMed", "id": "20731781", "url": "https://pubmed.ncbi.nlm.nih.gov/20731781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22264-1", "protein_name": "Transcription factor MYB12", "gene_name": "MYB12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FJ07-1", "protein_name": "Transcription factor MYB111", "gene_name": "MYB111", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZK4-1", "protein_name": "Transcription factor MYB11", "gene_name": "MYB11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22264", "url": "https://www.uniprot.org/uniprotkb/O22264" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20731781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chloroplast FtsY, chloroplast signal recognition particle, and GTP are required to reconstitute the soluble phase of light-harvesting chlorophyll protein transport into thylakoid membranes.", "journal": "The Journal of biological chemistry", "date": "1999-09-17", "authors": "Tu C J, Schuenemann D, Hoffman N E", "reference": { "type": "PubMed", "id": "10480939", "url": "https://pubmed.ncbi.nlm.nih.gov/10480939" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P37107-1", "protein_name": "Signal recognition particle subunit SRP54, chloroplastic", "gene_name": "FFC", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80842-1", "protein_name": "Cell division protein FtsY homolog, chloroplastic", "gene_name": "CPFTSY", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10480939", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of the protein-interacting domains of chloroplast SRP43.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Jonas-Straube E, Hutin C, Hoffman N E, Sch\u00fcnemann D", "reference": { "type": "PubMed", "id": "11306572", "url": "https://pubmed.ncbi.nlm.nih.gov/11306572" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11306572", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the GTPase cycle in post-translational signal recognition particle-based protein targeting involves cpSRP43.", "journal": "The Journal of biological chemistry", "date": "2004-10-08", "authors": "Goforth Robyn L, Peterson Eric C, Yuan Jianguo, Moore Misty J, Kight Alicia D, Lohse Matthew B, Sakon Joshua, Henry Ralph L", "reference": { "type": "PubMed", "id": "15292240", "url": "https://pubmed.ncbi.nlm.nih.gov/15292240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15292240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three-dimensional solution structures of the chromodomains of cpSRP43.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Sivaraja Vaithiyalingam, Kumar Thallapuranam Krishnaswamy Suresh, Leena Philominathan Sagaya Theresa, Chang An-ni, Vidya Chitturi, Goforth Robyn L, Rajalingam Dakshinamurthy, Arvind Kannan, Ye Jiang-Liang, Chou Jonathan, Henry Ralph, Yu Chin", "reference": { "type": "PubMed", "id": "16183644", "url": "https://pubmed.ncbi.nlm.nih.gov/16183644" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16183644", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis cpFtsY mutants exhibit pleiotropic defects including an inability to increase iron deficiency-inducible root Fe(III) chelate reductase activity.", "journal": "Plant J.", "date": "2006", "authors": "Durrett Timothy P, Connolly Erin L, Rogers Elizabeth E", "reference": { "type": "PubMed", "id": "16813577", "url": "https://pubmed.ncbi.nlm.nih.gov/16813577" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P37107-1", "protein_name": "Signal recognition particle subunit SRP54, chloroplastic", "gene_name": "FFC", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80842-1", "protein_name": "Cell division protein FtsY homolog, chloroplastic", "gene_name": "CPFTSY", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P92949-1", "protein_name": "Ferric reduction oxidase 2", "gene_name": "FRO2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 344, "end_pos": 344, "sequence_org": "G", "sequence_mut": "D", "comment": "In frd4-2; chlorotic and reduction in thylakoid membrane content and stacking.", "evidence": [ { "database": "UniProtKB", "id": "O80842", "url": "https://www.uniprot.org/uniprotkb/O80842" }, { "database": "PubMed", "id": "16813577", "url": "https://pubmed.ncbi.nlm.nih.gov/16813577" } ], "uniprot_canonical_ac": "O80842-1" } ], "record_id": "pubmed.16813577", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Canonical signal recognition particle components can be bypassed for posttranslational protein targeting in chloroplasts.", "journal": "The Plant cell", "date": "2007-05", "authors": "Tzvetkova-Chevolleau Tzvetelina, Hutin Claire, No\u00ebl Laurent D, Goforth Robyn, Carde Jean-Pierre, Caffarri Stephano, Sinning Irmgard, Groves Matthew, Teulon Jean-Marie, Hoffman Neil E, Henry Ralph, Havaux Michel, Nussaume Laurent", "reference": { "type": "PubMed", "id": "17513500", "url": "https://pubmed.ncbi.nlm.nih.gov/17513500" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LBP4-1", "protein_name": "Inner membrane protein ALBINO3, chloroplastic", "gene_name": "ALB3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17513500", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Assembly of chloroplast signal recognition particle involves structural rearrangement in cpSRP43.", "journal": "J. Mol. Biol.", "date": "2008", "authors": "Kathir Karuppanan Muthusamy, Rajalingam Dakshinamurthy, Sivaraja Vaithiyalingam, Kight Alicia, Goforth Robyn L, Yu Chin, Henry Ralph, Kumar Thallapuranam Krishnaswamy Suresh", "reference": { "type": "PubMed", "id": "18586266", "url": "https://pubmed.ncbi.nlm.nih.gov/18586266" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P37107-1", "protein_name": "Signal recognition particle subunit SRP54, chloroplastic", "gene_name": "FFC", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18586266", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for specific substrate recognition by the chloroplast signal recognition particle protein cpSRP43.", "journal": "Science (New York, N.Y.)", "date": "2008-07-11", "authors": "Stengel Katharina F, Holdermann Iris, Cain Peter, Robinson Colin, Wild Klemens, Sinning Irmgard", "reference": { "type": "PubMed", "id": "18621669", "url": "https://pubmed.ncbi.nlm.nih.gov/18621669" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ48-1", "protein_name": "Chlorophyll a-b binding protein 2, chloroplastic", "gene_name": "LHCB1.1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 161, "end_pos": 161, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreased interaction with LHCP.", "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" }, { "database": "PubMed", "id": "18621669", "url": "https://pubmed.ncbi.nlm.nih.gov/18621669" } ], "uniprot_canonical_ac": "O22265-1" }, { "start_pos": 192, "end_pos": 192, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreased interaction with LHCP.", "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" }, { "database": "PubMed", "id": "18621669", "url": "https://pubmed.ncbi.nlm.nih.gov/18621669" } ], "uniprot_canonical_ac": "O22265-1" }, { "start_pos": 204, "end_pos": 204, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of interaction with LHCP.", "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" }, { "database": "PubMed", "id": "18621669", "url": "https://pubmed.ncbi.nlm.nih.gov/18621669" } ], "uniprot_canonical_ac": "O22265-1" }, { "start_pos": 226, "end_pos": 226, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreased interaction with LHCP.", "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" }, { "database": "PubMed", "id": "18621669", "url": "https://pubmed.ncbi.nlm.nih.gov/18621669" } ], "uniprot_canonical_ac": "O22265-1" }, { "start_pos": 199, "end_pos": 199, "sequence_org": "L", "sequence_mut": "K", "comment": "Loss of targeting to the thylakoid.", "evidence": [ { "database": "UniProtKB", "id": "P0CJ48", "url": "https://www.uniprot.org/uniprotkb/P0CJ48" }, { "database": "PubMed", "id": "18621669", "url": "https://pubmed.ncbi.nlm.nih.gov/18621669" } ], "uniprot_canonical_ac": "P0CJ48-1" } ], "record_id": "pubmed.18621669", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The C terminus of the Alb3 membrane insertase recruits cpSRP43 to the thylakoid membrane.", "journal": "The Journal of biological chemistry", "date": "2010-02-19", "authors": "Falk Sebastian, Ravaud Stephanie, Koch Joachim, Sinning Irmgard", "reference": { "type": "PubMed", "id": "20018841", "url": "https://pubmed.ncbi.nlm.nih.gov/20018841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LBP4-1", "protein_name": "Inner membrane protein ALBINO3, chloroplastic", "gene_name": "ALB3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 269, "end_pos": 269, "sequence_org": "Y", "sequence_mut": "A", "comment": "Decreased interaction with ALB3.", "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" }, { "database": "PubMed", "id": "20018841", "url": "https://pubmed.ncbi.nlm.nih.gov/20018841" } ], "uniprot_canonical_ac": "O22265-1" }, { "start_pos": 291, "end_pos": 291, "sequence_org": "W", "sequence_mut": "A", "comment": "Decreased interaction with ALB3.", "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" }, { "database": "PubMed", "id": "20018841", "url": "https://pubmed.ncbi.nlm.nih.gov/20018841" } ], "uniprot_canonical_ac": "O22265-1" }, { "start_pos": 293, "end_pos": 293, "sequence_org": "D", "sequence_mut": "A", "comment": "Decreased interaction with ALB3.", "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" }, { "database": "PubMed", "id": "20018841", "url": "https://pubmed.ncbi.nlm.nih.gov/20018841" } ], "uniprot_canonical_ac": "O22265-1" }, { "start_pos": 376, "end_pos": 377, "sequence_org": "KR", "sequence_mut": "AA", "comment": "Decreased interaction with CAO/cpSRP43. Loss of interaction with CAO/cpSRP43; when associated with 454-A-A-455.", "evidence": [ { "database": "UniProtKB", "id": "Q8LBP4", "url": "https://www.uniprot.org/uniprotkb/Q8LBP4" }, { "database": "PubMed", "id": "20018841", "url": "https://pubmed.ncbi.nlm.nih.gov/20018841" } ], "uniprot_canonical_ac": "Q8LBP4-1" }, { "start_pos": 454, "end_pos": 455, "sequence_org": "KR", "sequence_mut": "AA", "comment": "Decreased interaction with CAO/cpSRP43. Loss of interaction with CAO/cpSRP43; when associated with 376-A-A-377.", "evidence": [ { "database": "UniProtKB", "id": "Q8LBP4", "url": "https://www.uniprot.org/uniprotkb/Q8LBP4" }, { "database": "PubMed", "id": "20018841", "url": "https://pubmed.ncbi.nlm.nih.gov/20018841" } ], "uniprot_canonical_ac": "Q8LBP4-1" } ], "record_id": "pubmed.20018841", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cpSRP43 is a novel chaperone specific for light-harvesting chlorophyll a,b-binding proteins.", "journal": "The Journal of biological chemistry", "date": "2010-07-09", "authors": "Falk Sebastian, Sinning Irmgard", "reference": { "type": "PubMed", "id": "20498370", "url": "https://pubmed.ncbi.nlm.nih.gov/20498370" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20498370", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interplay between the cpSRP pathway components, the substrate LHCP and the translocase Alb3: an in vivo and in vitro study.", "journal": "FEBS Lett.", "date": "2010", "authors": "Bals Thomas, D\u00fcnschede Beatrix, Funke Silke, Sch\u00fcnemann Danja", "reference": { "type": "PubMed", "id": "20828566", "url": "https://pubmed.ncbi.nlm.nih.gov/20828566" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LBP4-1", "protein_name": "Inner membrane protein ALBINO3, chloroplastic", "gene_name": "ALB3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20828566", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LTD is a protein required for sorting light-harvesting chlorophyll-binding proteins to the chloroplast SRP pathway.", "journal": "Nat. Commun.", "date": "2011", "authors": "Ouyang Min, Li Xiaoyi, Ma Jinfang, Chi Wei, Xiao Jianwei, Zou Meijuan, Chen Fan, Lu Congming, Zhang Lixin", "reference": { "type": "PubMed", "id": "21505433", "url": "https://pubmed.ncbi.nlm.nih.gov/21505433" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LPR9-1", "protein_name": "Protein TIC110, chloroplastic", "gene_name": "TIC110", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VY88-1", "protein_name": "Protein LHCP TRANSLOCATION DEFECT", "gene_name": "LTD", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FMD5-1", "protein_name": "Protein TIC 40, chloroplastic", "gene_name": "TIC40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0CJ48-1", "protein_name": "Chlorophyll a-b binding protein 2, chloroplastic", "gene_name": "LHCB1.1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 197, "end_pos": 200, "sequence_org": "DPLG", "sequence_mut": "AAAA", "comment": "Loss of interaction with CAO/cpSRP43, but no effect on interaction with LTD.", "evidence": [ { "database": "UniProtKB", "id": "P0CJ48", "url": "https://www.uniprot.org/uniprotkb/P0CJ48" }, { "database": "PubMed", "id": "21505433", "url": "https://pubmed.ncbi.nlm.nih.gov/21505433" } ], "uniprot_canonical_ac": "P0CJ48-1" }, { "start_pos": 210, "end_pos": 212, "sequence_org": "ELK", "sequence_mut": "AAA", "comment": "Loss of interaction with LTD, but no effect on interaction with CAO/cpSRP43.", "evidence": [ { "database": "UniProtKB", "id": "P0CJ48", "url": "https://www.uniprot.org/uniprotkb/P0CJ48" }, { "database": "PubMed", "id": "21505433", "url": "https://pubmed.ncbi.nlm.nih.gov/21505433" } ], "uniprot_canonical_ac": "P0CJ48-1" }, { "start_pos": 220, "end_pos": 223, "sequence_org": "RLAM", "sequence_mut": "AAAA", "comment": "Loss of interaction with LTD, but no effect on interaction with CAO/cpSRP43.", "evidence": [ { "database": "UniProtKB", "id": "P0CJ48", "url": "https://www.uniprot.org/uniprotkb/P0CJ48" }, { "database": "PubMed", "id": "21505433", "url": "https://pubmed.ncbi.nlm.nih.gov/21505433" } ], "uniprot_canonical_ac": "P0CJ48-1" } ], "record_id": "pubmed.21505433", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A chromodomain protein encoded by the arabidopsis CAO gene is a plant-specific component of the chloroplast signal recognition particle pathway that is involved in LHCP targeting.", "journal": "The Plant cell", "date": "1999-01", "authors": "Klimyuk V I, Persello-Cartieaux F, Havaux M, Contard-David P, Schuenemann D, Meiherhoff K, Gouet P, Jones J D, Hoffman N E, Nussaume L", "reference": { "type": "PubMed", "id": "9878634", "url": "https://pubmed.ncbi.nlm.nih.gov/9878634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22265-1", "protein_name": "Signal recognition particle 43 kDa protein, chloroplastic", "gene_name": "CAO", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22265", "url": "https://www.uniprot.org/uniprotkb/O22265" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9878634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biochemical characterization of a putative cytokinin-responsive His-kinase, CKI1, from Arabidopsis thaliana.", "journal": "Bioscience, biotechnology, and biochemistry", "date": "1999-09", "authors": "Nakamura A, Kakimoto T, Imamura A, Suzuki T, Ueguchi C, Mizuno T", "reference": { "type": "PubMed", "id": "10610126", "url": "https://pubmed.ncbi.nlm.nih.gov/10610126" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22267-1", "protein_name": "Histidine kinase CKI1", "gene_name": "CKI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 1050, "end_pos": 1050, "sequence_org": "D", "sequence_mut": "E", "comment": "Loss of histidine kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" }, { "database": "PubMed", "id": "10610126", "url": "https://pubmed.ncbi.nlm.nih.gov/10610126" } ], "uniprot_canonical_ac": "O22267-1" }, { "start_pos": 1050, "end_pos": 1050, "sequence_org": "D", "sequence_mut": "Q", "comment": "Loss of histidine kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" }, { "database": "PubMed", "id": "10610126", "url": "https://pubmed.ncbi.nlm.nih.gov/10610126" } ], "uniprot_canonical_ac": "O22267-1" } ], "record_id": "pubmed.10610126", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Possible His to Asp phosphorelay signaling in an Arabidopsis two-component system.", "journal": "FEBS Lett.", "date": "2000", "authors": "Urao T, Miyata S, Yamaguchi-Shinozaki K, Shinozaki K", "reference": { "type": "PubMed", "id": "10930573", "url": "https://pubmed.ncbi.nlm.nih.gov/10930573" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22267-1", "protein_name": "Histidine kinase CKI1", "gene_name": "CKI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49333-1", "protein_name": "Ethylene receptor 1", "gene_name": "ETR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZNV8-1", "protein_name": "Histidine-containing phosphotransfer protein 2", "gene_name": "AHP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80366-1", "protein_name": "Two-component response regulator ARR9", "gene_name": "ARR9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82798-1", "protein_name": "Two-component response regulator ARR4", "gene_name": "ARR4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZNV9-1", "protein_name": "Histidine-containing phosphotransfer protein 1", "gene_name": "AHP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SAZ5-1", "protein_name": "Histidine-containing phosphotransfer protein 3", "gene_name": "AHP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXL4-1", "protein_name": "Histidine kinase 1", "gene_name": "AHK1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 1075, "end_pos": 1075, "sequence_org": "D", "sequence_mut": "E", "comment": "Loss of histidine kinase activity and impaired interaction with AHP2.", "evidence": [ { "database": "UniProtKB", "id": "Q9SXL4", "url": "https://www.uniprot.org/uniprotkb/Q9SXL4" }, { "database": "PubMed", "id": "10488240", "url": "https://pubmed.ncbi.nlm.nih.gov/10488240" }, { "database": "PubMed", "id": "10930573", "url": "https://pubmed.ncbi.nlm.nih.gov/10930573" } ], "uniprot_canonical_ac": "Q9SXL4-1" } ], "record_id": "pubmed.10930573", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An Arabidopsis histidine kinase is essential for megagametogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002-11-26", "authors": "Pischke Melissa S, Jones Linda G, Otsuga Denichiro, Fernandez Donna E, Drews Gary N, Sussman Michael R", "reference": { "type": "PubMed", "id": "12426401", "url": "https://pubmed.ncbi.nlm.nih.gov/12426401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22267-1", "protein_name": "Histidine kinase CKI1", "gene_name": "CKI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12426401", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The putative sensor histidine kinase CKI1 is involved in female gametophyte development in Arabidopsis.", "journal": "Molecular genetics and genomics : MGG", "date": "2003-07", "authors": "Hej\u00e1tko J, Pernisov\u00e1 M, Eneva T, Palme K, Brzobohat\u00fd B", "reference": { "type": "PubMed", "id": "12774227", "url": "https://pubmed.ncbi.nlm.nih.gov/12774227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22267-1", "protein_name": "Histidine kinase CKI1", "gene_name": "CKI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 150, "end_pos": 153, "sequence_org": "RGDY", "sequence_mut": "GT", "comment": "In cki1-r; normal phenotype rescued from En-1 insertional disruption phenotype.", "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" }, { "database": "PubMed", "id": "12774227", "url": "https://pubmed.ncbi.nlm.nih.gov/12774227" } ], "uniprot_canonical_ac": "O22267-1" } ], "record_id": "pubmed.12774227", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of AHK1/ATHK1 and cytokinin receptor histidine kinases in response to abscisic acid, drought, and salt stress in Arabidopsis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007-12-18", "authors": "Tran Lam-Son Phan, Urao Takeshi, Qin Feng, Maruyama Kyonoshin, Kakimoto Tatsuo, Shinozaki Kazuo, Yamaguchi-Shinozaki Kazuko", "reference": { "type": "PubMed", "id": "18077346", "url": "https://pubmed.ncbi.nlm.nih.gov/18077346" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22267-1", "protein_name": "Histidine kinase CKI1", "gene_name": "CKI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5U0-1", "protein_name": "Histidine kinase 4", "gene_name": "AHK4; WOL", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5U2-1", "protein_name": "Histidine kinase 2", "gene_name": "AHK2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5U1-1", "protein_name": "Histidine kinase 3", "gene_name": "AHK3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3S4A7-1", "protein_name": "Histidine kinase 5", "gene_name": "AHK5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXL4-1", "protein_name": "Histidine kinase 1", "gene_name": "AHK1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18077346", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The histidine kinases CYTOKININ-INDEPENDENT1 and ARABIDOPSIS HISTIDINE KINASE2 and 3 regulate vascular tissue development in Arabidopsis shoots.", "journal": "The Plant cell", "date": "2009-07", "authors": "Hej\u00e1tko Jan, Ryu Hojin, Kim Gyung-Tae, Dobesov\u00e1 Romana, Choi Sunhwa, Choi Sang Mi, Soucek Premysl, Hor\u00e1k Jakub, Pek\u00e1rov\u00e1 Blanka, Palme Klaus, Brzobohaty Bretislav, Hwang Ildoo", "reference": { "type": "PubMed", "id": "19622803", "url": "https://pubmed.ncbi.nlm.nih.gov/19622803" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22267-1", "protein_name": "Histidine kinase CKI1", "gene_name": "CKI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5U2-1", "protein_name": "Histidine kinase 2", "gene_name": "AHK2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5U1-1", "protein_name": "Histidine kinase 3", "gene_name": "AHK3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 405, "end_pos": 405, "sequence_org": "H", "sequence_mut": "Q", "comment": "Dysfunction of the two-component signaling pathway leading to defects in procambial cell maintenance and proliferation, as well as the absence of secondary growth.", "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" }, { "database": "PubMed", "id": "19622803", "url": "https://pubmed.ncbi.nlm.nih.gov/19622803" } ], "uniprot_canonical_ac": "O22267-1" } ], "record_id": "pubmed.19622803", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis histidine kinase CKI1 acts upstream of histidine phosphotransfer proteins to regulate female gametophyte development and vegetative growth.", "journal": "The Plant cell", "date": "2010-04", "authors": "Deng Yan, Dong Haili, Mu Jinye, Ren Bo, Zheng Binglian, Ji Zhendong, Yang Wei-Cai, Liang Yan, Zuo Jianru", "reference": { "type": "PubMed", "id": "20363773", "url": "https://pubmed.ncbi.nlm.nih.gov/20363773" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22267-1", "protein_name": "Histidine kinase CKI1", "gene_name": "CKI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20363773", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CKI1, a histidine kinase homolog implicated in cytokinin signal transduction.", "journal": "Science (New York, N.Y.)", "date": "1996-11-08", "authors": "Kakimoto T", "reference": { "type": "PubMed", "id": "8875940", "url": "https://pubmed.ncbi.nlm.nih.gov/8875940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22267-1", "protein_name": "Histidine kinase CKI1", "gene_name": "CKI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22267", "url": "https://www.uniprot.org/uniprotkb/O22267" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8875940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mitochondrial rRNA dimethyladenosine methyltransferase in Arabidopsis.", "journal": "The Plant journal : for cell and molecular biology", "date": "2010-02", "authors": "Richter Uwe, K\u00fchn Kristina, Okada Sachiko, Brennicke Axel, Weihe Andreas, B\u00f6rner Thomas", "reference": { "type": "PubMed", "id": "19929881", "url": "https://pubmed.ncbi.nlm.nih.gov/19929881" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22268-1", "protein_name": "Ribosomal RNA small subunit methyltransferase", "gene_name": "DIM1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FK02-1", "protein_name": "Ribosomal RNA small subunit methyltransferase, mitochondrial", "gene_name": "DIM1B", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22268", "url": "https://www.uniprot.org/uniprotkb/O22268" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19929881", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear ribosome biogenesis mediated by the DIM1A rRNA dimethylase is required for organized root growth and epidermal patterning in Arabidopsis.", "journal": "The Plant cell", "date": "2012-07", "authors": "Wieckowski Yana, Schiefelbein John", "reference": { "type": "PubMed", "id": "22829145", "url": "https://pubmed.ncbi.nlm.nih.gov/22829145" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22268-1", "protein_name": "Ribosomal RNA small subunit methyltransferase", "gene_name": "DIM1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F1QJ20-1", "protein_name": "rRNA adenine N(6)-methyltransferase", "gene_name": "dimt1l", "tax_name": "Zebrafish" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22268", "url": "https://www.uniprot.org/uniprotkb/O22268" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 66, "end_pos": 66, "sequence_org": "G", "sequence_mut": "E", "comment": "In dim1A; loss of adenine methylation, but no effect on pre-rRNA processing.", "evidence": [ { "database": "UniProtKB", "id": "O22268", "url": "https://www.uniprot.org/uniprotkb/O22268" }, { "database": "PubMed", "id": "22829145", "url": "https://pubmed.ncbi.nlm.nih.gov/22829145" } ], "uniprot_canonical_ac": "O22268-1" } ], "record_id": "pubmed.22829145", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic evidence for the role of GDP-mannose in plant ascorbic acid (vitamin C) biosynthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999-03-30", "authors": "Conklin P L, Norris S R, Wheeler G L, Williams E H, Smirnoff N, Last R L", "reference": { "type": "PubMed", "id": "10097187", "url": "https://pubmed.ncbi.nlm.nih.gov/10097187" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 22, "end_pos": 22, "sequence_org": "P", "sequence_mut": "S", "comment": "In vtc1-1 and vtc1-2; reduced enzyme activity and ascorbate concentrations, and ozone-sensitive.", "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" }, { "database": "PubMed", "id": "10097187", "url": "https://pubmed.ncbi.nlm.nih.gov/10097187" } ], "uniprot_canonical_ac": "O22287-1" } ], "record_id": "pubmed.10097187", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of ascorbic acid-deficient Arabidopsis thaliana mutants.", "journal": "Genetics", "date": "2000-02", "authors": "Conklin P L, Saracco S A, Norris S R, Last R L", "reference": { "type": "PubMed", "id": "10655235", "url": "https://pubmed.ncbi.nlm.nih.gov/10655235" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10655235", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis cyt1 mutants are deficient in a mannose-1-phosphate guanylyltransferase and point to a requirement of N-linked glycosylation for cellulose biosynthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001-02-27", "authors": "Lukowitz W, Nickle T C, Meinke D W, Last R L, Conklin P L, Somerville C R", "reference": { "type": "PubMed", "id": "11226227", "url": "https://pubmed.ncbi.nlm.nih.gov/11226227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 89, "end_pos": 89, "sequence_org": "P", "sequence_mut": "L", "comment": "In cyt1-1; deficient in N-glycosylation and cellulose, and embryo lethal.", "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" }, { "database": "PubMed", "id": "11226227", "url": "https://pubmed.ncbi.nlm.nih.gov/11226227" } ], "uniprot_canonical_ac": "O22287-1" } ], "record_id": "pubmed.11226227", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Leaf vitamin C contents modulate plant defense transcripts and regulate genes that control development through hormone signaling.", "journal": "The Plant cell", "date": "2003-04", "authors": "Pastori Gabriela M, Kiddle Guy, Antoniw John, Bernard Stephanie, Veljovic-Jovanovic Sonja, Verrier Paul J, Noctor Graham, Foyer Christine H", "reference": { "type": "PubMed", "id": "12671089", "url": "https://pubmed.ncbi.nlm.nih.gov/12671089" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12671089", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The timing of senescence and response to pathogens is altered in the ascorbate-deficient Arabidopsis mutant vitamin c-1.", "journal": "Plant physiology", "date": "2004-04", "authors": "Barth Carina, Moeder Wolfgang, Klessig Daniel F, Conklin Patricia L", "reference": { "type": "PubMed", "id": "15064386", "url": "https://pubmed.ncbi.nlm.nih.gov/15064386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15064386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of plant morphology, root architecture, and cell structure by low vitamin C in Arabidopsis thaliana.", "journal": "Journal of experimental botany", "date": "2006", "authors": "Olmos E, Kiddle G, Pellny Tk, Kumar S, Foyer Ch", "reference": { "type": "PubMed", "id": "16720601", "url": "https://pubmed.ncbi.nlm.nih.gov/16720601" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16720601", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Antioxidant status, peroxidase activity, and PR protein transcript levels in ascorbate-deficient Arabidopsis thaliana vtc mutants.", "journal": "Journal of experimental botany", "date": "2008", "authors": "Colville Louise, Smirnoff Nicholas", "reference": { "type": "PubMed", "id": "18849295", "url": "https://pubmed.ncbi.nlm.nih.gov/18849295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18849295", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GDP-mannose pyrophosphorylase is a genetic determinant of ammonium sensitivity in Arabidopsis thaliana.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008-11-25", "authors": "Qin Cheng, Qian Weiqiang, Wang Wenfeng, Wu Yue, Yu Chunmei, Jiang Xinhang, Wang Daowen, Wu Ping", "reference": { "type": "PubMed", "id": "19011088", "url": "https://pubmed.ncbi.nlm.nih.gov/19011088" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 11, "end_pos": 11, "sequence_org": "G", "sequence_mut": "S", "comment": "In hsn1; reduced enzyme activity, ascorbate concentrations and N-glycosylation, and increased sensitivity to ammonium.", "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" }, { "database": "PubMed", "id": "19011088", "url": "https://pubmed.ncbi.nlm.nih.gov/19011088" } ], "uniprot_canonical_ac": "O22287-1" } ], "record_id": "pubmed.19011088", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mutation in GDP-mannose pyrophosphorylase causes conditional hypersensitivity to ammonium, resulting in Arabidopsis root growth inhibition, altered ammonium metabolism, and hormone homeostasis.", "journal": "J. Exp. Bot.", "date": "2010", "authors": "Barth Carina, Gouzd Zachary A, Steele Hilary P, Imperio Ryan M", "reference": { "type": "PubMed", "id": "20007685", "url": "https://pubmed.ncbi.nlm.nih.gov/20007685" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20007685", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis CSN5B interacts with VTC1 and modulates ascorbic acid synthesis.", "journal": "Plant Cell", "date": "2013", "authors": "Wang Juan, Yu Yanwen, Zhang Zhijin, Quan Ruidang, Zhang Haiwen, Ma Ligeng, Deng Xing Wang, Huang Rongfeng", "reference": { "type": "PubMed", "id": "23424245", "url": "https://pubmed.ncbi.nlm.nih.gov/23424245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LAZ7-1", "protein_name": "COP9 signalosome complex subunit 5a", "gene_name": "CSN5A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FVU9-1", "protein_name": "COP9 signalosome complex subunit 5b", "gene_name": "CSN5B", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23424245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "D27E mutation of VTC1 impairs the interaction with CSN5B and enhances ascorbic acid biosynthesis and seedling growth in Arabidopsis.", "journal": "Plant molecular biology", "date": "2016-11", "authors": "Li Shenghui, Wang Juan, Yu Yanwen, Wang Fengru, Dong Jingao, Huang Rongfeng", "reference": { "type": "PubMed", "id": "27561782", "url": "https://pubmed.ncbi.nlm.nih.gov/27561782" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 27, "end_pos": 27, "sequence_org": "D", "sequence_mut": "E", "comment": "Abolishes interaction with CSN5B and subsequent degradation in the dark by the 26S proteasome, and increases ascorbate accumulation in seedlings.", "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" }, { "database": "PubMed", "id": "27561782", "url": "https://pubmed.ncbi.nlm.nih.gov/27561782" } ], "uniprot_canonical_ac": "O22287-1" } ], "record_id": "pubmed.27561782", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.", "journal": "Frontiers in plant science", "date": "2022", "authors": "Zhang Chi, Zhao Shun, Li Yu-Shuai, He Chao, Wang Xiao, Liu Lin", "reference": { "type": "PubMed", "id": "35677252", "url": "https://pubmed.ncbi.nlm.nih.gov/35677252" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 223, "end_pos": 361, "sequence_org": "PRDYITGLRLYLDSLRKKSPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGVRIKKHACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSNILKPEIVM", "sequence_mut": "", "comment": "Reduces catalytic activity 3-fold.", "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" }, { "database": "PubMed", "id": "35677252", "url": "https://pubmed.ncbi.nlm.nih.gov/35677252" } ], "uniprot_canonical_ac": "O22287-1" } ], "record_id": "pubmed.35677252", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Environmental stress sensitivity of an ascorbic acid-deficient Arabidopsis mutant.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996-09-03", "authors": "Conklin P L, Williams E H, Last R L", "reference": { "type": "PubMed", "id": "8790441", "url": "https://pubmed.ncbi.nlm.nih.gov/8790441" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8790441", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "L-ascorbic acid metabolism in the ascorbate-deficient arabidopsis mutant vtc1.", "journal": "Plant physiology", "date": "1997-11", "authors": "Conklin P L, Pallanca J E, Last R L, Smirnoff N", "reference": { "type": "PubMed", "id": "9390448", "url": "https://pubmed.ncbi.nlm.nih.gov/9390448" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9390448", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A cytokinesis-defective mutant of Arabidopsis (cyt1) characterized by embryonic lethality, incomplete cell walls, and excessive callose accumulation.", "journal": "Plant J.", "date": "1998", "authors": "Nickle T C, Meinke D W", "reference": { "type": "PubMed", "id": "9750345", "url": "https://pubmed.ncbi.nlm.nih.gov/9750345" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22287-1", "protein_name": "Mannose-1-phosphate guanylyltransferase 1", "gene_name": "CYT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22287", "url": "https://www.uniprot.org/uniprotkb/O22287" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9750345", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "atSRp30, one of two SF2/ASF-like proteins from Arabidopsis thaliana, regulates splicing of specific plant genes.", "journal": "Genes & development", "date": "1999-04-15", "authors": "Lopato S, Kalyna M, Dorner S, Kobayashi R, Krainer A R, Barta A", "reference": { "type": "PubMed", "id": "10215626", "url": "https://pubmed.ncbi.nlm.nih.gov/10215626" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22315-1", "protein_name": "Serine/arginine-rich-splicing factor SR34", "gene_name": "SR34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XFR5-1", "protein_name": "Serine/arginine-rich splicing factor SR30", "gene_name": "SR30", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22315", "url": "https://www.uniprot.org/uniprotkb/O22315" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10215626", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ethylene-inducible PK12 kinase mediates the phosphorylation of SR splicing factors.", "journal": "The Plant journal : for cell and molecular biology", "date": "2000-01", "authors": "Savaldi-Goldstein S, Sessa G, Fluhr R", "reference": { "type": "PubMed", "id": "10652154", "url": "https://pubmed.ncbi.nlm.nih.gov/10652154" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22315-1", "protein_name": "Serine/arginine-rich-splicing factor SR34", "gene_name": "SR34", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22315", "url": "https://www.uniprot.org/uniprotkb/O22315" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10652154", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis splicing factor SR1 is regulated by alternative splicing.", "journal": "Plant Mol. Biol.", "date": "2000", "authors": "Lazar G, Goodman H M", "reference": { "type": "PubMed", "id": "10809003", "url": "https://pubmed.ncbi.nlm.nih.gov/10809003" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22315-1", "protein_name": "Serine/arginine-rich-splicing factor SR34", "gene_name": "SR34", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22315", "url": "https://www.uniprot.org/uniprotkb/O22315" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10809003", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Network of interactions of a novel plant-specific Arg/Ser-rich protein, atRSZ33, with atSC35-like splicing factors.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Lopato Sergiy, Forstner Christina, Kalyna Maria, Hilscher Julia, Langhammer Ulrike, Indrapichate Korakod, Lorkovi\u0107 Zdravko J, Barta Andrea", "reference": { "type": "PubMed", "id": "12176998", "url": "https://pubmed.ncbi.nlm.nih.gov/12176998" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22315-1", "protein_name": "Serine/arginine-rich-splicing factor SR34", "gene_name": "SR34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1PDV2-1", "protein_name": "Serine/arginine-rich SC35-like splicing factor SCL28", "gene_name": "SCL28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L3X8-1", "protein_name": "Serine/arginine-rich SC35-like splicing factor SCL30", "gene_name": "SCL30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FMG4-1", "protein_name": "Serine/arginine-rich splicing factor SC35", "gene_name": "SC35", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LHP2-1", "protein_name": "Serine/arginine-rich SC35-like splicing factor SCL30A", "gene_name": "SCL30A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81126-1", "protein_name": "Serine/arginine-rich splicing factor RSZ22", "gene_name": "RSZ22", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81127-1", "protein_name": "Serine/arginine-rich splicing factor RSZ21", "gene_name": "RSZ21", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VYA5-1", "protein_name": "Serine/arginine-rich splicing factor RS2Z33", "gene_name": "RS2Z33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SEU4-1", "protein_name": "Serine/arginine-rich SC35-like splicing factor SCL33", "gene_name": "SCL33", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22315", "url": "https://www.uniprot.org/uniprotkb/O22315" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12176998", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tissue-specific expression and dynamic organization of SR splicing factors in Arabidopsis.", "journal": "Mol. Biol. Cell", "date": "2004", "authors": "Fang Yuda, Hearn Stephen, Spector David L", "reference": { "type": "PubMed", "id": "15034145", "url": "https://pubmed.ncbi.nlm.nih.gov/15034145" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22315-1", "protein_name": "Serine/arginine-rich-splicing factor SR34", "gene_name": "SR34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SEU4-1", "protein_name": "Serine/arginine-rich SC35-like splicing factor SCL33", "gene_name": "SCL33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XFR5-1", "protein_name": "Serine/arginine-rich splicing factor SR30", "gene_name": "SR30", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22315", "url": "https://www.uniprot.org/uniprotkb/O22315" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15034145", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional distribution and dynamics of Arabidopsis SR splicing factors in living plant cells.", "journal": "Plant J.", "date": "2005", "authors": "Tillemans Vinciane, Dispa Laurence, Remacle Claire, Collinge M\u00e9lanie, Motte Patrick", "reference": { "type": "PubMed", "id": "15686520", "url": "https://pubmed.ncbi.nlm.nih.gov/15686520" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22315-1", "protein_name": "Serine/arginine-rich-splicing factor SR34", "gene_name": "SR34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81126-1", "protein_name": "Serine/arginine-rich splicing factor RSZ22", "gene_name": "RSZ22", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P92964-1", "protein_name": "Serine/arginine-rich splicing factor RS31", "gene_name": "RS31", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VYA5-1", "protein_name": "Serine/arginine-rich splicing factor RS2Z33", "gene_name": "RS2Z33", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22315", "url": "https://www.uniprot.org/uniprotkb/O22315" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15686520", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtCyp59 is a multidomain cyclophilin from Arabidopsis thaliana that interacts with SR proteins and the C-terminal domain of the RNA polymerase II.", "journal": "RNA", "date": "2006", "authors": "Gullerova Monika, Barta Andrea, Lorkovic Zdravko J", "reference": { "type": "PubMed", "id": "16497658", "url": "https://pubmed.ncbi.nlm.nih.gov/16497658" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22315-1", "protein_name": "Serine/arginine-rich-splicing factor SR34", "gene_name": "SR34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1PDV2-1", "protein_name": "Serine/arginine-rich SC35-like splicing factor SCL28", "gene_name": "SCL28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L3X8-1", "protein_name": "Serine/arginine-rich SC35-like splicing factor SCL30", "gene_name": "SCL30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FMG4-1", "protein_name": "Serine/arginine-rich splicing factor SC35", "gene_name": "SC35", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LHP2-1", "protein_name": "Serine/arginine-rich SC35-like splicing factor SCL30A", "gene_name": "SCL30A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81127-1", "protein_name": "Serine/arginine-rich splicing factor RSZ21", "gene_name": "RSZ21", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6Q151-1", "protein_name": "Peptidyl-prolyl cis-trans isomerase CYP59", "gene_name": "CYP59", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P18616-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB1", "gene_name": "NRPB1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P92964-1", "protein_name": "Serine/arginine-rich splicing factor RS31", "gene_name": "RS31", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VYA5-1", "protein_name": "Serine/arginine-rich splicing factor RS2Z33", "gene_name": "RS2Z33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P92965-1", "protein_name": "Serine/arginine-rich splicing factor RS40", "gene_name": "RS40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SEU4-1", "protein_name": "Serine/arginine-rich SC35-like splicing factor SCL33", "gene_name": "SCL33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XFR5-1", "protein_name": "Serine/arginine-rich splicing factor SR30", "gene_name": "SR30", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22315", "url": "https://www.uniprot.org/uniprotkb/O22315" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16497658", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ATP, phosphorylation and transcription regulate the mobility of plant splicing factors.", "journal": "J. Cell Sci.", "date": "2006", "authors": "Ali Gul Shad, Reddy Annireddy S N", "reference": { "type": "PubMed", "id": "16895966", "url": "https://pubmed.ncbi.nlm.nih.gov/16895966" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22315-1", "protein_name": "Serine/arginine-rich-splicing factor SR34", "gene_name": "SR34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SEE9-1", "protein_name": "Serine/arginine-rich splicing factor SR45", "gene_name": "SR45", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22315", "url": "https://www.uniprot.org/uniprotkb/O22315" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16895966", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a plant serine-arginine-rich protein similar to the mammalian splicing factor SF2/ASF.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "Lazar G, Schaal T, Maniatis T, Goodman H M", "reference": { "type": "PubMed", "id": "7644475", "url": "https://pubmed.ncbi.nlm.nih.gov/7644475" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22315-1", "protein_name": "Serine/arginine-rich-splicing factor SR34", "gene_name": "SR34", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22315", "url": "https://www.uniprot.org/uniprotkb/O22315" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7644475", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FASCIATA genes for chromatin assembly factor-1 in arabidopsis maintain the cellular organization of apical meristems.", "journal": "Cell", "date": "2001-01-12", "authors": "Kaya H, Shibahara K I, Taoka K I, Iwabuchi M, Stillman B, Araki T", "reference": { "type": "PubMed", "id": "11163246", "url": "https://pubmed.ncbi.nlm.nih.gov/11163246" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXY0-1", "protein_name": "Chromatin assembly factor 1 subunit FAS1", "gene_name": "FAS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXY1-1", "protein_name": "Chromatin assembly factor 1 subunit FAS2", "gene_name": "FAS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11163246", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis MSI1 is required for epigenetic maintenance of reproductive development.", "journal": "Development (Cambridge, England)", "date": "2003-06", "authors": "Hennig Lars, Taranto Patti, Walser Marcel, Sch\u00f6nrock Nicole, Gruissem Wilhelm", "reference": { "type": "PubMed", "id": "12736201", "url": "https://pubmed.ncbi.nlm.nih.gov/12736201" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12736201", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis MSI1 is a component of the MEA/FIE Polycomb group complex and required for seed development.", "journal": "The EMBO journal", "date": "2003-09-15", "authors": "K\u00f6hler Claudia, Hennig Lars, Bouveret Romaric, Gheyselinck Jacqueline, Grossniklaus Ueli, Gruissem Wilhelm", "reference": { "type": "PubMed", "id": "12970192", "url": "https://pubmed.ncbi.nlm.nih.gov/12970192" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12970192", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of function of MULTICOPY SUPPRESSOR OF IRA 1 produces nonviable parthenogenetic embryos in Arabidopsis.", "journal": "Current biology : CB", "date": "2005-04-26", "authors": "Guitton Anne-Elisabeth, Berger Fr\u00e9d\u00e9ric", "reference": { "type": "PubMed", "id": "15854908", "url": "https://pubmed.ncbi.nlm.nih.gov/15854908" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15854908", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional genomic analysis of CAF-1 mutants in Arabidopsis thaliana.", "journal": "The Journal of biological chemistry", "date": "2006-04-07", "authors": "Sch\u00f6nrock Nicole, Exner Vivien, Probst Aline, Gruissem Wilhelm, Hennig Lars", "reference": { "type": "PubMed", "id": "16452472", "url": "https://pubmed.ncbi.nlm.nih.gov/16452472" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXY0-1", "protein_name": "Chromatin assembly factor 1 subunit FAS1", "gene_name": "FAS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXY1-1", "protein_name": "Chromatin assembly factor 1 subunit FAS2", "gene_name": "FAS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16452472", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chromatin assembly factor CAF-1 is required for cellular differentiation during plant development.", "journal": "Development (Cambridge, England)", "date": "2006-11", "authors": "Exner Vivien, Taranto Patti, Sch\u00f6nrock Nicole, Gruissem Wilhelm, Hennig Lars", "reference": { "type": "PubMed", "id": "17021044", "url": "https://pubmed.ncbi.nlm.nih.gov/17021044" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXY0-1", "protein_name": "Chromatin assembly factor 1 subunit FAS1", "gene_name": "FAS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXY1-1", "protein_name": "Chromatin assembly factor 1 subunit FAS2", "gene_name": "FAS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17021044", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chromatin assembly factor 1 regulates the cell cycle but not cell fate during male gametogenesis in Arabidopsis thaliana.", "journal": "Development (Cambridge, England)", "date": "2008-01", "authors": "Chen Zhong, Tan Jeanie Li Hui, Ingouff Mathieu, Sundaresan Venkatesan, Berger Frederic", "reference": { "type": "PubMed", "id": "18045841", "url": "https://pubmed.ncbi.nlm.nih.gov/18045841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXY0-1", "protein_name": "Chromatin assembly factor 1 subunit FAS1", "gene_name": "FAS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXY1-1", "protein_name": "Chromatin assembly factor 1 subunit FAS2", "gene_name": "FAS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18045841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EMBRYONIC FLOWER1 participates in polycomb group-mediated AG gene silencing in Arabidopsis.", "journal": "Plant Cell", "date": "2008", "authors": "Calonje Myriam, Sanchez Rosario, Chen Lingjing, Sung Z Renee", "reference": { "type": "PubMed", "id": "18281509", "url": "https://pubmed.ncbi.nlm.nih.gov/18281509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L6Y4-1", "protein_name": "Polycomb group protein EMBRYONIC FLOWER 2", "gene_name": "EMF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P17839-1", "protein_name": "Floral homeotic protein AGAMOUS", "gene_name": "AG", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LYD9-1", "protein_name": "Protein EMBRYONIC FLOWER 1", "gene_name": "EMF1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18281509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A PHD-polycomb repressive complex 2 triggers the epigenetic silencing of FLC during vernalization.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2008", "authors": "De Lucia Filomena, Crevillen Pedro, Jones Alexandra M E, Greb Thomas, Dean Caroline", "reference": { "type": "PubMed", "id": "18854416", "url": "https://pubmed.ncbi.nlm.nih.gov/18854416" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LT47-1", "protein_name": "Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM", "gene_name": "FIE", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSM8-1", "protein_name": "Histone-lysine N-methyltransferase EZA1", "gene_name": "EZA1; SWN", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FIE3-1", "protein_name": "Protein VERNALIZATION INSENSITIVE 3", "gene_name": "VIN3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LHF5-1", "protein_name": "VIN3-like protein 1", "gene_name": "VIL1; VRN5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W5B1-1", "protein_name": "Polycomb group protein VERNALIZATION 2", "gene_name": "VRN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SUM4-1", "protein_name": "VIN3-like protein 2", "gene_name": "VIL2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18854416", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kicking against the PRCs - A domesticated transposase antagonises silencing mediated by polycomb group proteins and is an accessory component of polycomb repressive complex 2.", "journal": "PLoS Genet.", "date": "2015", "authors": "Liang Shih Chieh, Hartwig Ben, Perera Pumi, Mora-Garc\u00eda Santiago, de Leau Erica, Thornton Harry, de Lima Alves Flavia, de Alves Flavia Lima, Rappsilber Juri, Rapsilber Juri, Yang Suxin, James Geo Velikkakam, Schneeberger Korbinian, Finnegan E Jean, Turck Franziska, Goodrich Justin", "reference": { "type": "PubMed", "id": "26642436", "url": "https://pubmed.ncbi.nlm.nih.gov/26642436" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L6Y4-1", "protein_name": "Polycomb group protein EMBRYONIC FLOWER 2", "gene_name": "EMF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LT47-1", "protein_name": "Polycomb group protein FERTILIZATION-INDEPENDENT ENDOSPERM", "gene_name": "FIE", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94K49-1", "protein_name": "Protein ANTAGONIST OF LIKE HETEROCHROMATIN PROTEIN 1", "gene_name": "ALP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W5B1-1", "protein_name": "Polycomb group protein VERNALIZATION 2", "gene_name": "VRN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93831-1", "protein_name": "Histone-lysine N-methyltransferase CLF", "gene_name": "CLF", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26642436", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A conserved family of WD-40 proteins binds to the retinoblastoma protein in both plants and animals.", "journal": "Plant Cell", "date": "1997", "authors": "Ach R A, Taranto P, Gruissem W", "reference": { "type": "PubMed", "id": "9338962", "url": "https://pubmed.ncbi.nlm.nih.gov/9338962" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22467-1", "protein_name": "Histone-binding protein MSI1", "gene_name": "MSI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22468-1", "protein_name": "WD-40 repeat-containing protein MSI2", "gene_name": "MSI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22469-1", "protein_name": "WD-40 repeat-containing protein MSI3", "gene_name": "MSI3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22467", "url": "https://www.uniprot.org/uniprotkb/O22467" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9338962", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brassinosteroid-insensitive dwarf mutants of Arabidopsis accumulate brassinosteroids.", "journal": "Plant physiology", "date": "1999-11", "authors": "Noguchi T, Fujioka S, Choe S, Takatsuto S, Yoshida S, Yuan H, Feldmann K A, Tax F E", "reference": { "type": "PubMed", "id": "10557222", "url": "https://pubmed.ncbi.nlm.nih.gov/10557222" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 613, "end_pos": 613, "sequence_org": "G", "sequence_mut": "S", "comment": "In bri1-7; brassinosteroid-insensitive semi-dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "10557222", "url": "https://pubmed.ncbi.nlm.nih.gov/10557222" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 644, "end_pos": 644, "sequence_org": "G", "sequence_mut": "D", "comment": "In bri1-6; brassinosteroid-insensitive semi-dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "10557222", "url": "https://pubmed.ncbi.nlm.nih.gov/10557222" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 662, "end_pos": 662, "sequence_org": "S", "sequence_mut": "F", "comment": "In bri1-9; brassinosteroid-insensitive semi-dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "10557222", "url": "https://pubmed.ncbi.nlm.nih.gov/10557222" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "C", "sequence_mut": "Y", "comment": "In bri1-5; brassinosteroid-insensitive semi-dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "10557222", "url": "https://pubmed.ncbi.nlm.nih.gov/10557222" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 983, "end_pos": 983, "sequence_org": "R", "sequence_mut": "N", "comment": "In bri1-8; brassinosteroid-insensitive dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "10557222", "url": "https://pubmed.ncbi.nlm.nih.gov/10557222" } ], "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.10557222", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Perception of brassinosteroids by the extracellular domain of the receptor kinase BRI1.", "journal": "Science", "date": "2000", "authors": "He Z, Wang Z Y, Li J, Zhu Q, Lamb C, Ronald P, Chory J", "reference": { "type": "PubMed", "id": "10875920", "url": "https://pubmed.ncbi.nlm.nih.gov/10875920" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10875920", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brassinosteroid-insensitive-1 is a ubiquitously expressed leucine-rich repeat receptor serine/threonine kinase.", "journal": "Plant physiology", "date": "2000-08", "authors": "Friedrichsen D M, Joazeiro C A, Li J, Hunter T, Chory J", "reference": { "type": "PubMed", "id": "10938344", "url": "https://pubmed.ncbi.nlm.nih.gov/10938344" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 1139, "end_pos": 1139, "sequence_org": "D", "sequence_mut": "N", "comment": "In bri1-117; brassinosteroid-insensitive dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "10938344", "url": "https://pubmed.ncbi.nlm.nih.gov/10938344" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 750, "end_pos": 750, "sequence_org": "T", "sequence_mut": "I", "comment": "In bri1-102; brassinosteroid-insensitive dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "10938344", "url": "https://pubmed.ncbi.nlm.nih.gov/10938344" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 909, "end_pos": 909, "sequence_org": "A", "sequence_mut": "T", "comment": "In bri1-1; brassinosteroid-insensitive dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "10938344", "url": "https://pubmed.ncbi.nlm.nih.gov/10938344" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 983, "end_pos": 983, "sequence_org": "R", "sequence_mut": "Q", "comment": "In bri1-108; brassinosteroid-insensitive dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "10938344", "url": "https://pubmed.ncbi.nlm.nih.gov/10938344" } ], "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.10938344", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recombinant brassinosteroid insensitive 1 receptor-like kinase autophosphorylates on serine and threonine residues and phosphorylates a conserved peptide motif in vitro.", "journal": "Plant physiology", "date": "2000-10", "authors": "Oh M H, Ray W K, Huber S C, Asara J M, Gage D A, Clouse S D", "reference": { "type": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 911, "end_pos": 911, "sequence_org": "K", "sequence_mut": "E", "comment": "Loss of kinase activity; dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "uniprot_canonical_ac": "O22476-1" } ], "phosphorylation": [ { "start_pos": 1168, "end_pos": 1168, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "site_lbl": "Ser1168", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 1180, "end_pos": 1180, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "15935775", "url": "https://pubmed.ncbi.nlm.nih.gov/15935775" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "site_lbl": "Thr1180", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 838, "end_pos": 838, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "18686298", "url": "https://pubmed.ncbi.nlm.nih.gov/18686298" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" } ], "site_lbl": "Ser838", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 842, "end_pos": 842, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" } ], "site_lbl": "Thr842", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 846, "end_pos": 846, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" } ], "site_lbl": "Thr846", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 858, "end_pos": 858, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" } ], "site_lbl": "Ser858", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 872, "end_pos": 872, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "26284086", "url": "https://pubmed.ncbi.nlm.nih.gov/26284086" } ], "site_lbl": "Thr872", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 891, "end_pos": 891, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "site_lbl": "Ser891", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 982, "end_pos": 982, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "site_lbl": "Thr982", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.11027724", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BRI1 is a critical component of a plasma-membrane receptor for plant steroids.", "journal": "Nature", "date": "2001", "authors": "Wang Z Y, Seto H, Fujioka S, Yoshida S, Chory J", "reference": { "type": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 1168, "end_pos": 1168, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "site_lbl": "Ser1168", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 838, "end_pos": 838, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "18686298", "url": "https://pubmed.ncbi.nlm.nih.gov/18686298" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" } ], "site_lbl": "Ser838", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 858, "end_pos": 858, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" } ], "site_lbl": "Ser858", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 872, "end_pos": 872, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "26284086", "url": "https://pubmed.ncbi.nlm.nih.gov/26284086" } ], "site_lbl": "Thr872", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 880, "end_pos": 880, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" } ], "site_lbl": "Thr880", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 982, "end_pos": 982, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "site_lbl": "Thr982", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.11268216", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis transthyretin-like protein is a potential substrate of BRASSINOSTEROID-INSENSITIVE 1.", "journal": "The Plant cell", "date": "2004-09", "authors": "Nam Kyoung Hee, Li Jianming", "reference": { "type": "PubMed", "id": "15319482", "url": "https://pubmed.ncbi.nlm.nih.gov/15319482" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LVM5-1", "protein_name": "Uric acid degradation bifunctional protein TTL", "gene_name": "TTL", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 1031, "end_pos": 1031, "sequence_org": "A", "sequence_mut": "T", "comment": "In bri1-104; brassinosteroid-insensitive dwarf mutant and slightly reduced activity, but no effect on interaction with TTL.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "9298904", "url": "https://pubmed.ncbi.nlm.nih.gov/9298904" }, { "database": "PubMed", "id": "15319482", "url": "https://pubmed.ncbi.nlm.nih.gov/15319482" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 1048, "end_pos": 1048, "sequence_org": "G", "sequence_mut": "D", "comment": "In bri1-115; brassinosteroid-insensitive dwarf mutant, reduced activity and no interaction with TTL.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "9298904", "url": "https://pubmed.ncbi.nlm.nih.gov/9298904" }, { "database": "PubMed", "id": "15319482", "url": "https://pubmed.ncbi.nlm.nih.gov/15319482" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 1078, "end_pos": 1078, "sequence_org": "E", "sequence_mut": "K", "comment": "In bri1-101; brassinosteroid-insensitive dwarf mutant, lost activity and no interaction with TTL.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "9298904", "url": "https://pubmed.ncbi.nlm.nih.gov/9298904" }, { "database": "PubMed", "id": "15319482", "url": "https://pubmed.ncbi.nlm.nih.gov/15319482" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 2, "end_pos": 29, "sequence_org": "AMEIGEDEWKVCCGSSEFAKQMSTSGPL", "sequence_mut": "", "comment": "Lost ability to interact with BRI1.", "evidence": [ { "database": "UniProtKB", "id": "Q9LVM5", "url": "https://www.uniprot.org/uniprotkb/Q9LVM5" }, { "database": "PubMed", "id": "15319482", "url": "https://pubmed.ncbi.nlm.nih.gov/15319482" } ], "uniprot_canonical_ac": "Q9LVM5-1" } ], "record_id": "pubmed.15319482", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autoregulation and homodimerization are involved in the activation of the plant steroid receptor BRI1.", "journal": "Developmental cell", "date": "2005-06", "authors": "Wang Xuelu, Li Xiaoqing, Meisenhelder Jill, Hunter Tony, Yoshida Shigeo, Asami Tadao, Chory Joanne", "reference": { "type": "PubMed", "id": "15935775", "url": "https://pubmed.ncbi.nlm.nih.gov/15935775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 1162, "end_pos": 1162, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "15935775", "url": "https://pubmed.ncbi.nlm.nih.gov/15935775" } ], "site_lbl": "Ser1162", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 1180, "end_pos": 1180, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "15935775", "url": "https://pubmed.ncbi.nlm.nih.gov/15935775" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "site_lbl": "Thr1180", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.15935775", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brassinosteroid signaling: a paradigm for steroid hormone signaling from the cell surface.", "journal": "Science (New York, N.Y.)", "date": "2006-12-01", "authors": "Belkhadir Youssef, Chory Joanne", "reference": { "type": "PubMed", "id": "17138891", "url": "https://pubmed.ncbi.nlm.nih.gov/17138891" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17138891", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis thaliana brassinosteroid receptor (AtBRI1) contains a domain that functions as a guanylyl cyclase in vitro.", "journal": "PloS one", "date": "2007-05-23", "authors": "Kwezi Lusisizwe, Meier Stuart, Mungur Lyndon, Ruzvidzo Oziniel, Irving Helen, Gehring Chris", "reference": { "type": "PubMed", "id": "17520012", "url": "https://pubmed.ncbi.nlm.nih.gov/17520012" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17520012", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endosomal signaling of plant steroid receptor kinase BRI1.", "journal": "Genes Dev.", "date": "2007", "authors": "Geldner Niko, Hyman Derek L, Wang Xuelu, Schumacher Karin, Chory Joanne", "reference": { "type": "PubMed", "id": "17578906", "url": "https://pubmed.ncbi.nlm.nih.gov/17578906" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17578906", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Allele-specific suppression of a defective brassinosteroid receptor reveals a physiological role of UGGT in ER quality control.", "journal": "Molecular cell", "date": "2007-06-22", "authors": "Jin Hua, Yan Zhenyan, Nam Kyoung Hee, Li Jianming", "reference": { "type": "PubMed", "id": "17588517", "url": "https://pubmed.ncbi.nlm.nih.gov/17588517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WL80-1", "protein_name": "UDP-glucose:glycoprotein glucosyltransferase", "gene_name": "EBS1; UGGT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 1309, "end_pos": 1309, "sequence_org": "G", "sequence_mut": "E", "comment": "In ebs1-4; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q0WL80", "url": "https://www.uniprot.org/uniprotkb/Q0WL80" }, { "database": "PubMed", "id": "17588517", "url": "https://pubmed.ncbi.nlm.nih.gov/17588517" } ], "uniprot_canonical_ac": "Q0WL80-1" }, { "start_pos": 1500, "end_pos": 1500, "sequence_org": "L", "sequence_mut": "F", "comment": "In ebs1-3; loss of function.", "evidence": [ { "database": "UniProtKB", "id": "Q0WL80", "url": "https://www.uniprot.org/uniprotkb/Q0WL80" }, { "database": "PubMed", "id": "17588517", "url": "https://pubmed.ncbi.nlm.nih.gov/17588517" } ], "uniprot_canonical_ac": "Q0WL80-1" } ], "record_id": "pubmed.17588517", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Is kinase activity essential for biological functions of BRI1?", "journal": "Cell research", "date": "2008-04", "authors": "Xu Weihui, Huang Juan, Li Baohua, Li Jiayang, Wang Yonghong", "reference": { "type": "PubMed", "id": "18332904", "url": "https://pubmed.ncbi.nlm.nih.gov/18332904" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 989, "end_pos": 989, "sequence_org": "G", "sequence_mut": "I", "comment": "In bri1-301; impaired kinase activity and loss of autophosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "18332904", "url": "https://pubmed.ncbi.nlm.nih.gov/18332904" } ], "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.18332904", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BSKs mediate signal transduction from the receptor kinase BRI1 in Arabidopsis.", "journal": "Science (New York, N.Y.)", "date": "2008-07-25", "authors": "Tang Wenqiang, Kim Tae-Wuk, Oses-Prieto Juan A, Sun Yu, Deng Zhiping, Zhu Shengwei, Wang Ruiju, Burlingame Alma L, Wang Zhi-Yong", "reference": { "type": "PubMed", "id": "18653891", "url": "https://pubmed.ncbi.nlm.nih.gov/18653891" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W4L3-1", "protein_name": "Serine/threonine-protein kinase BSK3", "gene_name": "BSK3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q944A7-1", "protein_name": "Serine/threonine-protein kinase BSK1", "gene_name": "BSK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FIL1-1", "protein_name": "Serine/threonine-protein kinase BSK5", "gene_name": "BSK5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LS26-1", "protein_name": "Serine/threonine-protein kinase BSK2", "gene_name": "BSK2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 230, "end_pos": 230, "sequence_org": "S", "sequence_mut": "A", "comment": "Reduces protein phosphorylation 5-fold.", "evidence": [ { "database": "UniProtKB", "id": "Q944A7", "url": "https://www.uniprot.org/uniprotkb/Q944A7" }, { "database": "PubMed", "id": "18653891", "url": "https://pubmed.ncbi.nlm.nih.gov/18653891" } ], "uniprot_canonical_ac": "Q944A7-1" } ], "phosphorylation": [ { "start_pos": 230, "end_pos": 230, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q944A7", "url": "https://www.uniprot.org/uniprotkb/Q944A7" }, { "database": "PubMed", "id": "18653891", "url": "https://pubmed.ncbi.nlm.nih.gov/18653891" }, { "database": "iPTMnet", "id": "Q944A7", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q944A7" }, { "database": "PubMed", "id": "15308754", "url": "https://pubmed.ncbi.nlm.nih.gov/15308754" }, { "database": "PubMed", "id": "17586839", "url": "https://pubmed.ncbi.nlm.nih.gov/17586839" }, { "database": "PubMed", "id": "17651370", "url": "https://pubmed.ncbi.nlm.nih.gov/17651370" }, { "database": "PubMed", "id": "18686298", "url": "https://pubmed.ncbi.nlm.nih.gov/18686298" }, { "database": "PubMed", "id": "19376835", "url": "https://pubmed.ncbi.nlm.nih.gov/19376835" }, { "database": "PubMed", "id": "20466843", "url": "https://pubmed.ncbi.nlm.nih.gov/20466843" }, { "database": "PubMed", "id": "22060019", "url": "https://pubmed.ncbi.nlm.nih.gov/22060019" }, { "database": "PubMed", "id": "23111157", "url": "https://pubmed.ncbi.nlm.nih.gov/23111157" }, { "database": "PubMed", "id": "23776212", "url": "https://pubmed.ncbi.nlm.nih.gov/23776212" }, { "database": "PubMed", "id": "27419465", "url": "https://pubmed.ncbi.nlm.nih.gov/27419465" }, { "database": "PRO", "id": "Q944A7", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q944A7" } ], "site_lbl": "Ser230", "uniprot_canonical_ac": "Q944A7-1" } ], "record_id": "pubmed.18653891", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tyrosine phosphorylation in brassinosteroid signaling.", "journal": "Plant signaling & behavior", "date": "2009-12", "authors": "Oh Man-Ho, Clouse Steven D, Huber Steven C", "reference": { "type": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 1052, "end_pos": 1052, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" } ], "site_lbl": "Tyr1052", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 1057, "end_pos": 1057, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" } ], "site_lbl": "Tyr1057", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 1072, "end_pos": 1072, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" } ], "site_lbl": "Tyr1072", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 831, "end_pos": 831, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "35598220", "url": "https://pubmed.ncbi.nlm.nih.gov/35598220" } ], "site_lbl": "Tyr831", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 956, "end_pos": 956, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" } ], "site_lbl": "Tyr956", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.20514242", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis of steroid hormone perception by the receptor kinase BRI1.", "journal": "Nature", "date": "2011-06-12", "authors": "Hothorn Michael, Belkhadir Youssef, Dreux Marlene, Dabi Tsegaye, Noel Joseph P, Wilson Ian A, Chory Joanne", "reference": { "type": "PubMed", "id": "21666665", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RGX&bu=0&command=select+.A:112;+center+selection;+zoom+selection" }, "start_pos": 112, "start_aa": "Asn", "end_pos": 112, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn112", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "3RGX", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGX" }, { "id": "3RJ0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RJ0" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "4LSX", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSX" }, { "id": "9S8S", "database": "PDB", "url": "https://www.rcsb.org/structure/9S8S" }, { "id": "9S8Z", "database": "PDB", "url": "https://www.rcsb.org/structure/9S8Z" }, { "id": "3RIZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RIZ" }, { "id": "3RGZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 154, "start_aa": "Asn", "end_pos": 154, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn154", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RJ0&bu=0&command=select+.A:233;+center+selection;+zoom+selection" }, "start_pos": 233, "start_aa": "Asn", "end_pos": 233, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn233", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "3RJ0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RJ0" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "9S87", "database": "PDB", "url": "https://www.rcsb.org/structure/9S87" }, { "id": "6FIF", "database": "PDB", "url": "https://www.rcsb.org/structure/6FIF" }, { "id": "3RIZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RIZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RGX&bu=0&command=select+.A:351;+center+selection;+zoom+selection" }, "start_pos": 351, "start_aa": "Asn", "end_pos": 351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn351", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "3RGX", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGX" }, { "id": "3RJ0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RJ0" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "9S87", "database": "PDB", "url": "https://www.rcsb.org/structure/9S87" }, { "id": "6FIF", "database": "PDB", "url": "https://www.rcsb.org/structure/6FIF" }, { "id": "3RIZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RIZ" }, { "id": "3RGZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4M7E&bu=0&command=select+.B:545;+center+selection;+zoom+selection" }, "start_pos": 545, "start_aa": "Asn", "end_pos": 545, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn545", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "4M7E", "database": "PDB", "url": "https://www.rcsb.org/structure/4M7E" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.21666665", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural insight into brassinosteroid perception by BRI1.", "journal": "Nature", "date": "2011-06-12", "authors": "She Ji, Han Zhifu, Kim Tae-Wuk, Wang Jinjing, Cheng Wei, Chang Junbiao, Shi Shuai, Wang Jiawei, Yang Maojun, Wang Zhi-Yong, Chai Jijie", "reference": { "type": "PubMed", "id": "21666666", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RGX&bu=0&command=select+.A:112;+center+selection;+zoom+selection" }, "start_pos": 112, "start_aa": "Asn", "end_pos": 112, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn112", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "3RGX", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGX" }, { "id": "3RJ0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RJ0" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "4LSX", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSX" }, { "id": "9S8S", "database": "PDB", "url": "https://www.rcsb.org/structure/9S8S" }, { "id": "9S8Z", "database": "PDB", "url": "https://www.rcsb.org/structure/9S8Z" }, { "id": "3RIZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RIZ" }, { "id": "3RGZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 154, "start_aa": "Asn", "end_pos": 154, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn154", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RJ0&bu=0&command=select+.A:233;+center+selection;+zoom+selection" }, "start_pos": 233, "start_aa": "Asn", "end_pos": 233, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn233", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "3RJ0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RJ0" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "9S87", "database": "PDB", "url": "https://www.rcsb.org/structure/9S87" }, { "id": "6FIF", "database": "PDB", "url": "https://www.rcsb.org/structure/6FIF" }, { "id": "3RIZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RIZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RGX&bu=0&command=select+.A:351;+center+selection;+zoom+selection" }, "start_pos": 351, "start_aa": "Asn", "end_pos": 351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn351", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "3RGX", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGX" }, { "id": "3RJ0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RJ0" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "9S87", "database": "PDB", "url": "https://www.rcsb.org/structure/9S87" }, { "id": "6FIF", "database": "PDB", "url": "https://www.rcsb.org/structure/6FIF" }, { "id": "3RIZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RIZ" }, { "id": "3RGZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RGX&bu=0&command=select+.A:510;+center+selection;+zoom+selection" }, "start_pos": 510, "start_aa": "Asn", "end_pos": 510, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn510", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "3RGX", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGX" }, { "id": "9S8Z", "database": "PDB", "url": "https://www.rcsb.org/structure/9S8Z" }, { "id": "6FIF", "database": "PDB", "url": "https://www.rcsb.org/structure/6FIF" }, { "id": "3RGZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4M7E&bu=0&command=select+.B:545;+center+selection;+zoom+selection" }, "start_pos": 545, "start_aa": "Asn", "end_pos": 545, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn545", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "4M7E", "database": "PDB", "url": "https://www.rcsb.org/structure/4M7E" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4LSA&bu=0&command=select+.A:573;+center+selection;+zoom+selection" }, "start_pos": 573, "start_aa": "Asn", "end_pos": 573, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn573", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "4LSX", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSX" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.21666666", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_sites", "count": 8 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 8 }, { "field": "exact_n_linked_sites", "count": 8 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_sites", "count": 8 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 8 }, { "field": "exact_n_linked_sites", "count": 8 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enhancing Arabidopsis leaf growth by engineering the BRASSINOSTEROID INSENSITIVE1 receptor kinase.", "journal": "Plant physiology", "date": "2011-09", "authors": "Oh Man-Ho, Sun Jindong, Oh Dong Ha, Zielinski Raymond E, Clouse Steven D, Huber Steven C", "reference": { "type": "PubMed", "id": "21795582", "url": "https://pubmed.ncbi.nlm.nih.gov/21795582" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 831, "end_pos": 831, "kinase_uniprot_canonical_ac": "O22476-1", "kinase_gene_name": "BRI1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PubMed", "id": "21795582", "url": "https://pubmed.ncbi.nlm.nih.gov/21795582" } ], "site_lbl": "Tyr831", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.21795582", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The CDG1 kinase mediates brassinosteroid signal transduction from BRI1 receptor kinase to BSU1 phosphatase and GSK3-like kinase BIN2.", "journal": "Mol. Cell", "date": "2011", "authors": "Kim Tae-Wuk, Guan Shenheng, Burlingame Alma L, Wang Zhi-Yong", "reference": { "type": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L7U5-1", "protein_name": "Serine/threonine-protein phosphatase BSL1", "gene_name": "BSL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LR78-1", "protein_name": "Serine/threonine-protein phosphatase BSU1", "gene_name": "BSU1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39011-1", "protein_name": "Shaggy-related protein kinase eta", "gene_name": "ASK7; BIN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WRY5-1", "protein_name": "Probable serine/threonine-protein kinase PBL7", "gene_name": "PBL7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LSE1-1", "protein_name": "Serine/threonine-protein kinase CDG1", "gene_name": "CDG1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 395, "end_pos": 395, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9LR78", "url": "https://www.uniprot.org/uniprotkb/Q9LR78" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" }, { "database": "iPTMnet", "id": "Q9LR78", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LR78" }, { "database": "PubMed", "id": "18463617", "url": "https://pubmed.ncbi.nlm.nih.gov/18463617" }, { "database": "PubMed", "id": "20466843", "url": "https://pubmed.ncbi.nlm.nih.gov/20466843" }, { "database": "PRO", "id": "Q9LR78", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q9LR78" } ], "site_lbl": "Ser395", "uniprot_canonical_ac": "Q9LR78-1" }, { "start_pos": 444, "end_pos": 444, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9LR78", "url": "https://www.uniprot.org/uniprotkb/Q9LR78" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" }, { "database": "iPTMnet", "id": "Q9LR78", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LR78" }, { "database": "PubMed", "id": "18463617", "url": "https://pubmed.ncbi.nlm.nih.gov/18463617" }, { "database": "PubMed", "id": "20466843", "url": "https://pubmed.ncbi.nlm.nih.gov/20466843" }, { "database": "PubMed", "id": "30833711", "url": "https://pubmed.ncbi.nlm.nih.gov/30833711" }, { "database": "PRO", "id": "Q9LR78", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q9LR78" } ], "site_lbl": "Ser444", "uniprot_canonical_ac": "Q9LR78-1" }, { "start_pos": 764, "end_pos": 764, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9LR78", "url": "https://www.uniprot.org/uniprotkb/Q9LR78" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" }, { "database": "PRO", "id": "Q9LR78", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q9LR78" }, { "database": "iPTMnet", "id": "Q9LR78", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LR78" }, { "database": "PubMed", "id": "35697730", "url": "https://pubmed.ncbi.nlm.nih.gov/35697730" } ], "site_lbl": "Ser764", "uniprot_canonical_ac": "Q9LR78-1" }, { "start_pos": 200, "end_pos": 200, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q39011", "url": "https://www.uniprot.org/uniprotkb/Q39011" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" }, { "database": "iPTMnet", "id": "Q39011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q39011" }, { "database": "PubMed", "id": "22074104", "url": "https://pubmed.ncbi.nlm.nih.gov/22074104" }, { "database": "PubMed", "id": "23111157", "url": "https://pubmed.ncbi.nlm.nih.gov/23111157" }, { "database": "PubMed", "id": "23328941", "url": "https://pubmed.ncbi.nlm.nih.gov/23328941" }, { "database": "PubMed", "id": "23572148", "url": "https://pubmed.ncbi.nlm.nih.gov/23572148" }, { "database": "PubMed", "id": "23776212", "url": "https://pubmed.ncbi.nlm.nih.gov/23776212" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PubMed", "id": "26091701", "url": "https://pubmed.ncbi.nlm.nih.gov/26091701" }, { "database": "PubMed", "id": "27532006", "url": "https://pubmed.ncbi.nlm.nih.gov/27532006" }, { "database": "PubMed", "id": "28011693", "url": "https://pubmed.ncbi.nlm.nih.gov/28011693" }, { "database": "PubMed", "id": "29167316", "url": "https://pubmed.ncbi.nlm.nih.gov/29167316" }, { "database": "PubMed", "id": "30833711", "url": "https://pubmed.ncbi.nlm.nih.gov/30833711" }, { "database": "PRO", "id": "Q39011", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q39011" }, { "database": "PubMed", "id": "32221308", "url": "https://pubmed.ncbi.nlm.nih.gov/32221308" } ], "site_lbl": "Tyr200", "uniprot_canonical_ac": "Q39011-1" }, { "start_pos": 234, "end_pos": 234, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9LSE1", "url": "https://www.uniprot.org/uniprotkb/Q9LSE1" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" }, { "database": "PRO", "id": "Q9LSE1", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q9LSE1" }, { "database": "iPTMnet", "id": "Q9LSE1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LSE1" } ], "site_lbl": "Ser234", "uniprot_canonical_ac": "Q9LSE1-1" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9LSE1", "url": "https://www.uniprot.org/uniprotkb/Q9LSE1" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" }, { "database": "PRO", "id": "Q9LSE1", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q9LSE1" }, { "database": "iPTMnet", "id": "Q9LSE1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LSE1" } ], "site_lbl": "Ser44", "uniprot_canonical_ac": "Q9LSE1-1" }, { "start_pos": 47, "end_pos": 47, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9LSE1", "url": "https://www.uniprot.org/uniprotkb/Q9LSE1" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" }, { "database": "PRO", "id": "Q9LSE1", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q9LSE1" }, { "database": "iPTMnet", "id": "Q9LSE1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9LSE1" } ], "site_lbl": "Ser47", "uniprot_canonical_ac": "Q9LSE1-1" } ], "mutagenesis": [ { "start_pos": 147, "end_pos": 147, "sequence_org": "Y", "sequence_mut": "G", "comment": "Loss of kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9LSE1", "url": "https://www.uniprot.org/uniprotkb/Q9LSE1" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" } ], "uniprot_canonical_ac": "Q9LSE1-1" }, { "start_pos": 4, "end_pos": 4, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of plasma membrane localization; when associated with Ala-6.", "evidence": [ { "database": "UniProtKB", "id": "Q9LSE1", "url": "https://www.uniprot.org/uniprotkb/Q9LSE1" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" } ], "uniprot_canonical_ac": "Q9LSE1-1" }, { "start_pos": 6, "end_pos": 6, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of plasma membrane localization; when associated with Ala-4.", "evidence": [ { "database": "UniProtKB", "id": "Q9LSE1", "url": "https://www.uniprot.org/uniprotkb/Q9LSE1" }, { "database": "PubMed", "id": "21855796", "url": "https://pubmed.ncbi.nlm.nih.gov/21855796" } ], "uniprot_canonical_ac": "Q9LSE1-1" } ], "record_id": "pubmed.21855796", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deactivation of the Arabidopsis BRASSINOSTEROID INSENSITIVE 1 (BRI1) receptor kinase by autophosphorylation within the glycine-rich loop.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012-01-03", "authors": "Oh Man-Ho, Wang Xiaofeng, Clouse Steven D, Huber Steven C", "reference": { "type": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 858, "end_pos": 858, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" } ], "site_lbl": "Ser858", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 872, "end_pos": 872, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "26284086", "url": "https://pubmed.ncbi.nlm.nih.gov/26284086" } ], "site_lbl": "Thr872", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 891, "end_pos": 891, "kinase_uniprot_canonical_ac": "O22476-1", "kinase_gene_name": "BRI1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" } ], "site_lbl": "Ser891", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 891, "end_pos": 891, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "site_lbl": "Ser891", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.22184234", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tyrosine Phosphorylation of the BRI1 Receptor Kinase Occurs via a Post-Translational Modification and is Activated by the Juxtamembrane Domain.", "journal": "Frontiers in plant science", "date": "2012", "authors": "Oh Man-Ho, Clouse Steven D, Huber Steven C", "reference": { "type": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 1072, "end_pos": 1072, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" } ], "site_lbl": "Tyr1072", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 831, "end_pos": 831, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "35598220", "url": "https://pubmed.ncbi.nlm.nih.gov/35598220" } ], "site_lbl": "Tyr831", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 858, "end_pos": 858, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "18694562", "url": "https://pubmed.ncbi.nlm.nih.gov/18694562" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" } ], "site_lbl": "Ser858", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 872, "end_pos": 872, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "26284086", "url": "https://pubmed.ncbi.nlm.nih.gov/26284086" } ], "site_lbl": "Thr872", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 891, "end_pos": 891, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" } ], "site_lbl": "Ser891", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 956, "end_pos": 956, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" } ], "site_lbl": "Tyr956", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.22891071", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BSKs are partially redundant positive regulators of brassinosteroid signaling in Arabidopsis.", "journal": "The Plant journal : for cell and molecular biology", "date": "2013-06", "authors": "Sreeramulu Shivakumar, Mostizky Yana, Sunitha Sukumaran, Shani Eilon, Nahum Hadas, Salomon Dor, Hayun Liat Ben, Gruetter Christian, Rauh Daniel, Ori Naomi, Sessa Guido", "reference": { "type": "PubMed", "id": "23496207", "url": "https://pubmed.ncbi.nlm.nih.gov/23496207" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W4L3-1", "protein_name": "Serine/threonine-protein kinase BSK3", "gene_name": "BSK3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q944A7-1", "protein_name": "Serine/threonine-protein kinase BSK1", "gene_name": "BSK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4I3M3-1", "protein_name": "Serine/threonine-protein kinase BSK7", "gene_name": "BSK7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FIL1-1", "protein_name": "Serine/threonine-protein kinase BSK5", "gene_name": "BSK5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39011-1", "protein_name": "Shaggy-related protein kinase eta", "gene_name": "ASK7; BIN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FHD7-1", "protein_name": "Serine/threonine-protein kinase BSK8", "gene_name": "BSK8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39012-1", "protein_name": "Shaggy-related protein kinase iota", "gene_name": "ASK9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4HU55-1", "protein_name": "Serine/threonine-protein kinase BSK4", "gene_name": "BSK4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4I7Y4-1", "protein_name": "Serine/threonine-protein kinase BSK11", "gene_name": "BSK11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M324-1", "protein_name": "Serine/threonine-protein kinase BSK6", "gene_name": "BSK6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 69, "end_pos": 69, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes kinase activity. Altered BASL exclusion from nucleus.", "evidence": [ { "database": "UniProtKB", "id": "Q39011", "url": "https://www.uniprot.org/uniprotkb/Q39011" }, { "database": "PubMed", "id": "11847343", "url": "https://pubmed.ncbi.nlm.nih.gov/11847343" }, { "database": "PubMed", "id": "30429609", "url": "https://pubmed.ncbi.nlm.nih.gov/30429609" }, { "database": "PubMed", "id": "23496207", "url": "https://pubmed.ncbi.nlm.nih.gov/23496207" } ], "uniprot_canonical_ac": "Q39011-1" }, { "start_pos": 213, "end_pos": 213, "sequence_org": "S", "sequence_mut": "A", "comment": "Slightly reduces BSK8 protein phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9FHD7", "url": "https://www.uniprot.org/uniprotkb/Q9FHD7" }, { "database": "PubMed", "id": "23496207", "url": "https://pubmed.ncbi.nlm.nih.gov/23496207" } ], "uniprot_canonical_ac": "Q9FHD7-1" }, { "start_pos": 99, "end_pos": 99, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolishes kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q39012", "url": "https://www.uniprot.org/uniprotkb/Q39012" }, { "database": "PubMed", "id": "23496207", "url": "https://pubmed.ncbi.nlm.nih.gov/23496207" } ], "uniprot_canonical_ac": "Q39012-1" }, { "start_pos": 210, "end_pos": 210, "sequence_org": "S", "sequence_mut": "A", "comment": "Slightly reduces BSK6 protein phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9M324", "url": "https://www.uniprot.org/uniprotkb/Q9M324" }, { "database": "PubMed", "id": "23496207", "url": "https://pubmed.ncbi.nlm.nih.gov/23496207" } ], "uniprot_canonical_ac": "Q9M324-1" } ], "record_id": "pubmed.23496207", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inverse modulation of plant immune and brassinosteroid signaling pathways by the receptor-like cytoplasmic kinase BIK1.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2013", "authors": "Lin Wenwei, Lu Dongping, Gao Xiquan, Jiang Shan, Ma Xiyu, Wang Zonghua, Mengiste Tesfaye, He Ping, Shan Libo", "reference": { "type": "PubMed", "id": "23818580", "url": "https://pubmed.ncbi.nlm.nih.gov/23818580" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O48814-1", "protein_name": "Serine/threonine-protein kinase BIK1", "gene_name": "BIK1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23818580", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular mechanism for plant steroid receptor activation by somatic embryogenesis co-receptor kinases.", "journal": "Science (New York, N.Y.)", "date": "2013-08-23", "authors": "Santiago Julia, Henzler Christine, Hothorn Michael", "reference": { "type": "PubMed", "id": "23929946", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94AG2-1", "protein_name": "Somatic embryogenesis receptor kinase 1", "gene_name": "SERK1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RGX&bu=0&command=select+.A:112;+center+selection;+zoom+selection" }, "start_pos": 112, "start_aa": "Asn", "end_pos": 112, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn112", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "3RGX", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGX" }, { "id": "3RJ0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RJ0" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "4LSX", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSX" }, { "id": "9S8S", "database": "PDB", "url": "https://www.rcsb.org/structure/9S8S" }, { "id": "9S8Z", "database": "PDB", "url": "https://www.rcsb.org/structure/9S8Z" }, { "id": "3RIZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RIZ" }, { "id": "3RGZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 154, "start_aa": "Asn", "end_pos": 154, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn154", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RJ0&bu=0&command=select+.A:233;+center+selection;+zoom+selection" }, "start_pos": 233, "start_aa": "Asn", "end_pos": 233, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn233", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "3RJ0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RJ0" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "9S87", "database": "PDB", "url": "https://www.rcsb.org/structure/9S87" }, { "id": "6FIF", "database": "PDB", "url": "https://www.rcsb.org/structure/6FIF" }, { "id": "3RIZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RIZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3RGX&bu=0&command=select+.A:351;+center+selection;+zoom+selection" }, "start_pos": 351, "start_aa": "Asn", "end_pos": 351, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn351", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "3RGX", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGX" }, { "id": "3RJ0", "database": "PDB", "url": "https://www.rcsb.org/structure/3RJ0" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "9S87", "database": "PDB", "url": "https://www.rcsb.org/structure/9S87" }, { "id": "6FIF", "database": "PDB", "url": "https://www.rcsb.org/structure/6FIF" }, { "id": "3RIZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RIZ" }, { "id": "3RGZ", "database": "PDB", "url": "https://www.rcsb.org/structure/3RGZ" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4M7E&bu=0&command=select+.B:545;+center+selection;+zoom+selection" }, "start_pos": 545, "start_aa": "Asn", "end_pos": 545, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn545", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "4M7E", "database": "PDB", "url": "https://www.rcsb.org/structure/4M7E" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4LSA&bu=0&command=select+.A:573;+center+selection;+zoom+selection" }, "start_pos": 573, "start_aa": "Asn", "end_pos": 573, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn573", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "4LSA", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSA" }, { "id": "4LSX", "database": "PDB", "url": "https://www.rcsb.org/structure/4LSX" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4LSX&bu=0&command=select+.C:104;+center+selection;+zoom+selection" }, "start_pos": 104, "start_aa": "Asn", "end_pos": 104, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn104", "evidence": [ { "id": "Q94AG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q94AG2#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "4LSX", "database": "PDB", "url": "https://www.rcsb.org/sequence/4LSX" }, { "id": "4LSC", "database": "PDB", "url": "https://www.rcsb.org/sequence/4LSC" }, { "id": "PRU00498", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "7ODV", "database": "PDB", "url": "https://www.rcsb.org/structure/7ODV" }, { "id": "7OGO", "database": "PDB", "url": "https://www.rcsb.org/structure/7OGO" }, { "id": "7OGU", "database": "PDB", "url": "https://www.rcsb.org/structure/7OGU" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q94AG2-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4LSC&bu=0&command=select+.A:150;+center+selection;+zoom+selection" }, "start_pos": 150, "start_aa": "Asn", "end_pos": 150, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn150", "evidence": [ { "id": "Q94AG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q94AG2#ptm_processing" }, { "id": "27058169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27058169" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "4LSX", "database": "PDB", "url": "https://www.rcsb.org/sequence/4LSX" }, { "id": "26308901", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26308901" }, { "id": "5IYX", "database": "PDB", "url": "https://www.rcsb.org/sequence/5IYX" }, { "id": "4Z64", "database": "PDB", "url": "https://www.rcsb.org/sequence/4Z64" }, { "id": "4LSC", "database": "PDB", "url": "https://www.rcsb.org/sequence/4LSC" }, { "id": "PRU00498", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "7OGU", "database": "PDB", "url": "https://www.rcsb.org/structure/7OGU" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q94AG2-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4LSX&bu=0&command=select+.D:163;+center+selection;+zoom+selection" }, "start_pos": 163, "start_aa": "Asn", "end_pos": 163, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn163", "evidence": [ { "id": "Q94AG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q94AG2#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "4LSX", "database": "PDB", "url": "https://www.rcsb.org/sequence/4LSX" }, { "id": "PRU00498", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/PRU00498" }, { "id": "7ODV", "database": "PDB", "url": "https://www.rcsb.org/structure/7ODV" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q94AG2-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4LSC&bu=0&command=select+.A:184;+center+selection;+zoom+selection" }, "start_pos": 184, "start_aa": "Asn", "end_pos": 184, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn184", "evidence": [ { "id": "Q94AG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q94AG2#ptm_processing" }, { "id": "27058169", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27058169" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "5IYX", "database": "PDB", "url": "https://www.rcsb.org/sequence/5IYX" }, { "id": "4LSC", "database": "PDB", "url": "https://www.rcsb.org/sequence/4LSC" }, { "id": "PRU00498", "database": "PROSITE-ProRule", "url": "https://prosite.expasy.org/rule/PRU00498" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q94AG2-1" } ], "record_id": "pubmed.23929946", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_sites", "count": 11 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 11 }, { "field": "exact_n_linked_sites", "count": 11 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_sites", "count": 11 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 11 }, { "field": "exact_n_linked_sites", "count": 11 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structures of the phosphorylated BRI1 kinase domain and implications for brassinosteroid signal initiation.", "journal": "The Plant journal : for cell and molecular biology", "date": "2014-04", "authors": "Bojar Daniel, Martinez Jacobo, Santiago Julia, Rybin Vladimir, Bayliss Richard, Hothorn Michael", "reference": { "type": "PubMed", "id": "24461462", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 154, "start_aa": "Asn", "end_pos": 154, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn154", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4M7E&bu=0&command=select+.B:545;+center+selection;+zoom+selection" }, "start_pos": 545, "start_aa": "Asn", "end_pos": 545, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn545", "evidence": [ { "id": "O22476", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O22476#ptm_processing" }, { "id": "23929946", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23929946" }, { "id": "21666666", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666666" }, { "id": "24461462", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24461462" }, { "id": "21666665", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21666665" }, { "id": "4M7E", "database": "PDB", "url": "https://www.rcsb.org/structure/4M7E" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.24461462", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of the BRI1 receptor kinase by Thr-for-Ser substitution in a regulatory autophosphorylation site.", "journal": "Frontiers in plant science", "date": "2015", "authors": "Oh Man-Ho, Bender Kyle W, Kim Sang Y, Wu Xia, Lee Seulki, Nou Ill-Sup, Zielinski Raymond E, Clouse Steven D, Huber Steven C", "reference": { "type": "PubMed", "id": "26284086", "url": "https://pubmed.ncbi.nlm.nih.gov/26284086" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 872, "end_pos": 872, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "11027724", "url": "https://pubmed.ncbi.nlm.nih.gov/11027724" }, { "database": "PubMed", "id": "15894717", "url": "https://pubmed.ncbi.nlm.nih.gov/15894717" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "22184234", "url": "https://pubmed.ncbi.nlm.nih.gov/22184234" }, { "database": "PubMed", "id": "11268216", "url": "https://pubmed.ncbi.nlm.nih.gov/11268216" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "26284086", "url": "https://pubmed.ncbi.nlm.nih.gov/26284086" } ], "site_lbl": "Thr872", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.26284086", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of Arabidopsis brassinosteroid receptor BRI1 endocytosis and degradation by plant U-box PUB12/PUB13-mediated ubiquitination.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018-02-20", "authors": "Zhou Jinggeng, Liu Derui, Wang Ping, Ma Xiyu, Lin Wenwei, Chen Sixue, Mishev Kiril, Lu Dongping, Kumar Rahul, Vanhoutte Isabelle, Meng Xiangzong, He Ping, Russinova Eugenia, Shan Libo", "reference": { "type": "PubMed", "id": "29432171", "url": "https://pubmed.ncbi.nlm.nih.gov/29432171" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SNC6-1", "protein_name": "U-box domain-containing protein 13", "gene_name": "PUB13", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 344, "end_pos": 344, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "29432171", "url": "https://pubmed.ncbi.nlm.nih.gov/29432171" } ], "site_lbl": "Ser344", "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 344, "end_pos": 344, "kinase_uniprot_canonical_ac": "O22476-1", "kinase_gene_name": "BRI1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q9SNC6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9SNC6" }, { "database": "PubMed", "id": "29432171", "url": "https://pubmed.ncbi.nlm.nih.gov/29432171" } ], "site_lbl": "Ser344", "uniprot_canonical_ac": "Q9SNC6-1" } ], "record_id": "pubmed.29432171", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of tyrosine autophosphorylation and methionine residues in BRI1 function in Arabidopsis thaliana.", "journal": "Genes & genomics", "date": "2022-07", "authors": "Choi Jae-Han, Oh Eun-Seok, Min Hansol, Chae Won Byoung, Mandadi Kranthi Kiran, Oh Man-Ho", "reference": { "type": "PubMed", "id": "35598220", "url": "https://pubmed.ncbi.nlm.nih.gov/35598220" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 831, "end_pos": 831, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "19124768", "url": "https://pubmed.ncbi.nlm.nih.gov/19124768" }, { "database": "PRO", "id": "O22476", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=O22476" }, { "database": "iPTMnet", "id": "O22476", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O22476" }, { "database": "PubMed", "id": "20514242", "url": "https://pubmed.ncbi.nlm.nih.gov/20514242" }, { "database": "PubMed", "id": "22891071", "url": "https://pubmed.ncbi.nlm.nih.gov/22891071" }, { "database": "PubMed", "id": "35598220", "url": "https://pubmed.ncbi.nlm.nih.gov/35598220" } ], "site_lbl": "Tyr831", "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.35598220", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A putative leucine-rich repeat receptor kinase involved in brassinosteroid signal transduction.", "journal": "Cell", "date": "1997-09-05", "authors": "Li J, Chory J", "reference": { "type": "PubMed", "id": "9298904", "url": "https://pubmed.ncbi.nlm.nih.gov/9298904" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22476-1", "protein_name": "Protein BRASSINOSTEROID INSENSITIVE 1", "gene_name": "BRI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 1031, "end_pos": 1031, "sequence_org": "A", "sequence_mut": "T", "comment": "In bri1-104; brassinosteroid-insensitive dwarf mutant and slightly reduced activity, but no effect on interaction with TTL.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "9298904", "url": "https://pubmed.ncbi.nlm.nih.gov/9298904" }, { "database": "PubMed", "id": "15319482", "url": "https://pubmed.ncbi.nlm.nih.gov/15319482" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 1048, "end_pos": 1048, "sequence_org": "G", "sequence_mut": "D", "comment": "In bri1-115; brassinosteroid-insensitive dwarf mutant, reduced activity and no interaction with TTL.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "9298904", "url": "https://pubmed.ncbi.nlm.nih.gov/9298904" }, { "database": "PubMed", "id": "15319482", "url": "https://pubmed.ncbi.nlm.nih.gov/15319482" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 1078, "end_pos": 1078, "sequence_org": "E", "sequence_mut": "K", "comment": "In bri1-101; brassinosteroid-insensitive dwarf mutant, lost activity and no interaction with TTL.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "9298904", "url": "https://pubmed.ncbi.nlm.nih.gov/9298904" }, { "database": "PubMed", "id": "15319482", "url": "https://pubmed.ncbi.nlm.nih.gov/15319482" } ], "uniprot_canonical_ac": "O22476-1" }, { "start_pos": 611, "end_pos": 611, "sequence_org": "G", "sequence_mut": "E", "comment": "In bri1-113; brassinosteroid-insensitive semi-dwarf mutant.", "evidence": [ { "database": "UniProtKB", "id": "O22476", "url": "https://www.uniprot.org/uniprotkb/O22476" }, { "database": "PubMed", "id": "9298904", "url": "https://pubmed.ncbi.nlm.nih.gov/9298904" } ], "uniprot_canonical_ac": "O22476-1" } ], "record_id": "pubmed.9298904", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of chlorophyllase, the key enzyme in chlorophyll degradation: finding of a lipase motif and the induction by methyl jasmonate.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999-12-21", "authors": "Tsuchiya T, Ohta H, Okawa K, Iwamatsu A, Shimada H, Masuda T, Takamiya K", "reference": { "type": "PubMed", "id": "10611389", "url": "https://pubmed.ncbi.nlm.nih.gov/10611389" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22527-1", "protein_name": "Chlorophyllase-1", "gene_name": "CLH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M7I7-1", "protein_name": "Chlorophyllase-2", "gene_name": "CLH2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22527", "url": "https://www.uniprot.org/uniprotkb/O22527" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10611389", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Altering the expression of the chlorophyllase gene ATHCOR1 in transgenic Arabidopsis caused changes in the chlorophyll-to-chlorophyllide ratio.", "journal": "Plant physiology", "date": "2002-04", "authors": "Benedetti Celso Eduardo, Arruda Paulo", "reference": { "type": "PubMed", "id": "11950974", "url": "https://pubmed.ncbi.nlm.nih.gov/11950974" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22527-1", "protein_name": "Chlorophyllase-1", "gene_name": "CLH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M7I7-1", "protein_name": "Chlorophyllase-2", "gene_name": "CLH2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22527", "url": "https://www.uniprot.org/uniprotkb/O22527" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11950974", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chlorophyllase 1, a damage control enzyme, affects the balance between defense pathways in plants.", "journal": "The Plant cell", "date": "2005-01", "authors": "Kariola Tarja, Brader G\u00fcnter, Li Jing, Palva E Tapio", "reference": { "type": "PubMed", "id": "15598807", "url": "https://pubmed.ncbi.nlm.nih.gov/15598807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22527-1", "protein_name": "Chlorophyllase-1", "gene_name": "CLH1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22527", "url": "https://www.uniprot.org/uniprotkb/O22527" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15598807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The chlorophyllases AtCLH1 and AtCLH2 are not essential for senescence-related chlorophyll breakdown in Arabidopsis thaliana.", "journal": "FEBS letters", "date": "2007-11-27", "authors": "Schenk Nicole, Schelbert Silvia, Kanwischer Marion, Goldschmidt Eliezer E, D\u00f6rmann Peter, H\u00f6rtensteiner Stefan", "reference": { "type": "PubMed", "id": "17996203", "url": "https://pubmed.ncbi.nlm.nih.gov/17996203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22527-1", "protein_name": "Chlorophyllase-1", "gene_name": "CLH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M7I7-1", "protein_name": "Chlorophyllase-2", "gene_name": "CLH2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22527", "url": "https://www.uniprot.org/uniprotkb/O22527" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17996203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Repression of AtCLH1 expression results in a decrease in the ratio of chlorophyll a/b but doesnot affect the rate of chlorophyll degradation during leaf senescence.", "journal": "Zhi wu sheng li yu fen zi sheng wu xue xue bao = Journal of plant physiology and molecular biology", "date": "2007-12", "authors": "Zhou Xiao, Liao Yang, Ren Guo-Dong, Zhang Yan-Yan, Chen Wen-Jun, Kuai Ben-Ke", "reference": { "type": "PubMed", "id": "18349515", "url": "https://pubmed.ncbi.nlm.nih.gov/18349515" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22527-1", "protein_name": "Chlorophyllase-1", "gene_name": "CLH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M7I7-1", "protein_name": "Chlorophyllase-2", "gene_name": "CLH2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22527", "url": "https://www.uniprot.org/uniprotkb/O22527" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18349515", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of enzymes involved in chlorophyll catabolism in Arabidopsis is light controlled.", "journal": "Plant Physiol.", "date": "2011", "authors": "Banas Agnieszka Katarzyna, \u0141abuz Justyna, Sztatelman Olga, Gabrys Halina, Fiedor Leszek", "reference": { "type": "PubMed", "id": "21896889", "url": "https://pubmed.ncbi.nlm.nih.gov/21896889" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22527-1", "protein_name": "Chlorophyllase-1", "gene_name": "CLH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M7I7-1", "protein_name": "Chlorophyllase-2", "gene_name": "CLH2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22527", "url": "https://www.uniprot.org/uniprotkb/O22527" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21896889", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]