[ { "title": "Functional characterization of novel human ARFGAP3.", "journal": "FEBS letters", "date": "2001", "authors": "Liu X, Zhang C, Xing G, Chen Q, He F", "reference": { "type": "PubMed", "id": "11172815", "url": "https://pubmed.ncbi.nlm.nih.gov/11172815" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11172815", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The coatomer-interacting protein Dsl1p is required for Golgi-to-endoplasmic reticulum retrieval in yeast.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Andag U, Neumann T, Schmitt HD", "reference": { "type": "PubMed", "id": "11493604", "url": "https://pubmed.ncbi.nlm.nih.gov/11493604" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53847-1", "protein_name": "Protein transport protein DSL1", "gene_name": "DSL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 725, "end_pos": 754, "sequence_org": "QWIELLFADTPLRRNAIDDIYEIRGTALDD", "sequence_mut": "", "comment": "In dsl1-22; strong Golgi-ER retrograde transport defect.", "evidence": [ { "database": "UniProtKB", "id": "P53847", "url": "https://www.uniprot.org/uniprotkb/P53847" }, { "database": "PubMed", "id": "11493604", "url": "https://pubmed.ncbi.nlm.nih.gov/11493604" } ], "uniprot_canonical_ac": "P53847-1" } ], "record_id": "pubmed.11493604", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chimaerins, novel non-protein kinase C phorbol ester receptors, associate with Tmp21-I (p23): evidence for a novel anchoring mechanism involving the chimaerin C1 domain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang H, Kazanietz MG", "reference": { "type": "PubMed", "id": "11689559", "url": "https://pubmed.ncbi.nlm.nih.gov/11689559" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11689559", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "KDEL-cargo regulates interactions between proteins involved in COPI vesicle traffic: measurements in living cells using FRET.", "journal": "Developmental cell", "date": "2001", "authors": "Majoul I, Straub M, Hell SW, Duden R, Soling HD", "reference": { "type": "PubMed", "id": "11703931", "url": "https://pubmed.ncbi.nlm.nih.gov/11703931" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q63584-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "Tmed10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q63524-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "Tmed2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P84080-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62848-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "Arfgap1; Col20a1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 71, "end_pos": 71, "sequence_org": "Q", "sequence_mut": "L", "comment": "Mainly GTP-bound form; abolishes interaction with TMED10.", "evidence": [ { "database": "UniProtKB", "id": "P84080", "url": "https://www.uniprot.org/uniprotkb/P84080" }, { "database": "PubMed", "id": "11703931", "url": "https://pubmed.ncbi.nlm.nih.gov/11703931" } ], "uniprot_canonical_ac": "P84080-1" } ], "record_id": "pubmed.11703931", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 157 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recruitment to Golgi membranes of ADP-ribosylation factor 1 is mediated by the cytoplasmic domain of p23.", "journal": "The EMBO journal", "date": "2001", "authors": "Gommel DU, Memon AR, Heiss A, Lottspeich F, Pfannstiel J, Lechner J, Reinhard C, Helms JB, Nickel W, Wieland FT", "reference": { "type": "PubMed", "id": "11726511", "url": "https://pubmed.ncbi.nlm.nih.gov/11726511" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11726511", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Golgi-to-endoplasmic reticulum (ER) retrograde traffic in yeast requires Dsl1p, a component of the ER target site that interacts with a COPI coat subunit.", "journal": "Molecular biology of the cell", "date": "2001", "authors": "Reilly BA, Kraynack BA, VanRheenen SM, Waters MG", "reference": { "type": "PubMed", "id": "11739780", "url": "https://pubmed.ncbi.nlm.nih.gov/11739780" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53847-1", "protein_name": "Protein transport protein DSL1", "gene_name": "DSL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11739780", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 102 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GBF1, a guanine nucleotide exchange factor for ADP-ribosylation factors, is localized to the cis-Golgi and involved in membrane association of the COPI coat.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002", "authors": "Kawamoto K, Yoshida Y, Tamaki H, Torii S, Shinotsuka C, Yamashina S, Nakayama K", "reference": { "type": "PubMed", "id": "12047556", "url": "https://pubmed.ncbi.nlm.nih.gov/12047556" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12047556", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dsl1p, an essential component of the Golgi-endoplasmic reticulum retrieval system in yeast, uses the same sequence motif to interact with different subunits of the COPI vesicle coat.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Andag U, Schmitt HD", "reference": { "type": "PubMed", "id": "14504276", "url": "https://pubmed.ncbi.nlm.nih.gov/14504276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53847-1", "protein_name": "Protein transport protein DSL1", "gene_name": "DSL1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P43621-1", "protein_name": "Coatomer subunit delta", "gene_name": "RET2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 413, "end_pos": 413, "sequence_org": "W", "sequence_mut": "A", "comment": "Viable and reduced interaction with RET2, strong Golgi-ER retrograde transport defect. Loss of interaction with RET2; when associated with A-455. Lethal and loss of interactions with RET1 and RET2; when associated with A-425.", "evidence": [ { "database": "UniProtKB", "id": "P53847", "url": "https://www.uniprot.org/uniprotkb/P53847" }, { "database": "PubMed", "id": "14504276", "url": "https://pubmed.ncbi.nlm.nih.gov/14504276" } ], "uniprot_canonical_ac": "P53847-1" }, { "start_pos": 425, "end_pos": 425, "sequence_org": "W", "sequence_mut": "A", "comment": "Loss of interaction with RET1; when associated with A-413.", "evidence": [ { "database": "UniProtKB", "id": "P53847", "url": "https://www.uniprot.org/uniprotkb/P53847" }, { "database": "PubMed", "id": "14504276", "url": "https://pubmed.ncbi.nlm.nih.gov/14504276" } ], "uniprot_canonical_ac": "P53847-1" }, { "start_pos": 455, "end_pos": 455, "sequence_org": "W", "sequence_mut": "A", "comment": "Viable and no effect. Lethal and loss of interaction with RET2 and reduced interaction with RET1; when associated with A-413.", "evidence": [ { "database": "UniProtKB", "id": "P53847", "url": "https://www.uniprot.org/uniprotkb/P53847" }, { "database": "PubMed", "id": "14504276", "url": "https://pubmed.ncbi.nlm.nih.gov/14504276" } ], "uniprot_canonical_ac": "P53847-1" } ], "record_id": "pubmed.14504276", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 103 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lipid packing sensed by ArfGAP1 couples COPI coat disassembly to membrane bilayer curvature.", "journal": "Nature", "date": "2003", "authors": "Bigay J, Gounon P, Robineau S, Antonny B", "reference": { "type": "PubMed", "id": "14654841", "url": "https://pubmed.ncbi.nlm.nih.gov/14654841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14654841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Involvement of BNIP1 in apoptosis and endoplasmic reticulum membrane fusion.", "journal": "The EMBO journal", "date": "2004", "authors": "Nakajima K, Hirose H, Taniguchi M, Kurashina H, Arasaki K, Nagahama M, Tani K, Yamamoto A, Tagaya M", "reference": { "type": "PubMed", "id": "15272311", "url": "https://pubmed.ncbi.nlm.nih.gov/15272311" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 114, "end_pos": 114, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of proapoptotic effect. No effect on interaction with RINT1.", "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" }, { "database": "PubMed", "id": "15272311", "url": "https://pubmed.ncbi.nlm.nih.gov/15272311" } ], "uniprot_canonical_ac": "Q12981-4" } ], "record_id": "pubmed.15272311", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamics of GBF1, a Brefeldin A-sensitive Arf1 exchange factor at the Golgi.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Niu TK, Pfeifer AC, Lippincott-Schwartz J, Jackson CL", "reference": { "type": "PubMed", "id": "15616190", "url": "https://pubmed.ncbi.nlm.nih.gov/15616190" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 833, "end_pos": 833, "sequence_org": "M", "sequence_mut": "L", "comment": "Confers BFA tolerance.", "evidence": [ { "database": "UniProtKB", "id": "Q92538", "url": "https://www.uniprot.org/uniprotkb/Q92538" }, { "database": "PubMed", "id": "15616190", "url": "https://pubmed.ncbi.nlm.nih.gov/15616190" } ], "uniprot_canonical_ac": "Q92538-4" } ], "record_id": "pubmed.15616190", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Live imaging of bidirectional traffic from the ERGIC.", "journal": "Journal of cell science", "date": "2005", "authors": "Ben-Tekaya H, Miura K, Pepperkok R, Hauri HP", "reference": { "type": "PubMed", "id": "15632110", "url": "https://pubmed.ncbi.nlm.nih.gov/15632110" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15632110", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dissection of membrane dynamics of the ARF-guanine nucleotide exchange factor GBF1.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2005", "authors": "Szul T, Garcia-Mata R, Brandon E, Shestopal S, Alvarez C, Sztul E", "reference": { "type": "PubMed", "id": "15813748", "url": "https://pubmed.ncbi.nlm.nih.gov/15813748" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15813748", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isoform-selective effects of the depletion of ADP-ribosylation factors 1-5 on membrane traffic.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Volpicelli-Daley LA, Li Y, Zhang CJ, Kahn RA", "reference": { "type": "PubMed", "id": "16030262", "url": "https://pubmed.ncbi.nlm.nih.gov/16030262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16030262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ADP-ribosylation factor, a small GTP-binding protein, is required for binding of the coatomer protein beta-COP to Golgi membranes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Donaldson JG, Cassel D, Kahn RA, Klausner RD", "reference": { "type": "PubMed", "id": "1631136", "url": "https://pubmed.ncbi.nlm.nih.gov/1631136" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0JN39-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1631136", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 154 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ARF proteins: roles in membrane traffic and beyond.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "D'Souza-Schorey C, Chavrier P", "reference": { "type": "PubMed", "id": "16633337", "url": "https://pubmed.ncbi.nlm.nih.gov/16633337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16633337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ADP-ribosylation factor is a subunit of the coat of Golgi-derived COP-coated vesicles: a novel role for a GTP-binding protein.", "journal": "Cell", "date": "1991", "authors": "Serafini T, Orci L, Amherdt M, Brunner M, Kahn RA, Rothman JE", "reference": { "type": "PubMed", "id": "1680566", "url": "https://pubmed.ncbi.nlm.nih.gov/1680566" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1680566", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GBF1, a cis-Golgi and VTCs-localized ARF-GEF, is implicated in ER-to-Golgi protein traffic.", "journal": "Journal of cell science", "date": "2006", "authors": "Zhao X, Claude A, Chun J, Shields DJ, Presley JF, Melancon P", "reference": { "type": "PubMed", "id": "16926190", "url": "https://pubmed.ncbi.nlm.nih.gov/16926190" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16926190", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coatomer, the coat protein of COPI transport vesicles, discriminates endoplasmic reticulum residents from p24 proteins.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Bethune J, Kol M, Hoffmann J, Reckmann I, Brugger B, Wieland F", "reference": { "type": "PubMed", "id": "16940185", "url": "https://pubmed.ncbi.nlm.nih.gov/16940185" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53620-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16940185", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 154 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A role for kinesin-2 in COPI-dependent recycling between the ER and the Golgi complex.", "journal": "Current biology : CB", "date": "2006", "authors": "Stauber T, Simpson JC, Pepperkok R, Vernos I", "reference": { "type": "PubMed", "id": "17113389", "url": "https://pubmed.ncbi.nlm.nih.gov/17113389" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17113389", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two lipid-packing sensor motifs contribute to the sensitivity of ArfGAP1 to membrane curvature.", "journal": "Biochemistry", "date": "2007", "authors": "Mesmin B, Drin G, Levi S, Rawet M, Cassel D, Bigay J, Antonny B", "reference": { "type": "PubMed", "id": "17253781", "url": "https://pubmed.ncbi.nlm.nih.gov/17253781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17253781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential localization of coatomer complex isoforms within the Golgi apparatus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Moelleken J, Malsam J, Betts MJ, Movafeghi A, Reckmann I, Meissner I, Hellwig A, Russell RB, Sollner T, Brugger B, Wieland FT", "reference": { "type": "PubMed", "id": "17360540", "url": "https://pubmed.ncbi.nlm.nih.gov/17360540" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "O55029-1", "protein_name": "Coatomer subunit beta'", "gene_name": "Copb2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4AEF8-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "Copg1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A8I6GES6-1", "protein_name": "Coatomer subunit zeta", "gene_name": "Copz1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O35142-1", "protein_name": "Coatomer subunit beta'", "gene_name": "Copb2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "D4ABY2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "Copg2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JHH9-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "Copz2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QZE5-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "Copg1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P61924-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "Copz1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QXK3-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "Copg2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17360540", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 162 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rab1b interacts with GBF1 and modulates both ARF1 dynamics and COPI association.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Monetta P, Slavin I, Romero N, Alvarez C", "reference": { "type": "PubMed", "id": "17429068", "url": "https://pubmed.ncbi.nlm.nih.gov/17429068" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17429068", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two human ARFGAPs associated with COP-I-coated vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Frigerio G, Grimsey N, Dale M, Majoul I, Duden R", "reference": { "type": "PubMed", "id": "17760859", "url": "https://pubmed.ncbi.nlm.nih.gov/17760859" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17760859", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mammalian GPI-anchored proteins require p24 proteins for their efficient transport from the ER to the plasma membrane.", "journal": "The Biochemical journal", "date": "2008", "authors": "Takida S, Maeda Y, Kinoshita T", "reference": { "type": "PubMed", "id": "17927562", "url": "https://pubmed.ncbi.nlm.nih.gov/17927562" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17927562", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dissecting the role of the ARF guanine nucleotide exchange factor GBF1 in Golgi biogenesis and protein trafficking.", "journal": "Journal of cell science", "date": "2007", "authors": "Szul T, Grabski R, Lyons S, Morohashi Y, Shestopal S, Lowe M, Sztul E", "reference": { "type": "PubMed", "id": "17956946", "url": "https://pubmed.ncbi.nlm.nih.gov/17956946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULH1-1", "protein_name": "Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1", "gene_name": "ASAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00471-1", "protein_name": "Exocyst complex component 5", "gene_name": "EXOC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KP1-1", "protein_name": "Exocyst complex component 2", "gene_name": "EXOC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13563-1", "protein_name": "Polycystin-2", "gene_name": "PKD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62491-1", "protein_name": "Ras-related protein Rab-11A", "gene_name": "RAB11A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IV77-1", "protein_name": "Cyclic nucleotide-gated channel alpha-4", "gene_name": "CNGA4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08100-1", "protein_name": "Rhodopsin", "gene_name": "RHO", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75154-1", "protein_name": "Rab11 family-interacting protein 3", "gene_name": "RAB11FIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14028-1", "protein_name": "Cyclic nucleotide-gated channel beta-1", "gene_name": "CNGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61006-1", "protein_name": "Ras-related protein Rab-8A", "gene_name": "RAB8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96QF0-1", "protein_name": "Rab-3A-interacting protein", "gene_name": "RAB3IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16280-1", "protein_name": "Cyclic nucleotide-gated channel alpha-2", "gene_name": "CNGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYI6-1", "protein_name": "Exocyst complex component 8", "gene_name": "EXOC8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96A65-1", "protein_name": "Exocyst complex component 4", "gene_name": "EXOC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98161-1", "protein_name": "Polycystin-1", "gene_name": "PKD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60645-1", "protein_name": "Exocyst complex component 3", "gene_name": "EXOC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPT5-3", "protein_name": "Exocyst complex component 7", "gene_name": "EXOC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NV70-1", "protein_name": "Exocyst complex component 1", "gene_name": "EXOC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAG9-1", "protein_name": "Exocyst complex component 6", "gene_name": "EXOC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17956946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 172 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A conformational change in the alpha-subunit of coatomer induced by ligand binding to gamma-COP revealed by single-pair FRET.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2008", "authors": "Langer JD, Roth CM, Bethune J, Stoops EH, Brugger B, Herten DP, Wieland FT", "reference": { "type": "PubMed", "id": "18182008", "url": "https://pubmed.ncbi.nlm.nih.gov/18182008" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18182008", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Mitrovic S, Ben-Tekaya H, Koegler E, Gruenberg J, Hauri HP", "reference": { "type": "PubMed", "id": "18287528", "url": "https://pubmed.ncbi.nlm.nih.gov/18287528" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15514-1", "protein_name": "Amphiregulin", "gene_name": "AREG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49257-1", "protein_name": "Protein ERGIC-53", "gene_name": "LMAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42261-1", "protein_name": "Glutamate receptor 1", "gene_name": "GRIA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBR2-1", "protein_name": "Cathepsin Z", "gene_name": "CTSZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95406-1", "protein_name": "Protein cornichon homolog 1", "gene_name": "CNIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01135-1", "protein_name": "Protransforming growth factor alpha", "gene_name": "TGFA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53634-1", "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PI25-1", "protein_name": "Protein cornichon homolog 2", "gene_name": "CNIH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBE1-1", "protein_name": "Protein cornichon homolog 3", "gene_name": "CNIH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAT1-1", "protein_name": "Protein ERGIC-53-like", "gene_name": "LMAN1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0V9-1", "protein_name": "VIP36-like protein", "gene_name": "LMAN2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12907-1", "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI22-1", "protein_name": "Multiple coagulation factor deficiency protein 2", "gene_name": "MCFD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5JRA6-1", "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02388-1", "protein_name": "Collagen alpha-1(VII) chain", "gene_name": "COL7A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PC5-3", "protein_name": "Melanoma inhibitory activity protein 2", "gene_name": "MIA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU5-1", "protein_name": "Guanine nucleotide-exchange factor SEC12", "gene_name": "PREB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01009-1", "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 265, "end_pos": 267, "sequence_org": "KKK", "sequence_mut": "AAA", "comment": "Targeted to the Golgi.", "evidence": [ { "database": "UniProtKB", "id": "O15260", "url": "https://www.uniprot.org/uniprotkb/O15260" }, { "database": "PubMed", "id": "33186557", "url": "https://pubmed.ncbi.nlm.nih.gov/33186557" }, { "database": "PubMed", "id": "18287528", "url": "https://pubmed.ncbi.nlm.nih.gov/18287528" } ], "uniprot_canonical_ac": "O15260-1" }, { "start_pos": 265, "end_pos": 267, "sequence_org": "KKK", "sequence_mut": "SSS", "comment": "Targeted to the Golgi.", "evidence": [ { "database": "UniProtKB", "id": "O15260", "url": "https://www.uniprot.org/uniprotkb/O15260" }, { "database": "PubMed", "id": "33186557", "url": "https://pubmed.ncbi.nlm.nih.gov/33186557" }, { "database": "PubMed", "id": "18287528", "url": "https://pubmed.ncbi.nlm.nih.gov/18287528" } ], "uniprot_canonical_ac": "O15260-1" } ], "record_id": "pubmed.18287528", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 131 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of class I and II ADP-ribosylation factors (Arfs) in live cells: GDP-bound class II Arfs associate with the ER-Golgi intermediate compartment independently of GBF1.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Chun J, Shapovalova Z, Dejgaard SY, Presley JF, Melancon P", "reference": { "type": "PubMed", "id": "18524849", "url": "https://pubmed.ncbi.nlm.nih.gov/18524849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18524849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Consensus nomenclature for the human ArfGAP domain-containing proteins.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Kahn RA, Bruford E, Inoue H, Logsdon JM Jr, Nie Z, Premont RT, Randazzo PA, Satake M, Theibert AB, Zapp ML, Cassel D", "reference": { "type": "PubMed", "id": "18809720", "url": "https://pubmed.ncbi.nlm.nih.gov/18809720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18809720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "'Coatomer': a cytosolic protein complex containing subunits of non-clathrin-coated Golgi transport vesicles.", "journal": "Nature", "date": "1991", "authors": "Waters MG, Serafini T, Rothman JE", "reference": { "type": "PubMed", "id": "1898986", "url": "https://pubmed.ncbi.nlm.nih.gov/1898986" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53620-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0JN39-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1898986", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 155 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential roles of ArfGAP1, ArfGAP2, and ArfGAP3 in COPI trafficking.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Weimer C, Beck R, Eckert P, Reckmann I, Moelleken J, Brugger B, Wieland F", "reference": { "type": "PubMed", "id": "19015319", "url": "https://pubmed.ncbi.nlm.nih.gov/19015319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3MID3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "Arfgap2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62848-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "Arfgap1; Col20a1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19015319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 155 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discrete determinants in ArfGAP2/3 conferring Golgi localization and regulation by the COPI coat.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Kliouchnikov L, Bigay J, Mesmin B, Parnis A, Rawet M, Goldfeder N, Antonny B, Cassel D", "reference": { "type": "PubMed", "id": "19109418", "url": "https://pubmed.ncbi.nlm.nih.gov/19109418" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19109418", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural characterization of Tip20p and Dsl1p, subunits of the Dsl1p vesicle tethering complex.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Tripathi A, Ren Y, Jeffrey PD, Hughson FM", "reference": { "type": "PubMed", "id": "19151722", "url": "https://pubmed.ncbi.nlm.nih.gov/19151722" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19151722", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the neuroblastoma-amplified gene product as a component of the syntaxin 18 complex implicated in Golgi-to-endoplasmic reticulum retrograde transport.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Aoki T, Ichimura S, Itoh A, Kuramoto M, Shinkawa T, Isobe T, Tagaya M", "reference": { "type": "PubMed", "id": "19369418", "url": "https://pubmed.ncbi.nlm.nih.gov/19369418" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19369418", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of ARF and beta-COP to Golgi membranes: possible regulation by a trimeric G protein.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Donaldson JG, Kahn RA, Lippincott-Schwartz J, Klausner RD", "reference": { "type": "PubMed", "id": "1957170", "url": "https://pubmed.ncbi.nlm.nih.gov/1957170" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23514-1", "protein_name": "Coatomer subunit beta", "gene_name": "Copb1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1957170", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 154 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The COPI system: molecular mechanisms and function.", "journal": "FEBS letters", "date": "2009", "authors": "Beck R, Rawet M, Wieland FT, Cassel D", "reference": { "type": "PubMed", "id": "19631211", "url": "https://pubmed.ncbi.nlm.nih.gov/19631211" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19631211", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A link between ER tethering and COP-I vesicle uncoating.", "journal": "Developmental cell", "date": "2009", "authors": "Zink S, Wenzel D, Wurm CA, Schmitt HD", "reference": { "type": "PubMed", "id": "19758564", "url": "https://pubmed.ncbi.nlm.nih.gov/19758564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19758564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A structure-based mechanism for vesicle capture by the multisubunit tethering complex Dsl1.", "journal": "Cell", "date": "2009", "authors": "Ren Y, Yip CK, Tripathi A, Huie D, Jeffrey PD, Walz T, Hughson FM", "reference": { "type": "PubMed", "id": "20005805", "url": "https://pubmed.ncbi.nlm.nih.gov/20005805" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20005805", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of ER-Golgi intermediate compartment tubulation and mobility by COPI coats, motor proteins and microtubules.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Tomas M, Martinez-Alonso E, Ballesta J, Martinez-Menarguez JA", "reference": { "type": "PubMed", "id": "20136777", "url": "https://pubmed.ncbi.nlm.nih.gov/20136777" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20136777", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arf3 is activated uniquely at the trans-Golgi network by brefeldin A-inhibited guanine nucleotide exchange factors.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Manolea F, Chun J, Chen DW, Clarke I, Summerfeldt N, Dacks JB, Melancon P", "reference": { "type": "PubMed", "id": "20357002", "url": "https://pubmed.ncbi.nlm.nih.gov/20357002" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20357002", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Selective export of human GPI-anchored proteins from the endoplasmic reticulum.", "journal": "Journal of cell science", "date": "2010", "authors": "Bonnon C, Wendeler MW, Paccaud JP, Hauri HP", "reference": { "type": "PubMed", "id": "20427317", "url": "https://pubmed.ncbi.nlm.nih.gov/20427317" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15514-1", "protein_name": "Amphiregulin", "gene_name": "AREG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49257-1", "protein_name": "Protein ERGIC-53", "gene_name": "LMAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42261-1", "protein_name": "Glutamate receptor 1", "gene_name": "GRIA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBR2-1", "protein_name": "Cathepsin Z", "gene_name": "CTSZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95406-1", "protein_name": "Protein cornichon homolog 1", "gene_name": "CNIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01135-1", "protein_name": "Protransforming growth factor alpha", "gene_name": "TGFA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53634-1", "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PI25-1", "protein_name": "Protein cornichon homolog 2", "gene_name": "CNIH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBE1-1", "protein_name": "Protein cornichon homolog 3", "gene_name": "CNIH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAT1-1", "protein_name": "Protein ERGIC-53-like", "gene_name": "LMAN1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0V9-1", "protein_name": "VIP36-like protein", "gene_name": "LMAN2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12907-1", "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI22-1", "protein_name": "Multiple coagulation factor deficiency protein 2", "gene_name": "MCFD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5JRA6-1", "protein_name": "Transport and Golgi organization protein 1 homolog", "gene_name": "MIA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02388-1", "protein_name": "Collagen alpha-1(VII) chain", "gene_name": "COL7A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PC5-3", "protein_name": "Melanoma inhibitory activity protein 2", "gene_name": "MIA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU5-1", "protein_name": "Guanine nucleotide-exchange factor SEC12", "gene_name": "PREB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01009-1", "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20427317", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 179 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural analysis of the RZZ complex reveals common ancestry with multisubunit vesicle tethering machinery.", "journal": "Structure (London, England : 1993)", "date": "2010", "authors": "Civril F, Wehenkel A, Giorgi FM, Santaguida S, Di Fonzo A, Grigorean G, Ciccarelli FD, Musacchio A", "reference": { "type": "PubMed", "id": "20462495", "url": "https://pubmed.ncbi.nlm.nih.gov/20462495" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50748-1", "protein_name": "Kinetochore-associated protein 1", "gene_name": "KNTC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H900-1", "protein_name": "Protein zwilch homolog", "gene_name": "ZWILCH", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20462495", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 103 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of alpha-COP in complex with epsilon-COP provides insight into the architecture of the COPI vesicular coat.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Hsia KC, Hoelz A", "reference": { "type": "PubMed", "id": "20534429", "url": "https://pubmed.ncbi.nlm.nih.gov/20534429" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20534429", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Models for the functions of Arf GAPs.", "journal": "Seminars in cell & developmental biology", "date": "2011", "authors": "East MP, Kahn RA", "reference": { "type": "PubMed", "id": "20637885", "url": "https://pubmed.ncbi.nlm.nih.gov/20637885" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20637885", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteinase-activated receptors, nucleotide P2Y receptors, and mu-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking.", "journal": "Journal of neurochemistry", "date": "2011", "authors": "Luo W, Wang Y, Reiser G", "reference": { "type": "PubMed", "id": "21219331", "url": "https://pubmed.ncbi.nlm.nih.gov/21219331" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q63524-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "Tmed2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51582-1", "protein_name": "P2Y purinoceptor 4", "gene_name": "P2RY4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21219331", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 155 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Dsl1 protein tethering complex is a resident endoplasmic reticulum complex, which interacts with five soluble NSF (N-ethylmaleimide-sensitive factor) attachment protein receptors (SNAREs): implications for fusion and fusion regulation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Meiringer CT, Rethmeier R, Auffarth K, Wilson J, Perz A, Barlowe C, Schmitt HD, Ungermann C", "reference": { "type": "PubMed", "id": "21550981", "url": "https://pubmed.ncbi.nlm.nih.gov/21550981" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21550981", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "COPI budding within the Golgi stack.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Popoff V, Adolf F, Brugger B, Wieland F", "reference": { "type": "PubMed", "id": "21844168", "url": "https://pubmed.ncbi.nlm.nih.gov/21844168" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21844168", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNF185, a novel mitochondrial ubiquitin E3 ligase, regulates autophagy through interaction with BNIP1.", "journal": "PloS one", "date": "2011", "authors": "Tang F, Wang B, Li N, Wu Y, Jia J, Suo T, Chen Q, Liu YJ, Tang J", "reference": { "type": "PubMed", "id": "21931693", "url": "https://pubmed.ncbi.nlm.nih.gov/21931693" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GF1-1", "protein_name": "E3 ubiquitin-protein ligase RNF185", "gene_name": "RNF185", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21931693", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "p24 proteins are required for secretion of Wnt ligands.", "journal": "EMBO reports", "date": "2011", "authors": "Buechling T, Chaudhary V, Spirohn K, Weiss M, Boutros M", "reference": { "type": "PubMed", "id": "22094269", "url": "https://pubmed.ncbi.nlm.nih.gov/22094269" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1J5-1", "protein_name": "Protein Wnt-8a", "gene_name": "WNT8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93098-1", "protein_name": "Protein Wnt-8b", "gene_name": "WNT8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60493-1", "protein_name": "Sorting nexin-3", "gene_name": "SNX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3A6-1", "protein_name": "Transmembrane emp24 domain-containing protein 5", "gene_name": "TMED5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T9L3-1", "protein_name": "Protein wntless homolog", "gene_name": "WLS", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96014-1", "protein_name": "Protein Wnt-11", "gene_name": "WNT11", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96QK1-1", "protein_name": "Vacuolar protein sorting-associated protein 35", "gene_name": "VPS35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H237-1", "protein_name": "Protein-serine O-palmitoleoyltransferase porcupine", "gene_name": "PORCN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14905-1", "protein_name": "Protein Wnt-9b", "gene_name": "WNT9B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93097-1", "protein_name": "Protein Wnt-2b", "gene_name": "WNT2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09544-1", "protein_name": "Protein Wnt-2", "gene_name": "WNT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9GZT5-1", "protein_name": "Protein Wnt-10a", "gene_name": "WNT10A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56706-1", "protein_name": "Protein Wnt-7b", "gene_name": "WNT7B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56703-1", "protein_name": "Proto-oncogene Wnt-3", "gene_name": "WNT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56705-1", "protein_name": "Protein Wnt-4", "gene_name": "WNT4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P41221-1", "protein_name": "Protein Wnt-5a", "gene_name": "WNT5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00755-1", "protein_name": "Protein Wnt-7a", "gene_name": "WNT7A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14904-1", "protein_name": "Protein Wnt-9a", "gene_name": "WNT9A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00744-1", "protein_name": "Protein Wnt-10b", "gene_name": "WNT10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBV4-1", "protein_name": "Protein Wnt-16", "gene_name": "WNT16", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04628-1", "protein_name": "Proto-oncogene Wnt-1", "gene_name": "WNT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBQ0-1", "protein_name": "Vacuolar protein sorting-associated protein 29", "gene_name": "VPS29", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75436-1", "protein_name": "Vacuolar protein sorting-associated protein 26A", "gene_name": "VPS26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6F9-1", "protein_name": "Protein Wnt-6", "gene_name": "WNT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1J7-1", "protein_name": "Protein Wnt-5b", "gene_name": "WNT5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22094269", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 179 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A structure-based mechanism for Arf1-dependent recruitment of coatomer to membranes.", "journal": "Cell", "date": "2012", "authors": "Yu X, Breitman M, Goldberg J", "reference": { "type": "PubMed", "id": "22304919", "url": "https://pubmed.ncbi.nlm.nih.gov/22304919" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11076-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22304919", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 154 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential expression of BNIP family members of BH3-only proteins during the development and after axotomy in the rat.", "journal": "Molecules and cells", "date": "2012", "authors": "Cho B, Choi SY, Park OH, Sun W, Geum D", "reference": { "type": "PubMed", "id": "22639046", "url": "https://pubmed.ncbi.nlm.nih.gov/22639046" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22639046", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Secretory protein biogenesis and traffic in the early secretory pathway.", "journal": "Genetics", "date": "2013", "authors": "Barlowe CK, Miller EA", "reference": { "type": "PubMed", "id": "23396477", "url": "https://pubmed.ncbi.nlm.nih.gov/23396477" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23396477", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel RING finger E3 ligase RNF186 regulate ER stress-mediated apoptosis through interaction with BNip1.", "journal": "Cellular signalling", "date": "2013", "authors": "Wang P, Wu Y, Li Y, Zheng J, Tang J", "reference": { "type": "PubMed", "id": "23896122", "url": "https://pubmed.ncbi.nlm.nih.gov/23896122" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXI6-1", "protein_name": "E3 ubiquitin-protein ligase RNF186", "gene_name": "RNF186", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 58, "end_pos": 66, "sequence_org": "CQHAFCAIC", "sequence_mut": "AQWAFAAIA", "comment": "Loss of autoubiquitination; loss of BNIP1 polyubiquitination; no effect on interaction with BNIP1; decreased effect on calcium release from the endoplasmic reticulum.", "evidence": [ { "database": "UniProtKB", "id": "Q9NXI6", "url": "https://www.uniprot.org/uniprotkb/Q9NXI6" }, { "database": "PubMed", "id": "23896122", "url": "https://pubmed.ncbi.nlm.nih.gov/23896122" } ], "uniprot_canonical_ac": "Q9NXI6-1" } ], "record_id": "pubmed.23896122", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Moonlighting functions of the NRZ (mammalian Dsl1) complex.", "journal": "Frontiers in cell and developmental biology", "date": "2014", "authors": "Tagaya M, Arasaki K, Inoue H, Kimura H", "reference": { "type": "PubMed", "id": "25364732", "url": "https://pubmed.ncbi.nlm.nih.gov/25364732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25364732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Diverse roles for the p24 family of proteins in eukaryotic cells.", "journal": "Biomolecular concepts", "date": "2012", "authors": "Schuiki I, Volchuk A", "reference": { "type": "PubMed", "id": "25436559", "url": "https://pubmed.ncbi.nlm.nih.gov/25436559" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25436559", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Three alphaSNAP and 10 ATP molecules are used in SNARE complex disassembly by N-ethylmaleimide-sensitive factor (NSF).", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Shah N, Colbert KN, Enos MD, Herschlag D, Weis WI", "reference": { "type": "PubMed", "id": "25492864", "url": "https://pubmed.ncbi.nlm.nih.gov/25492864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q05-1", "protein_name": "Trafficking protein particle complex subunit 9", "gene_name": "TRAPPC9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5R8-1", "protein_name": "Trafficking protein particle complex subunit 1", "gene_name": "TRAPPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y296-1", "protein_name": "Trafficking protein particle complex subunit 4", "gene_name": "TRAPPC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQW1-1", "protein_name": "Protein transport protein Sec31B", "gene_name": "SEC31B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00743-1", "protein_name": "Serine/threonine-protein phosphatase 6 catalytic subunit", "gene_name": "PPP6C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5H9R7-1", "protein_name": "Serine/threonine-protein phosphatase 6 regulatory subunit 3", "gene_name": "PPP6R3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15514-1", "protein_name": "Amphiregulin", "gene_name": "AREG", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49257-1", "protein_name": "Protein ERGIC-53", "gene_name": "LMAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42261-1", "protein_name": "Glutamate receptor 1", "gene_name": "GRIA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBR2-1", "protein_name": "Cathepsin Z", "gene_name": "CTSZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95406-1", "protein_name": "Protein cornichon homolog 1", "gene_name": "CNIH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94979-1", "protein_name": "Protein transport protein Sec31A", "gene_name": "SEC31A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48553-1", "protein_name": "Trafficking protein particle complex subunit 10", "gene_name": "TRAPPC10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JE7-1", "protein_name": "Protein transport protein Sec16B", "gene_name": "SEC16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95487-1", "protein_name": "Protein transport protein Sec24B", "gene_name": "SEC24B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56962-1", "protein_name": "Syntaxin-17", "gene_name": "STX17", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6B6-1", "protein_name": "Small COPII coat GTPase SAR1B", "gene_name": "SAR1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01135-1", "protein_name": "Protransforming growth factor alpha", "gene_name": "TGFA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53634-1", "protein_name": "Dipeptidyl peptidase 1", "gene_name": "CTSC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96IW7-1", "protein_name": "Vesicle-trafficking protein SEC22a", "gene_name": "SEC22A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUR0-1", "protein_name": "Trafficking protein particle complex subunit 5", "gene_name": "TRAPPC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PI25-1", "protein_name": "Protein cornichon homolog 2", "gene_name": "CNIH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBE1-1", "protein_name": "Protein cornichon homolog 3", "gene_name": "CNIH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAT1-1", "protein_name": "Protein ERGIC-53-like", "gene_name": "LMAN1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0V9-1", "protein_name": "VIP36-like protein", "gene_name": "LMAN2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12907-1", "protein_name": "Vesicular integral-membrane protein VIP36", "gene_name": "LMAN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI22-1", "protein_name": "Multiple coagulation factor deficiency protein 2", "gene_name": "MCFD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15027-1", "protein_name": "Protein transport protein Sec16A", "gene_name": "SEC16A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00451-1", "protein_name": "Coagulation factor VIII", "gene_name": "F8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92734-1", "protein_name": "Protein TFG", "gene_name": "TFG", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UPN7-1", "protein_name": "Serine/threonine-protein phosphatase 6 regulatory subunit 1", "gene_name": "PPP6R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15084-3", "protein_name": "Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A", "gene_name": "ANKRD28", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVM8-1", "protein_name": "Sec1 family domain-containing protein 1", "gene_name": "SCFD1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02388-1", "protein_name": "Collagen alpha-1(VII) chain", "gene_name": "COL7A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12259-1", "protein_name": "Coagulation factor V", "gene_name": "F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53992-1", "protein_name": "Protein transport protein Sec24C", "gene_name": "SEC24C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43617-1", "protein_name": "Trafficking protein particle complex subunit 3", "gene_name": "TRAPPC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCU5-1", "protein_name": "Guanine nucleotide-exchange factor SEC12", "gene_name": "PREB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75865-1", "protein_name": "Trafficking protein particle complex subunit 6A", "gene_name": "TRAPPC6A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6Y8-1", "protein_name": "SEC23-interacting protein", "gene_name": "SEC23IP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BZ9-1", "protein_name": "TBC1 domain family member 20", "gene_name": "TBC1D20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15436-1", "protein_name": "Protein transport protein Sec23A", "gene_name": "SEC23A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UL33-1", "protein_name": "Trafficking protein particle complex subunit 2-like protein", "gene_name": "TRAPPC2L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48730-1", "protein_name": "Casein kinase I isoform delta", "gene_name": "CSNK1D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94855-1", "protein_name": "Protein transport protein Sec24D", "gene_name": "SEC24D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DI81-1", "protein_name": "Trafficking protein particle complex subunit 2", "gene_name": "TRAPPC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRL7-1", "protein_name": "Vesicle-trafficking protein SEC22c", "gene_name": "SEC22C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95486-1", "protein_name": "Protein transport protein Sec24A", "gene_name": "SEC24A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86SZ2-1", "protein_name": "Trafficking protein particle complex subunit 6B", "gene_name": "TRAPPC6B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01009-1", "protein_name": "Alpha-1-antitrypsin", "gene_name": "SERPINA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25492864", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 204 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MTD-like motif of a BH3-only protein, BNIP1, induces necrosis accompanied by an intracellular calcium spike.", "journal": "Biochemical and biophysical research communications", "date": "2018", "authors": "Park J, Han JH, Myung SH, Seo YW, Kim TH", "reference": { "type": "PubMed", "id": "29222049", "url": "https://pubmed.ncbi.nlm.nih.gov/29222049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29222049", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A homozygous hypomorphic BNIP1 variant causes an increase in autophagosomes and reduced autophagic flux and results in a spondylo-epiphyseal dysplasia.", "journal": "Hum. Mutat.", "date": "2022", "authors": "Holling T, Bhavani GS, von Elsner L, Shah H, Kausthubham N, Bhattacharyya SS, Shukla A, Mortier GR, Schinke T, Danyukova T, Pohl S, Kutsche K, Girisha KM", "reference": { "type": "PubMed", "id": "35266227", "url": "https://pubmed.ncbi.nlm.nih.gov/35266227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35266227", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Kinesin is the motor for microtubule-mediated Golgi-to-ER membrane traffic.", "journal": "The Journal of cell biology", "date": "1995", "authors": "Lippincott-Schwartz J, Cole NB, Marotta A, Conrad PA, Bloom GS", "reference": { "type": "PubMed", "id": "7844144", "url": "https://pubmed.ncbi.nlm.nih.gov/7844144" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7844144", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 101 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenovirus E1B 19 kDa and Bcl-2 proteins interact with a common set of cellular proteins.", "journal": "Cell", "date": "1994-10-21", "authors": "Boyd J M, Malstrom S, Subramanian T, Venkatesh L K, Schaeper U, Elangovan B, D'Sa-Eipper C, Chinnadurai G", "reference": { "type": "PubMed", "id": "7954800", "url": "https://pubmed.ncbi.nlm.nih.gov/7954800" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12983-1", "protein_name": "BCL2/adenovirus E1B 19 kDa protein-interacting protein 3", "gene_name": "BNIP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12982-1", "protein_name": "BCL2/adenovirus E1B 19 kDa protein-interacting protein 2", "gene_name": "BNIP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7954800", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coatomer is essential for retrieval of dilysine-tagged proteins to the endoplasmic reticulum.", "journal": "Cell", "date": "1994", "authors": "Letourneur F, Gaynor EC, Hennecke S, Demolliere C, Duden R, Emr SD, Riezman H, Cosson P", "reference": { "type": "PubMed", "id": "8001155", "url": "https://pubmed.ncbi.nlm.nih.gov/8001155" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P32074-1", "protein_name": "Coatomer subunit gamma", "gene_name": "SEC21", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P53622-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COP1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8001155", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 155 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coatomer interaction with di-lysine endoplasmic reticulum retention motifs.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Cosson P, Letourneur F", "reference": { "type": "PubMed", "id": "8128252", "url": "https://pubmed.ncbi.nlm.nih.gov/8128252" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8128252", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "En bloc incorporation of coatomer subunits during the assembly of COP-coated vesicles.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Hara-Kuge S, Kuge O, Orci L, Amherdt M, Ravazzola M, Wieland FT, Rothman JE", "reference": { "type": "PubMed", "id": "8132710", "url": "https://pubmed.ncbi.nlm.nih.gov/8132710" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q28104-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8132710", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 154 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hydrolysis of bound GTP by ARF protein triggers uncoating of Golgi-derived COP-coated vesicles.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Tanigawa G, Orci L, Amherdt M, Ravazzola M, Helms JB, Rothman JE", "reference": { "type": "PubMed", "id": "8253837", "url": "https://pubmed.ncbi.nlm.nih.gov/8253837" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 71, "end_pos": 71, "sequence_org": "Q", "sequence_mut": "L", "comment": "Inhibits GTP hydrolysis. Coatomer proteins recruitment to the Golgi membrane and formation of coated vesicles are normal. However, Golgi transport is severely reduced due to impaired vesicle uncoating.", "evidence": [ { "database": "UniProtKB", "id": "P84077", "url": "https://www.uniprot.org/uniprotkb/P84077" }, { "database": "PubMed", "id": "8253837", "url": "https://pubmed.ncbi.nlm.nih.gov/8253837" } ], "uniprot_canonical_ac": "P84077-1" } ], "record_id": "pubmed.8253837", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Binding of coatomer to Golgi membranes requires ADP-ribosylation factor.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Palmer DJ, Helms JB, Beckers CJ, Orci L, Rothman JE", "reference": { "type": "PubMed", "id": "8505331", "url": "https://pubmed.ncbi.nlm.nih.gov/8505331" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84080-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0JN39-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Bovine" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8505331", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 155 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct and GTP-dependent interaction of ADP ribosylation factor 1 with coatomer subunit beta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhao L, Helms JB, Brugger B, Harter C, Martoglio B, Graf R, Brunner J, Wieland FT", "reference": { "type": "PubMed", "id": "9114004", "url": "https://pubmed.ncbi.nlm.nih.gov/9114004" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9114004", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ER-to-Golgi transport visualized in living cells.", "journal": "Nature", "date": "1997", "authors": "Presley JF, Cole NB, Schroer TA, Hirschberg K, Zaal KJ, Lippincott-Schwartz J", "reference": { "type": "PubMed", "id": "9288971", "url": "https://pubmed.ncbi.nlm.nih.gov/9288971" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9288971", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The KDEL receptor, ERD2, regulates intracellular traffic by recruiting a GTPase-activating protein for ARF1.", "journal": "The EMBO journal", "date": "1997", "authors": "Aoe T, Cukierman E, Lee A, Cassel D, Peters PJ, Hsu VW", "reference": { "type": "PubMed", "id": "9405360", "url": "https://pubmed.ncbi.nlm.nih.gov/9405360" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62848-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "Arfgap1; Col20a1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9405360", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 154 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A single binding site for dilysine retrieval motifs and p23 within the gamma subunit of coatomer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Harter C, Wieland FT", "reference": { "type": "PubMed", "id": "9751720", "url": "https://pubmed.ncbi.nlm.nih.gov/9751720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9751720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Receptor-induced polymerization of coatomer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Reinhard C, Harter C, Bremser M, Brugger B, Sohn K, Helms JB, Wieland F", "reference": { "type": "PubMed", "id": "9990005", "url": "https://pubmed.ncbi.nlm.nih.gov/9990005" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q12981-4", "protein_name": "Vesicle transport protein SEC20", "gene_name": "BNIP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15498-1", "protein_name": "Synaptobrevin homolog YKT6", "gene_name": "YKT6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12893-1", "protein_name": "Transmembrane protein 115", "gene_name": "TMEM115", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZMV9-1", "protein_name": "Kinesin-like protein KIF6", "gene_name": "KIF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NI77-1", "protein_name": "Kinesin-like protein KIF18A", "gene_name": "KIF18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H115-1", "protein_name": "Beta-soluble NSF attachment protein", "gene_name": "NAPB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14203-1", "protein_name": "Dynactin subunit 1", "gene_name": "DCTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16157-1", "protein_name": "Ankyrin-1", "gene_name": "ANK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAQ2-1", "protein_name": "Kinesin-like protein KIF9", "gene_name": "KIF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01484-4", "protein_name": "Ankyrin-2", "gene_name": "ANK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12955-3", "protein_name": "Ankyrin-3", "gene_name": "ANK3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6H7-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 2", "gene_name": "ARFGAP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y496-1", "protein_name": "Kinesin-like protein KIF3A", "gene_name": "KIF3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15066-1", "protein_name": "Kinesin-like protein KIF3B", "gene_name": "KIF3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84085-1", "protein_name": "ADP-ribosylation factor 5", "gene_name": "ARF5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P84077-1", "protein_name": "ADP-ribosylation factor 1", "gene_name": "ARF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N6T3-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 1", "gene_name": "ARFGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ32-1", "protein_name": "Actin-related protein 10", "gene_name": "ACTR10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68363-1", "protein_name": "Tubulin alpha-1B chain", "gene_name": "TUBA1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PEY2-1", "protein_name": "Tubulin alpha-3E chain", "gene_name": "TUBA3E", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53621-1", "protein_name": "Coatomer subunit alpha", "gene_name": "COPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68366-1", "protein_name": "Tubulin alpha-4A chain", "gene_name": "TUBA4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35606-1", "protein_name": "Coatomer subunit beta'", "gene_name": "COPB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q71U36-1", "protein_name": "Tubulin alpha-1A chain", "gene_name": "TUBA1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61923-1", "protein_name": "Coatomer subunit zeta-1", "gene_name": "COPZ1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P48444-1", "protein_name": "Coatomer subunit delta", "gene_name": "ARCN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95235-1", "protein_name": "Kinesin-like protein KIF20A", "gene_name": "KIF20A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33947-1", "protein_name": "ER lumen protein-retaining receptor 2", "gene_name": "KDELR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00399-1", "protein_name": "Dynactin subunit 6", "gene_name": "DCTN6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14789-1", "protein_name": "Golgin subfamily B member 1", "gene_name": "GOLGB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2RRP1-1", "protein_name": "NBAS subunit of NRZ tethering complex", "gene_name": "NBAS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVA1-1", "protein_name": "Tubulin beta-2B chain", "gene_name": "TUBB2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MW5-1", "protein_name": "Conserved oligomeric Golgi complex subunit 8", "gene_name": "COG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P54920-1", "protein_name": "Alpha-soluble NSF attachment protein", "gene_name": "NAPA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P2W9-1", "protein_name": "Syntaxin-18", "gene_name": "STX18", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75396-1", "protein_name": "Vesicle-trafficking protein SEC22b", "gene_name": "SEC22B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43264-1", "protein_name": "Centromere/kinetochore protein zw10 homolog", "gene_name": "ZW10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P53618-1", "protein_name": "Coatomer subunit beta", "gene_name": "COPB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H254-1", "protein_name": "Spectrin beta chain, non-erythrocytic 4", "gene_name": "SPTBN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y2V7-1", "protein_name": "Conserved oligomeric Golgi complex subunit 6", "gene_name": "COG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NUQ1-1", "protein_name": "RAD50-interacting protein 1", "gene_name": "RINT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47756-2", "protein_name": "F-actin-capping protein subunit beta", "gene_name": "CAPZB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NYM9-1", "protein_name": "BET1-like protein", "gene_name": "BET1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P47755-1", "protein_name": "F-actin-capping protein subunit alpha-2", "gene_name": "CAPZA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52907-1", "protein_name": "F-actin-capping protein subunit alpha-1", "gene_name": "CAPZA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13409-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 2", "gene_name": "DYNC1I2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14576-1", "protein_name": "Cytoplasmic dynein 1 intermediate chain 1", "gene_name": "DYNC1I1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08174-1", "protein_name": "Complement decay-accelerating factor", "gene_name": "CD55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6G9-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 1", "gene_name": "DYNC1LI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15260-1", "protein_name": "Surfeit locus protein 4", "gene_name": "SURF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75037-1", "protein_name": "Kinesin-like protein KIF21B", "gene_name": "KIF21B", "tax_name": "Human" }, { "uniprot_canonical_ac": "B7ZC32-1", "protein_name": "Kinesin-like protein KIF28P", "gene_name": "KIF28P", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14782-1", "protein_name": "Kinesin-like protein KIF3C", "gene_name": "KIF3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95239-1", "protein_name": "Chromosome-associated kinesin KIF4A", "gene_name": "KIF4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12756-1", "protein_name": "Kinesin-like protein KIF1A", "gene_name": "KIF1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FN5-1", "protein_name": "Kinesin-like protein KIF12", "gene_name": "KIF12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAC6-1", "protein_name": "Kinesin-like protein KIF19", "gene_name": "KIF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2VIQ3-1", "protein_name": "Chromosome-associated kinesin KIF4B", "gene_name": "KIF4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86VH2-1", "protein_name": "Kinesin-like protein KIF27", "gene_name": "KIF27", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N4N8-1", "protein_name": "Kinesin-like protein KIF2B", "gene_name": "KIF2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92845-1", "protein_name": "Kinesin-associated protein 3", "gene_name": "KIFAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L93-1", "protein_name": "Kinesin-like protein KIF16B", "gene_name": "KIF16B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96Q89-1", "protein_name": "Kinesin-like protein KIF20B", "gene_name": "KIF20B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BW19-1", "protein_name": "Kinesin-like protein KIFC1", "gene_name": "KIFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULI4-1", "protein_name": "Kinesin-like protein KIF26A", "gene_name": "KIF26A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49755-1", "protein_name": "Transmembrane emp24 domain-containing protein 10", "gene_name": "TMED10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86Y91-5", "protein_name": "Kinesin-like protein KIF18B", "gene_name": "KIF18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11277-1", "protein_name": "Spectrin beta chain, erythrocytic", "gene_name": "SPTB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NRC6-1", "protein_name": "Spectrin beta chain, non-erythrocytic 5", "gene_name": "SPTBN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BUF5-1", "protein_name": "Tubulin beta-6 chain", "gene_name": "TUBB6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99747-1", "protein_name": "Gamma-soluble NSF attachment protein", "gene_name": "NAPG", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NNZ2-1", "protein_name": "Tubulin beta 8B", "gene_name": "TUBB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3ZCM7-1", "protein_name": "Tubulin beta-8 chain", "gene_name": "TUBB8", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14653-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "GOSR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46459-1", "protein_name": "Vesicle-fusing ATPase", "gene_name": "NSF", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04350-1", "protein_name": "Tubulin beta-4A chain", "gene_name": "TUBB4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0U4-1", "protein_name": "Ras-related protein Rab-1B", "gene_name": "RAB1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13885-1", "protein_name": "Tubulin beta-2A chain", "gene_name": "TUBB2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0H5-1", "protein_name": "Rac GTPase-activating protein 1", "gene_name": "RACGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P02549-1", "protein_name": "Spectrin alpha chain, erythrocytic 1", "gene_name": "SPTA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02241-1", "protein_name": "Kinesin-like protein KIF23", "gene_name": "KIF23", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NSK0-1", "protein_name": "Kinesin light chain 4", "gene_name": "KLC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P597-1", "protein_name": "Kinesin light chain 3", "gene_name": "KLC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61163-1", "protein_name": "Alpha-centractin", "gene_name": "ACTR1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63167-1", "protein_name": "Dynein light chain 1, cytoplasmic", "gene_name": "DYNLL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60763-1", "protein_name": "General vesicular transport factor p115", "gene_name": "USO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18085-1", "protein_name": "ADP-ribosylation factor 4", "gene_name": "ARF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61204-1", "protein_name": "ADP-ribosylation factor 3", "gene_name": "ARF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP61-1", "protein_name": "ADP-ribosylation factor GTPase-activating protein 3", "gene_name": "ARFGAP3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12840-1", "protein_name": "Kinesin heavy chain isoform 5A", "gene_name": "KIF5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14579-1", "protein_name": "Coatomer subunit epsilon", "gene_name": "COPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 1", "gene_name": "COG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13190-1", "protein_name": "Syntaxin-5", "gene_name": "STX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92538-4", "protein_name": "Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1", "gene_name": "GBF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96JB2-1", "protein_name": "Conserved oligomeric Golgi complex subunit 3", "gene_name": "COG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9E3-1", "protein_name": "Conserved oligomeric Golgi complex subunit 4", "gene_name": "COG4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P83436-1", "protein_name": "Conserved oligomeric Golgi complex subunit 7", "gene_name": "COG7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14746-1", "protein_name": "Conserved oligomeric Golgi complex subunit 2", "gene_name": "COG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBF2-1", "protein_name": "Coatomer subunit gamma-2", "gene_name": "COPG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UP83-2", "protein_name": "Conserved oligomeric Golgi complex subunit 5", "gene_name": "COG5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y678-1", "protein_name": "Coatomer subunit gamma-1", "gene_name": "COPG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P299-1", "protein_name": "Coatomer subunit zeta-2", "gene_name": "COPZ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43731-1", "protein_name": "ER lumen protein-retaining receptor 3", "gene_name": "KDELR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24390-1", "protein_name": "ER lumen protein-retaining receptor 1", "gene_name": "KDELR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0B6-1", "protein_name": "Kinesin light chain 2", "gene_name": "KLC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33176-1", "protein_name": "Kinesin-1 heavy chain", "gene_name": "KIF5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15328-1", "protein_name": "Folate receptor alpha", "gene_name": "FOLR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62820-1", "protein_name": "Ras-related protein Rab-1A", "gene_name": "RAB1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95249-1", "protein_name": "Golgi SNAP receptor complex member 1", "gene_name": "GOSR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH8-1", "protein_name": "Tubulin alpha-3D chain", "gene_name": "TUBA3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z4S6-1", "protein_name": "Kinesin-like protein KIF21A", "gene_name": "KIF21A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q07866-1", "protein_name": "Kinesin light chain 1", "gene_name": "KLC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13561-1", "protein_name": "Dynactin subunit 2", "gene_name": "DCTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UJW0-1", "protein_name": "Dynactin subunit 4", "gene_name": "DCTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ2-1", "protein_name": "Dynein light chain 2, cytoplasmic", "gene_name": "DYNLL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BTE1-1", "protein_name": "Dynactin subunit 5", "gene_name": "DCTN5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NS87-1", "protein_name": "Kinesin-like protein KIF15", "gene_name": "KIF15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2KJY2-1", "protein_name": "Kinesin-like protein KIF26B", "gene_name": "KIF26B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P52732-1", "protein_name": "Kinesin-like protein KIF11", "gene_name": "KIF11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AC6-1", "protein_name": "Kinesin-like protein KIFC2", "gene_name": "KIFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIL4-1", "protein_name": "Kinesin-like protein KIF25", "gene_name": "KIF25", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BVK6-1", "protein_name": "Transmembrane emp24 domain-containing protein 9", "gene_name": "TMED9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13509-1", "protein_name": "Tubulin beta-3 chain", "gene_name": "TUBB3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQE3-1", "protein_name": "Tubulin alpha-1C chain", "gene_name": "TUBA1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15020-1", "protein_name": "Spectrin beta chain, non-erythrocytic 2", "gene_name": "SPTBN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68371-1", "protein_name": "Tubulin beta-4B chain", "gene_name": "TUBB4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4B7-1", "protein_name": "Tubulin beta-1 chain", "gene_name": "TUBB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H853-1", "protein_name": "Tubulin-like protein alpha-4B", "gene_name": "TUBA4B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Q3-1", "protein_name": "Transmembrane emp24 domain-containing protein 3", "gene_name": "TMED3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3B3-1", "protein_name": "Transmembrane emp24 domain-containing protein 7", "gene_name": "TMED7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02224-1", "protein_name": "Centromere-associated protein E", "gene_name": "CENPE", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15155-1", "protein_name": "BET1 homolog", "gene_name": "BET1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13987-1", "protein_name": "CD59 glycoprotein", "gene_name": "CD59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15363-1", "protein_name": "Transmembrane emp24 domain-containing protein 2", "gene_name": "TMED2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KX2-1", "protein_name": "F-actin-capping protein subunit alpha-3", "gene_name": "CAPZA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60333-1", "protein_name": "Kinesin-like protein KIF1B", "gene_name": "KIF1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75935-1", "protein_name": "Dynactin subunit 3", "gene_name": "DCTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43237-1", "protein_name": "Cytoplasmic dynein 1 light intermediate chain 2", "gene_name": "DYNC1LI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14204-1", "protein_name": "Cytoplasmic dynein 1 heavy chain 1", "gene_name": "DYNC1H1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00139-3", "protein_name": "Kinesin-like protein KIF2A", "gene_name": "KIF2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01308-1", "protein_name": "Insulin", "gene_name": "INS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43896-1", "protein_name": "Kinesin-like protein KIF1C", "gene_name": "KIF1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14807-1", "protein_name": "Kinesin-like protein KIF22", "gene_name": "KIF22", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99661-1", "protein_name": "Kinesin-like protein KIF2C", "gene_name": "KIF2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NZ43-1", "protein_name": "Vesicle transport protein USE1", "gene_name": "USE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A6NHL2-1", "protein_name": "Tubulin alpha chain-like 3", "gene_name": "TUBAL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NY65-1", "protein_name": "Tubulin alpha-8 chain", "gene_name": "TUBA8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPH7-1", "protein_name": "Tubulin alpha-3C chain", "gene_name": "TUBA3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08379-1", "protein_name": "Golgin subfamily A member 2", "gene_name": "GOLGA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQQ3-1", "protein_name": "Golgi reassembly-stacking protein 1", "gene_name": "GORASP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQT8-1", "protein_name": "Kinesin-like protein KIF13B", "gene_name": "KIF13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q12981", "url": "https://www.uniprot.org/uniprotkb/Q12981" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9990005", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 153 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mitogenic influence of human R-spondin1 on the intestinal epithelium.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Kim KA, Kakitani M, Zhao J, Oshima T, Tang T, Binnerts M, Liu Y, Boyle B, Park E, Emtage P, Funk WD, Tomizuka K", "reference": { "type": "PubMed", "id": "16109882", "url": "https://pubmed.ncbi.nlm.nih.gov/16109882" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16109882", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "R-spondin proteins: a novel link to beta-catenin activation.", "journal": "Cell Cycle", "date": "2006", "authors": "Kim KA, Zhao J, Andarmani S, Kakitani M, Oshima T, Binnerts ME, Abo A, Tomizuka K, Funk WD", "reference": { "type": "PubMed", "id": "16357527", "url": "https://pubmed.ncbi.nlm.nih.gov/16357527" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16357527", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The gene encoding R-spondin 4 (RSPO4), a secreted protein implicated in Wnt signaling, is mutated in inherited anonychia.", "journal": "Nature genetics", "date": "2006", "authors": "Blaydon DC, Ishii Y, O'Toole EA, Unsworth HC, Teh MT, Ruschendorf F, Sinclair C, Hopsu-Havu VK, Tidman N, Moss C, Watson R, de Berker D, Wajid M, Christiano AM, Kelsell DP", "reference": { "type": "PubMed", "id": "17041604", "url": "https://pubmed.ncbi.nlm.nih.gov/17041604" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17041604", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the gene encoding the Wnt-signaling component R-spondin 4 (RSPO4) cause autosomal recessive anonychia.", "journal": "American journal of human genetics", "date": "2006", "authors": "Bergmann C, Senderek J, Anhuf D, Thiel CT, Ekici AB, Poblete-Gutierrez P, van Steensel M, Seelow D, Nurnberg G, Schild HH, Nurnberg P, Reis A, Frank J, Zerres K", "reference": { "type": "PubMed", "id": "17186469", "url": "https://pubmed.ncbi.nlm.nih.gov/17186469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs768138495", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768138495" }, { "id": "17186469", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17186469" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 34, "end_pos": 34, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 filters: n-glyco-sequon-loss (NCT->XCT).", "chr_id": "20", "chr_pos": "968125", "ref_nt": "p", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N34", "disease": [ { "disease_id": "DOID:0080082", "recommended_name": { "id": "DOID:0080082", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080082", "name": "nonsyndromic congenital nail disorder 4", "description": "A nonsyndromic congenital nail disorder that is characterized by complete absence or severe hypoplasia of all fingernails and toenails without significant bone anomalies, and that has_material_basis_in homozygous or compound heterozygous mutation in the R-spondin-4 gene on chromosome 20p13." }, "synonyms": [ { "id": "DOID:0080082", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080082", "name": "HYPONYCHIA CONGENITA", "description": "" }, { "id": "DOID:0080082", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080082", "name": "anonychia congenita", "description": "" }, { "id": "MONDO:0008798", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008798", "name": "nonsyndromic congenital nail disorder 4", "description": "Any isolated congenital anonychia in which the cause of the disease is a mutation in the RSPO4 gene." }, { "id": "MONDO:0008798", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008798", "name": "RSPO4 isolated congenital anonychia", "description": "" }, { "id": "MONDO:0008798", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008798", "name": "isolated congenital anonychia caused by mutation in RSPO4", "description": "" }, { "id": "MONDO:0008798", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008798", "name": "nail disorder, nonsyndromic congenital, type 4", "description": "" }, { "id": "MONDO:0008798", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008798", "name": "nonsyndromic congenital nail disorder 4", "description": "" }, { "id": "MONDO:0008798", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008798", "name": "nonsyndromic congenital nail disorder type 4", "description": "" }, { "id": "MONDO:0008798", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008798", "name": "NDNC4", "description": "" }, { "id": "MONDO:0008798", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008798", "name": "nail disorder, nonsyndromic congenital, 4", "description": "" }, { "id": "MIM:206800", "resource": "MIM", "url": "https://www.omim.org/entry/206800", "name": "Nail disorder, non-syndromic congenital, 4", "description": "Nail disorder, non-syndromic congenital, 4" } ], "unlinked_id_list": [], "evidence": [ { "id": "206800", "database": "MIM", "url": "https://www.omim.org/entry/206800" }, { "id": "0080082", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0080082" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "001000000000000000000.00010000000000.000000000001000000.01001.10.001.010", "uniprot_canonical_ac": "Q2I0M5-1" } ], "record_id": "pubmed.17186469", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "R-spondin1 is a high affinity ligand for LRP6 and induces LRP6 phosphorylation and beta-catenin signaling.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Wei Q, Yokota C, Semenov MV, Doble B, Woodgett J, He X", "reference": { "type": "PubMed", "id": "17400545", "url": "https://pubmed.ncbi.nlm.nih.gov/17400545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17400545", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "R-Spondin1 regulates Wnt signaling by inhibiting internalization of LRP6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Binnerts ME, Kim KA, Bright JM, Patel SM, Tran K, Zhou M, Leung JM, Liu Y, Lomas WE 3rd, Dixon M, Hazell SA, Wagle M, Nie WS, Tomasevic N, Williams J, Zhan X, Levy MD, Funk WD, Abo A", "reference": { "type": "PubMed", "id": "17804805", "url": "https://pubmed.ncbi.nlm.nih.gov/17804805" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94907-1", "protein_name": "Dickkopf-related protein 1", "gene_name": "DKK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96MU8-1", "protein_name": "Kremen protein 1", "gene_name": "KREMEN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17804805", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in R-spondin 4 (RSPO4) underlie inherited anonychia.", "journal": "The Journal of investigative dermatology", "date": "2008", "authors": "Ishii Y, Wajid M, Bazzi H, Fantauzzo KA, Barber AG, Blaydon DC, Nam JS, Yoon JK, Kelsell DP, Christiano AM", "reference": { "type": "PubMed", "id": "17805348", "url": "https://pubmed.ncbi.nlm.nih.gov/17805348" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17805348", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Balanced ubiquitylation and deubiquitylation of Frizzled regulate cellular responsiveness to Wg/Wnt.", "journal": "The EMBO journal", "date": "2010", "authors": "Mukai A, Yamamoto-Hino M, Awano W, Watanabe W, Komada M, Goto S", "reference": { "type": "PubMed", "id": "20495530", "url": "https://pubmed.ncbi.nlm.nih.gov/20495530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20495530", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "R-spondins function as ligands of the orphan receptors LGR4 and LGR5 to regulate Wnt/beta-catenin signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Carmon KS, Gong X, Lin Q, Thomas A, Liu Q", "reference": { "type": "PubMed", "id": "21693646", "url": "https://pubmed.ncbi.nlm.nih.gov/21693646" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BJ73-1", "protein_name": "R-spondin-4", "gene_name": "Rspo4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A2ARI4-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "Lgr4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q2TJ95-1", "protein_name": "R-spondin-3", "gene_name": "Rspo3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BFU0-1", "protein_name": "R-spondin-2", "gene_name": "Rspo2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z132-1", "protein_name": "R-spondin-1", "gene_name": "Rspo1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21693646", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lgr5 homologues associate with Wnt receptors and mediate R-spondin signalling.", "journal": "Nature", "date": "2011", "authors": "de Lau W, Barker N, Low TY, Koo BK, Li VS, Teunissen H, Kujala P, Haegebarth A, Peters PJ, van de Wetering M, Stange DE, van Es JE, Guardavaccaro D, Schasfoort RB, Mohri Y, Nishimori K, Mohammed S, Heck AJ, Clevers H", "reference": { "type": "PubMed", "id": "21727895", "url": "https://pubmed.ncbi.nlm.nih.gov/21727895" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z1P4-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "Lgr5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2ARI4-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "Lgr4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21727895", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LGR4 and LGR5 are R-spondin receptors mediating Wnt/beta-catenin and Wnt/PCP signalling.", "journal": "EMBO reports", "date": "2011", "authors": "Glinka A, Dolde C, Kirsch N, Huang YL, Kazanskaya O, Ingelfinger D, Boutros M, Cruciat CM, Niehrs C", "reference": { "type": "PubMed", "id": "21909076", "url": "https://pubmed.ncbi.nlm.nih.gov/21909076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21909076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZNRF3 promotes Wnt receptor turnover in an R-spondin-sensitive manner.", "journal": "Nature", "date": "2012", "authors": "Hao HX, Xie Y, Zhang Y, Charlat O, Oster E, Avello M, Lei H, Mickanin C, Liu D, Ruffner H, Mao X, Ma Q, Zamponi R, Bouwmeester T, Finan PM, Kirschner MW, Porter JA, Serluca FC, Cong F", "reference": { "type": "PubMed", "id": "22575959", "url": "https://pubmed.ncbi.nlm.nih.gov/22575959" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A5WWA0-1", "protein_name": "E3 ubiquitin-protein ligase znrf3", "gene_name": "znrf3", "tax_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SSZ7-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "Znrf3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 103, "end_pos": 103, "sequence_org": "P", "sequence_mut": "A", "comment": "Abolishes interaction with RSPO1 and prevents subsequent membrane clearance.", "evidence": [ { "database": "UniProtKB", "id": "Q9ULT6", "url": "https://www.uniprot.org/uniprotkb/Q9ULT6" }, { "database": "PubMed", "id": "22575959", "url": "https://pubmed.ncbi.nlm.nih.gov/22575959" } ], "uniprot_canonical_ac": "Q9ULT6-1" } ], "record_id": "pubmed.22575959", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inactivating mutations of RNF43 confer Wnt dependency in pancreatic ductal adenocarcinoma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Jiang X, Hao HX, Growney JD, Woolfenden S, Bottiglio C, Ng N, Lu B, Hsieh MH, Bagdasarian L, Meyer R, Smith TR, Avello M, Charlat O, Xie Y, Porter JA, Pan S, Liu J, McLaughlin ME, Cong F", "reference": { "type": "PubMed", "id": "23847203", "url": "https://pubmed.ncbi.nlm.nih.gov/23847203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40818-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 8", "gene_name": "USP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60353-1", "protein_name": "Frizzled-6", "gene_name": "FZD6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13467-1", "protein_name": "Frizzled-5", "gene_name": "FZD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H461-1", "protein_name": "Frizzled-8", "gene_name": "FZD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75581-1", "protein_name": "Low-density lipoprotein receptor-related protein 6", "gene_name": "LRP6", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75197-1", "protein_name": "Low-density lipoprotein receptor-related protein 5", "gene_name": "LRP5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P56704-1", "protein_name": "Protein Wnt-3a", "gene_name": "WNT3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9ULV1-1", "protein_name": "Frizzled-4", "gene_name": "FZD4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23847203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 21 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RSPO2 inhibition of RNF43 and ZNRF3 governs limb development independently of LGR4/5/6.", "journal": "Nature", "date": "2018", "authors": "Szenker-Ravi E, Altunoglu U, Leushacke M, Bosso-Lefevre C, Khatoo M, Thi Tran H, Naert T, Noelanders R, Hajamohideen A, Beneteau C, de Sousa SB, Karaman B, Latypova X, Basaran S, Yucel EB, Tan TT, Vlaminck L, Nayak SS, Shukla A, Girisha KM, Le Caignec C, Soshnikova N, Uyguner ZO, Vleminckx K, Barker N, Kayserili H, Reversade B", "reference": { "type": "PubMed", "id": "29769720", "url": "https://pubmed.ncbi.nlm.nih.gov/29769720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z1P4-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "Lgr5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q3UVD5-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "Lgr6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "A2ARI4-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "Lgr4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5SSZ7-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "Znrf3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9ULT6-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF3", "gene_name": "ZNRF3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5NCP0-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "Rnf43", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 105, "end_pos": 105, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of LGR5-binding, no effect on interaction with RNF43 and ZNRF3, no effect on WNT3A signaling; when associated with A-109.", "evidence": [ { "database": "UniProtKB", "id": "Q6UXX9", "url": "https://www.uniprot.org/uniprotkb/Q6UXX9" }, { "database": "PubMed", "id": "29769720", "url": "https://pubmed.ncbi.nlm.nih.gov/29769720" } ], "uniprot_canonical_ac": "Q6UXX9-1" }, { "start_pos": 109, "end_pos": 109, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of LGR5-binding, no effect on interaction with RNF43 and ZNRF3, no effect on WNT3A signaling; when associated with A-105.", "evidence": [ { "database": "UniProtKB", "id": "Q6UXX9", "url": "https://www.uniprot.org/uniprotkb/Q6UXX9" }, { "database": "PubMed", "id": "29769720", "url": "https://pubmed.ncbi.nlm.nih.gov/29769720" } ], "uniprot_canonical_ac": "Q6UXX9-1" }, { "start_pos": 106, "end_pos": 106, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of LGR4/5/6-binding, no effect on WNT3A signaling; when associated with A-110.", "evidence": [ { "database": "UniProtKB", "id": "Q9BXY4", "url": "https://www.uniprot.org/uniprotkb/Q9BXY4" }, { "database": "PubMed", "id": "29769720", "url": "https://pubmed.ncbi.nlm.nih.gov/29769720" } ], "uniprot_canonical_ac": "Q9BXY4-1" }, { "start_pos": 110, "end_pos": 110, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of LGR4/5/6-binding, no effect on WNT3A signaling; when associated with A-106.", "evidence": [ { "database": "UniProtKB", "id": "Q9BXY4", "url": "https://www.uniprot.org/uniprotkb/Q9BXY4" }, { "database": "PubMed", "id": "29769720", "url": "https://pubmed.ncbi.nlm.nih.gov/29769720" } ], "uniprot_canonical_ac": "Q9BXY4-1" } ], "record_id": "pubmed.29769720", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Single-cell RNA sequencing of human nail unit defines RSPO4 onychofibroblasts and SPINK6 nail epithelium.", "journal": "Communications biology", "date": "2021", "authors": "Kim HJ, Shim JH, Park JH, Shin HT, Shim JS, Jang KT, Park WY, Lee KH, Kwon EJ, Jang HS, Yang H, Lee JH, Yang JM, Lee D", "reference": { "type": "PubMed", "id": "34099859", "url": "https://pubmed.ncbi.nlm.nih.gov/34099859" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWN8-1", "protein_name": "Serine protease inhibitor Kazal-type 6", "gene_name": "SPINK6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34099859", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RSPO4 is a potential risk gene of stages III-IV, grade C periodontitis through effects on innate immune response and oral barrier integrity.", "journal": "Journal of clinical periodontology", "date": "2022-12-12", "authors": "Chopra Avneesh, Song Jiahui, Weiner January, Keceli Huseyin G, Dincer Pervin R, Cruz Raquel, Carracedo Angel, Blanco Juan, Dommisch Henrik, Schaefer Arne S", "reference": { "type": "PubMed", "id": "36507580", "url": "https://pubmed.ncbi.nlm.nih.gov/36507580" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2I0M5-1", "protein_name": "R-spondin-4", "gene_name": "RSPO4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2I0M5", "url": "https://www.uniprot.org/uniprotkb/Q2I0M5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36507580", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inducing intestinal growth.", "journal": "The New England journal of medicine", "date": "2005", "authors": "Abraham C, Cho JH", "reference": { "type": "PubMed", "id": "16306530", "url": "https://pubmed.ncbi.nlm.nih.gov/16306530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16306530", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "R-spondin1 is essential in sex determination, skin differentiation and malignancy.", "journal": "Nat. Genet.", "date": "2006", "authors": "Parma P, Radi O, Vidal V, Chaboissier MC, Dellambra E, Valentini S, Guerra L, Schedl A, Camerino G", "reference": { "type": "PubMed", "id": "17041600", "url": "https://pubmed.ncbi.nlm.nih.gov/17041600" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Z132-1", "protein_name": "R-spondin-1", "gene_name": "Rspo1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17041600", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LGR6 is a high affinity receptor of R-spondins and potentially functions as a tumor suppressor.", "journal": "PloS one", "date": "2012", "authors": "Gong X, Carmon KS, Lin Q, Thomas A, Yi J, Liu Q", "reference": { "type": "PubMed", "id": "22615920", "url": "https://pubmed.ncbi.nlm.nih.gov/22615920" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HBX8-3", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 6", "gene_name": "LGR6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22615920", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "R-Spondin potentiates Wnt/\u03b2-catenin signaling through orphan receptors LGR4 and LGR5.", "journal": "PloS one", "date": "2012", "authors": "Ruffner Heinz, Sprunger Jo\u00eblle, Charlat Olga, Leighton-Davies Juliet, Grosshans Bianka, Salathe Adrian, Zietzling Svenja, Beck Val\u00e9rie, Therier Maxime, Isken Andrea, Xie Yang, Zhang Yue, Hao Huaixiang, Shi Xiaoying, Liu Dong, Song Qinhui, Clay Ieuan, Hintzen Gabriele, Tchorz Jan, Bouchez Laure C, Michaud Gregory, Finan Peter, Myer Vic E, Bouwmeester Tewis, Porter Jeff, Hild Marc, Bassilana Fred, Parker Christian N, Cong Feng", "reference": { "type": "PubMed", "id": "22815884", "url": "https://pubmed.ncbi.nlm.nih.gov/22815884" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22815884", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structural basis of R-spondin recognition by LGR5 and RNF43.", "journal": "Genes Dev.", "date": "2013", "authors": "Chen PH, Chen X, Lin Z, Fang D, He X", "reference": { "type": "PubMed", "id": "23756651", "url": "https://pubmed.ncbi.nlm.nih.gov/23756651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68DV7-1", "protein_name": "E3 ubiquitin-protein ligase RNF43", "gene_name": "RNF43", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4BSS&bu=0&command=select+.B:208;+center+selection;+zoom+selection" }, "start_pos": 208, "start_aa": "Asn", "end_pos": 208, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn208", "evidence": [ { "id": "O75473", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75473#ptm_processing" }, { "id": "23756651", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23756651" }, { "id": "4BSS", "database": "PDB", "url": "https://www.rcsb.org/structure/4BSS" }, { "id": "4BST", "database": "PDB", "url": "https://www.rcsb.org/structure/4BST" }, { "id": "4KNG", "database": "PDB", "url": "https://www.rcsb.org/structure/4KNG" }, { "id": "4UFR", "database": "PDB", "url": "https://www.rcsb.org/structure/4UFR" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "O75473-1" } ], "record_id": "pubmed.23756651", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for R-spondin recognition by LGR4/5/6 receptors.", "journal": "Genes & development", "date": "2013", "authors": "Wang D, Huang B, Zhang S, Yu X, Wu W, Wang X", "reference": { "type": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXB1-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 4", "gene_name": "LGR4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 106, "sequence_org": "F", "sequence_mut": "A", "comment": "Abolishes activation of Wnt signaling. Abolishes LGR4 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 106, "end_pos": 106, "sequence_org": "F", "sequence_mut": "E", "comment": "Abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 110, "end_pos": 110, "sequence_org": "F", "sequence_mut": "A", "comment": "Nearly abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 110, "end_pos": 110, "sequence_org": "F", "sequence_mut": "E", "comment": "Abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 122, "end_pos": 122, "sequence_org": "K", "sequence_mut": "A", "comment": "Strongly reduces affinity for LGR4.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 124, "end_pos": 124, "sequence_org": "R", "sequence_mut": "A", "comment": "Strongly reduces affinity for LGR4.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 87, "end_pos": 87, "sequence_org": "R", "sequence_mut": "A", "comment": "Nearly abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4KT1&bu=0&command=select+.A:199;+center+selection;+zoom+selection" }, "start_pos": 199, "start_aa": "Asn", "end_pos": 199, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn199", "evidence": [ { "id": "Q9BXB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BXB1#ptm_processing" }, { "id": "23756652", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "id": "4KT1", "database": "PDB", "url": "https://www.rcsb.org/structure/4KT1" }, { "id": "4QXE", "database": "PDB", "url": "https://www.rcsb.org/structure/4QXE" }, { "id": "9KB6", "database": "PDB", "url": "https://www.rcsb.org/structure/9KB6" }, { "id": "9KB9", "database": "PDB", "url": "https://www.rcsb.org/structure/9KB9" }, { "id": "9KB8", "database": "PDB", "url": "https://www.rcsb.org/structure/9KB8" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BXB1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=4QXE&bu=0&command=select+.A:68;+center+selection;+zoom+selection" }, "start_pos": 68, "start_aa": "Asn", "end_pos": 68, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn68", "evidence": [ { "id": "Q9BXB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BXB1#ptm_processing" }, { "id": "23756652", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "id": "4QXE", "database": "PDB", "url": "https://www.rcsb.org/structure/4QXE" }, { "id": "9KB6", "database": "PDB", "url": "https://www.rcsb.org/structure/9KB6" }, { "id": "9KB9", "database": "PDB", "url": "https://www.rcsb.org/structure/9KB9" }, { "id": "9KB8", "database": "PDB", "url": "https://www.rcsb.org/structure/9KB8" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BXB1-1" } ], "record_id": "pubmed.23756652", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of stem cell growth factor R-spondin 1 in complex with the ectodomain of its receptor LGR5.", "journal": "Cell reports", "date": "2013", "authors": "Peng WC, de Lau W, Forneris F, Granneman JC, Huch M, Clevers H, Gros P", "reference": { "type": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75473-1", "protein_name": "Leucine-rich repeat-containing G protein-coupled receptor 5", "gene_name": "LGR5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 106, "sequence_org": "F", "sequence_mut": "A", "comment": "Abolishes activation of Wnt signaling. Abolishes LGR4 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 106, "end_pos": 106, "sequence_org": "F", "sequence_mut": "E", "comment": "Abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 110, "end_pos": 110, "sequence_org": "F", "sequence_mut": "A", "comment": "Nearly abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 110, "end_pos": 110, "sequence_org": "F", "sequence_mut": "E", "comment": "Abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 66, "end_pos": 66, "sequence_org": "R", "sequence_mut": "A", "comment": "Strongly reduces activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 66, "end_pos": 66, "sequence_org": "R", "sequence_mut": "W", "comment": "Reduces activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 70, "end_pos": 70, "sequence_org": "R", "sequence_mut": "C", "comment": "Strongly reduces activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 70, "end_pos": 70, "sequence_org": "R", "sequence_mut": "E", "comment": "Strongly reduces activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 71, "end_pos": 71, "sequence_org": "Q", "sequence_mut": "E", "comment": "No effect on activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 71, "end_pos": 71, "sequence_org": "Q", "sequence_mut": "R", "comment": "Strongly reduces activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "G", "sequence_mut": "E", "comment": "Strongly reduces activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "G", "sequence_mut": "R", "comment": "Strongly reduces activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 87, "end_pos": 87, "sequence_org": "R", "sequence_mut": "A", "comment": "Nearly abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "23756652", "url": "https://pubmed.ncbi.nlm.nih.gov/23756652" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 146, "end_pos": 146, "sequence_org": "D", "sequence_mut": "F", "comment": "Abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "O75473", "url": "https://www.uniprot.org/uniprotkb/O75473" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "O75473-1" }, { "start_pos": 170, "end_pos": 170, "sequence_org": "D", "sequence_mut": "F", "comment": "Abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "O75473", "url": "https://www.uniprot.org/uniprotkb/O75473" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "O75473-1" }, { "start_pos": 190, "end_pos": 190, "sequence_org": "A", "sequence_mut": "D", "comment": "Abolishes activation of Wnt signaling.", "evidence": [ { "database": "UniProtKB", "id": "O75473", "url": "https://www.uniprot.org/uniprotkb/O75473" }, { "database": "PubMed", "id": "23809763", "url": "https://pubmed.ncbi.nlm.nih.gov/23809763" } ], "uniprot_canonical_ac": "O75473-1" } ], "record_id": "pubmed.23809763", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of DPY19L3 as the C-mannosyltransferase of R-spondin1 in human cells.", "journal": "Molecular biology of the cell", "date": "2016", "authors": "Niwa Y, Suzuki T, Dohmae N, Simizu S", "reference": { "type": "PubMed", "id": "26764097", "url": "https://pubmed.ncbi.nlm.nih.gov/26764097" }, "referenced_glycans": [ { "glytoucan_ac": "G61491DK" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6ZPD9-1", "protein_name": "Protein C-mannosyl-transferase DPY19L3", "gene_name": "DPY19L3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G61491DK", "type": "C-linked", "subtype": "C-mannosylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "W", "relation": "attached", "comment": "C-linked (Man) tryptophan;C-mannosylation", "icn3d_view": {}, "start_pos": 153, "start_aa": "Trp", "end_pos": 153, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp153", "evidence": [ { "id": "Q2MKA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7#ptm_processing" }, { "id": "GLY_001254", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001254" }, { "id": "26764097", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26764097" } ], "filter_code": "000000000000000001000.0000000.00000000000100.1000000.1000000000.000000000000001010.10000.01100", "uniprot_canonical_ac": "Q2MKA7-1" }, { "glytoucan_ac": "", "type": "C-linked", "subtype": "C-mannosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "W", "relation": "attached", "comment": "C-linked (Man) tryptophan;C-mannosylation", "icn3d_view": {}, "start_pos": 153, "start_aa": "Trp", "end_pos": 153, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp153", "evidence": [ { "id": "Q2MKA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7#ptm_processing" }, { "id": "26764097", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26764097" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "000000000000000001000.00000000000100.00.01100", "uniprot_canonical_ac": "Q2MKA7-1" }, { "glytoucan_ac": "G61491DK", "type": "C-linked", "subtype": "C-mannosylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "W", "relation": "attached", "comment": "C-linked (Man) tryptophan;C-mannosylation", "icn3d_view": {}, "start_pos": 156, "start_aa": "Trp", "end_pos": 156, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp156", "evidence": [ { "id": "Q2MKA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7#ptm_processing" }, { "id": "GLY_001254", "database": "GlyGen", "url": "https://data.glygen.org/GLY_001254" }, { "id": "26764097", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26764097" } ], "filter_code": "000000000000000001000.0000000.00000000000100.1000000.1000000000.000000000000001010.10000.01100", "uniprot_canonical_ac": "Q2MKA7-1" }, { "glytoucan_ac": "", "type": "C-linked", "subtype": "C-mannosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "W", "relation": "attached", "comment": "C-linked (Man) tryptophan;C-mannosylation", "icn3d_view": {}, "start_pos": 156, "start_aa": "Trp", "end_pos": 156, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp156", "evidence": [ { "id": "Q2MKA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7#ptm_processing" }, { "id": "26764097", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26764097" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0;GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" }, { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000001000.00000000000100.00.01100", "uniprot_canonical_ac": "Q2MKA7-1" }, { "glytoucan_ac": "", "type": "C-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "W", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 156, "start_aa": "Trp", "end_pos": 156, "end_aa": "Trp", "residue": "Trp", "site_lbl": "Trp156", "evidence": [ { "id": "27350215", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27350215" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "26764097", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26764097" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "000000000000000001000.00000000000010.00.01000", "uniprot_canonical_ac": "Q9BXY4-1" } ], "mutagenesis": [ { "start_pos": 153, "end_pos": 153, "sequence_org": "W", "sequence_mut": "A", "comment": "Secretion of RSPO1 is decreased; when associated with A-156. Decreases activation of Wnt signaling; when associated with A-156.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "26764097", "url": "https://pubmed.ncbi.nlm.nih.gov/26764097" } ], "uniprot_canonical_ac": "Q2MKA7-1" }, { "start_pos": 156, "end_pos": 156, "sequence_org": "W", "sequence_mut": "A", "comment": "Secretion of RSPO1 is decreased; when associated with A-153. Decreases activation of Wnt signaling; when associated with A-153.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "26764097", "url": "https://pubmed.ncbi.nlm.nih.gov/26764097" } ], "uniprot_canonical_ac": "Q2MKA7-1" } ], "record_id": "pubmed.26764097", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_c_linked_sites", "count": 3 }, { "field": "exact_c_linked_glycan_sites", "count": 2 }, { "field": "exact_c_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_c_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_c_linked_sites", "count": 2 }, { "field": "exact_c_linked_glycan_sites", "count": 2 }, { "field": "exact_c_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_c_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] } ] }, { "title": "N-glycosylation of R-spondin1 at Asn137 negatively regulates its secretion and Wnt/\u03b2-catenin signaling-enhancing activity.", "journal": "Oncology letters", "date": "2016-05", "authors": "Tsuchiya Miyu, Niwa Yuki, Simizu Siro", "reference": { "type": "PubMed", "id": "27123103", "url": "https://pubmed.ncbi.nlm.nih.gov/27123103" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 137, "start_aa": "Asn", "end_pos": 137, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn137", "evidence": [ { "id": "Q2MKA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7#ptm_processing" }, { "id": "27123103", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27123103" }, { "id": "27314333", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27314333" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01101", "uniprot_canonical_ac": "Q2MKA7-1" } ], "mutagenesis": [ { "start_pos": 137, "end_pos": 137, "sequence_org": "N", "sequence_mut": "Q", "comment": "Secretion of RSPO1 is decreased. Increased Wnt/beta-catenin signaling-enhancing effects.", "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" }, { "database": "PubMed", "id": "27123103", "url": "https://pubmed.ncbi.nlm.nih.gov/27123103" } ], "uniprot_canonical_ac": "Q2MKA7-1" } ], "record_id": "pubmed.27123103", "abstract": "", "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "N-Glycosylation of Human R-Spondin 1 Is Required for Efficient Secretion and Stability but Not for Its Heparin Binding Ability.", "journal": "International journal of molecular sciences", "date": "2016", "authors": "Chang CF, Hsu LS, Weng CY, Chen CK, Wang SY, Chou YH, Liu YY, Yuan ZX, Huang WY, Lin H, Chen YH, Tsai JN", "reference": { "type": "PubMed", "id": "27314333", "url": "https://pubmed.ncbi.nlm.nih.gov/27314333" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXX9-1", "protein_name": "R-spondin-2", "gene_name": "RSPO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXY4-1", "protein_name": "R-spondin-3", "gene_name": "RSPO3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 137, "start_aa": "Asn", "end_pos": 137, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn137", "evidence": [ { "id": "Q2MKA7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7#ptm_processing" }, { "id": "27123103", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27123103" }, { "id": "27314333", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27314333" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01101", "uniprot_canonical_ac": "Q2MKA7-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 160, "start_aa": "Asn", "end_pos": 160, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn160", "evidence": [ { "id": "Q6UXX9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6UXX9#ptm_processing" }, { "id": "27314333", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27314333" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q6UXX9-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 137, "start_aa": "Asn", "end_pos": 137, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn137", "evidence": [ { "id": "27314333", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27314333" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "RLIMS-G_1.0", "mining_tool_list": [ { "label": "RLIMS-G_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BXY4-1" } ], "record_id": "pubmed.27314333", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_sites", "count": 3 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 3 }, { "field": "exact_n_linked_sites", "count": 3 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "WNT Signaling Driven by R-spondin 1 and LGR6 in High-grade Serous Ovarian Cancer.", "journal": "Anticancer research", "date": "2020", "authors": "Lee S, Jun J, Kim WJ, Tamayo P, Howell SB", "reference": { "type": "PubMed", "id": "33109540", "url": "https://pubmed.ncbi.nlm.nih.gov/33109540" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33109540", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RSPO1-mutated keratinocytes from palmoplantar keratoderma display impaired differentiation, alteration of cell-cell adhesion, EMT-like phenotype and invasiveness properties: implications for squamous cell carcinoma susceptibility in patients with 46XX disorder of sexual development.", "journal": "Orphanet journal of rare diseases", "date": "2022", "authors": "Dellambra E, Cordisco S, Delle Monache F, Bondanza S, Teson M, Nicodemi EM, Didona B, Condorelli AG, Camerino G, Castiglia D, Guerra L", "reference": { "type": "PubMed", "id": "35854363", "url": "https://pubmed.ncbi.nlm.nih.gov/35854363" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35854363", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human RSPO1 Mutation Represses Beige Adipocyte Thermogenesis and Contributes to Diet-Induced Adiposity.", "journal": "Advanced science (Weinheim, Baden-Wurttemberg, Germany)", "date": "2023-04", "authors": "Sun Yingkai, Zhang Juan, Hong Jie, Zhang Zhongyun, Lu Peng, Gao Aibo, Ni Mengshan, Zhang Zhiyin, Yang Huanjie, Shen Juan, Lu Jieli, Xue Wenzhi, Lv Qianqian, Bi Yufang, Zeng Yi Arial, Gu Weiqiong, Ning Guang, Wang Weiqing, Liu Ruixin, Wang Jiqiu", "reference": { "type": "PubMed", "id": "36755192", "url": "https://pubmed.ncbi.nlm.nih.gov/36755192" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2MKA7-1", "protein_name": "R-spondin-1", "gene_name": "RSPO1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2MKA7", "url": "https://www.uniprot.org/uniprotkb/Q2MKA7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36755192", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]