[ { "title": "Identification of FAM96B as a novel selenoprotein W binding partner in the brain.", "journal": "Biochemical and biophysical research communications", "date": "2019", "authors": "Chen P, Wang C, Liu Q, Tian J, Liu Q", "reference": { "type": "PubMed", "id": "30876693", "url": "https://pubmed.ncbi.nlm.nih.gov/30876693" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63302-1", "protein_name": "Selenoprotein W", "gene_name": "SELENOW", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P63302", "url": "https://www.uniprot.org/uniprotkb/P63302" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30876693", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of Selenoprotein W in participating in the progression of non-alcoholic fatty liver disease.", "journal": "Redox biology", "date": "2024-05", "authors": "Miao Zhiruo, Wang Wei, Miao Zhiying, Cao Qiyuan, Xu Shiwen", "reference": { "type": "PubMed", "id": "38460355", "url": "https://pubmed.ncbi.nlm.nih.gov/38460355" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63302-1", "protein_name": "Selenoprotein W", "gene_name": "SELENOW", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P63302", "url": "https://www.uniprot.org/uniprotkb/P63302" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38460355", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Selenoprotein W engages in overactive osteoclast differentiation in multiple myeloma.", "journal": "Molecular biology reports", "date": "2024-04-29", "authors": "Kim Hyunsoo, Oh Jiin, Kim Min Kyoung, Lee Kyung Hee, Jeong Daewon", "reference": { "type": "PubMed", "id": "38683225", "url": "https://pubmed.ncbi.nlm.nih.gov/38683225" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63302-1", "protein_name": "Selenoprotein W", "gene_name": "SELENOW", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63300-1", "protein_name": "Selenoprotein W", "gene_name": "Selenow", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P63302", "url": "https://www.uniprot.org/uniprotkb/P63302" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38683225", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conserved features of selenocysteine insertion sequence (SECIS) elements in selenoprotein W cDNAs from five species.", "journal": "Gene", "date": "1997", "authors": "Gu Q P, Beilstein M A, Vendeland S C, Lugade A, Ream W, Whanger P D", "reference": { "type": "PubMed", "id": "9256076", "url": "https://pubmed.ncbi.nlm.nih.gov/9256076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P63302-1", "protein_name": "Selenoprotein W", "gene_name": "SELENOW", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63300-1", "protein_name": "Selenoprotein W", "gene_name": "Selenow", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P63302", "url": "https://www.uniprot.org/uniprotkb/P63302" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9256076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Serological identification and expression analysis of gastric cancer-associated genes.", "journal": "Br. J. Cancer", "date": "2002", "authors": "Line A, Stengrevics A, Slucka Z, Li G, Jankevics E, Rees RC", "reference": { "type": "PubMed", "id": "12087473", "url": "https://pubmed.ncbi.nlm.nih.gov/12087473" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y3A4-1", "protein_name": "Ribosomal RNA-processing protein 7 homolog A", "gene_name": "RRP7A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75410-1", "protein_name": "Transforming acidic coiled-coil-containing protein 1", "gene_name": "TACC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P80303-1", "protein_name": "Nucleobindin-2", "gene_name": "NUCB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BXJ9-1", "protein_name": "N-alpha-acetyltransferase 15, NatA auxiliary subunit", "gene_name": "NAA15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NEY8-1", "protein_name": "Periphilin-1", "gene_name": "PPHLN1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y3A4", "url": "https://www.uniprot.org/uniprotkb/Q9Y3A4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12087473", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RRP7A links primary microcephaly to dysfunction of ribosome biogenesis, resorption of primary cilia, and neurogenesis.", "journal": "Nature communications", "date": "2020", "authors": "Farooq M, Lindbaek L, Krogh N, Doganli C, Keller C, Monnich M, Goncalves AB, Sakthivel S, Mang Y, Fatima A, Andersen VS, Hussain MS, Eiberg H, Hansen L, Kjaer KW, Gopalakrishnan J, Pedersen LB, Mollgard K, Nielsen H, Baig SM, Tommerup N, Christensen ST, Larsen LA", "reference": { "type": "PubMed", "id": "33199730", "url": "https://pubmed.ncbi.nlm.nih.gov/33199730" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y3A4-1", "protein_name": "Ribosomal RNA-processing protein 7 homolog A", "gene_name": "RRP7A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6R4-1", "protein_name": "Nucleolar protein 6", "gene_name": "NOL6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y3A4", "url": "https://www.uniprot.org/uniprotkb/Q9Y3A4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33199730", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.", "journal": "Genetics", "date": "2006", "authors": "Shiina Takashi, Ota Masao, Shimizu Sayoko, Katsuyama Yoshihiko, Hashimoto Nami, Takasu Miwa, Anzai Tatsuya, Kulski Jerzy K, Kikkawa Eri, Naruse Taeko, Kimura Natsuki, Yanagiya Kazuyo, Watanabe Atsushi, Hosomichi Kazuyoshi, Kohara Sakae, Iwamoto Chie, Umehara Yumi, Meyer Alice, Wanner Val\u00e9rie, Sano Kazumi, Macquin C\u00e9cile, Ikeo Kazuho, Tokunaga Katsushi, Gojobori Takashi, Inoko Hidetoshi, Bahram Seiamak", "reference": { "type": "PubMed", "id": "16702430", "url": "https://pubmed.ncbi.nlm.nih.gov/16702430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y676-1", "protein_name": "Small ribosomal subunit protein mS40", "gene_name": "MRPS18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q12899-1", "protein_name": "Tripartite motif-containing protein 26", "gene_name": "TRIM26", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92759-1", "protein_name": "General transcription factor IIH subunit 4", "gene_name": "GTF2H4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y242-1", "protein_name": "Transcription factor 19", "gene_name": "TCF19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13747-1", "protein_name": "HLA class I histocompatibility antigen, alpha chain E", "gene_name": "HLA-E", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UIG4-1", "protein_name": "Psoriasis susceptibility 1 candidate gene 2 protein", "gene_name": "PSORS1C2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UDY6-1", "protein_name": "Tripartite motif-containing protein 10", "gene_name": "TRIM10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14676-1", "protein_name": "Mediator of DNA damage checkpoint protein 1", "gene_name": "MDC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15517-1", "protein_name": "Corneodesmosin", "gene_name": "CDSN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UXA7-1", "protein_name": "Uncharacterized protein C6orf15", "gene_name": "C6orf15", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01860-1", "protein_name": "POU domain, class 5, transcription factor 1", "gene_name": "POU5F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3MIW9-1", "protein_name": "Mucin-like protein 3", "gene_name": "MUCL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08345-1", "protein_name": "Epithelial discoidin domain-containing receptor 1", "gene_name": "DDR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13838-1", "protein_name": "Spliceosome RNA helicase DDX39B", "gene_name": "DDX39B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IXM6-1", "protein_name": "Nurim", "gene_name": "NRM", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCM9-1", "protein_name": "E3 ubiquitin-protein ligase TRIM39", "gene_name": "TRIM39", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P9F5-1", "protein_name": "E3 ubiquitin ligase TRIM40", "gene_name": "TRIM40", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95670-1", "protein_name": "V-type proton ATPase subunit G 2", "gene_name": "ATP6V1G2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y676", "url": "https://www.uniprot.org/uniprotkb/Q9Y676" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16702430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus, resulting in the disruption of pRb-E2F1 complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Kashuba E, Yurchenko M, Yenamandra SP, Snopok B, Isaguliants M, Szekely L, Klein G", "reference": { "type": "PubMed", "id": "18391203", "url": "https://pubmed.ncbi.nlm.nih.gov/18391203" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y676-1", "protein_name": "Small ribosomal subunit protein mS40", "gene_name": "MRPS18B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y676", "url": "https://www.uniprot.org/uniprotkb/Q9Y676" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18391203", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and function of the mitochondrial ribosome.", "journal": "Annu. Rev. Biochem.", "date": "2016", "authors": "Greber Basil J, Ban Nenad", "reference": { "type": "PubMed", "id": "27023846", "url": "https://pubmed.ncbi.nlm.nih.gov/27023846" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y676-1", "protein_name": "Small ribosomal subunit protein mS40", "gene_name": "MRPS18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVS2-1", "protein_name": "Large ribosomal subunit protein mL66", "gene_name": "MRPS18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14197-1", "protein_name": "Large ribosomal subunit protein mL62", "gene_name": "MRPL58", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3D5-1", "protein_name": "Small ribosomal subunit protein bS18m", "gene_name": "MRPS18C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7F7-1", "protein_name": "Large ribosomal subunit protein mL55", "gene_name": "MRPL55", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP92-1", "protein_name": "Large ribosomal subunit protein mL65", "gene_name": "MRPS30", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAE8-1", "protein_name": "Large ribosomal subunit protein mL64", "gene_name": "GADD45GIP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y676", "url": "https://www.uniprot.org/uniprotkb/Q9Y676" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27023846", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression pattern of MRPS18 family genes in gliomas.", "journal": "Experimental oncology", "date": "2021", "authors": "Kovalevska LM, Malysheva TA, Kalman SS, Rozumenko AV, Verbova LV, Rozumenko VD, Kashuba EV", "reference": { "type": "PubMed", "id": "34591434", "url": "https://pubmed.ncbi.nlm.nih.gov/34591434" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y676-1", "protein_name": "Small ribosomal subunit protein mS40", "gene_name": "MRPS18B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVS2-1", "protein_name": "Large ribosomal subunit protein mL66", "gene_name": "MRPS18A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3D5-1", "protein_name": "Small ribosomal subunit protein bS18m", "gene_name": "MRPS18C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y676", "url": "https://www.uniprot.org/uniprotkb/Q9Y676" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34591434", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PA26 is a candidate gene for heterotaxia in humans: identification of a novel PA26-related gene family in human and mouse.", "journal": "Hum. Genet.", "date": "2003", "authors": "Peeters H, Debeer P, Bairoch A, Wilquet V, Huysmans C, Parthoens E, Fryns JP, Gewillig M, Nakamura Y, Niikawa N, Van de Ven W, Devriendt K", "reference": { "type": "PubMed", "id": "12607115", "url": "https://pubmed.ncbi.nlm.nih.gov/12607115" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58005-1", "protein_name": "Sestrin-3", "gene_name": "SESN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y6P5-1", "protein_name": "Sestrin-1", "gene_name": "SESN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58006-1", "protein_name": "Sestrin-1", "gene_name": "Sesn1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12607115", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hepatoprotective role of Sestrin2 against chronic ER stress.", "journal": "Nature communications", "date": "2014-06-20", "authors": "Park Hwan-Woo, Park Haeli, Ro Seung-Hyun, Jang Insook, Semple Ian A, Kim David N, Kim Myungjin, Nam Myeongjin, Zhang Deqiang, Yin Lei, Lee Jun Hee", "reference": { "type": "PubMed", "id": "24947615", "url": "https://pubmed.ncbi.nlm.nih.gov/24947615" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P58043-1", "protein_name": "Sestrin-2", "gene_name": "Sesn2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24947615", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Janus-faced Sestrin2 controls ROS and mTOR signalling through two separate functional domains.", "journal": "Nature communications", "date": "2015", "authors": "Kim H, An S, Ro SH, Teixeira F, Park GJ, Kim C, Cho CS, Kim JS, Jakob U, Lee JH, Cho US", "reference": { "type": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 113, "end_pos": 113, "sequence_org": "H", "sequence_mut": "E", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with C-128.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 125, "end_pos": 125, "sequence_org": "C", "sequence_mut": "S", "comment": "Decreased alkylhydroperoxide reductase activity and loss of the ability to decrease intracellular reactive oxygen species. No effect on interaction with the GATOR2 complex. No effect on inhibition of TOR signaling.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" }, { "database": "PubMed", "id": "18692468", "url": "https://pubmed.ncbi.nlm.nih.gov/18692468" }, { "database": "PubMed", "id": "15105503", "url": "https://pubmed.ncbi.nlm.nih.gov/15105503" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 127, "end_pos": 127, "sequence_org": "Y", "sequence_mut": "F", "comment": "Decreased alkylhydroperoxide reductase activity. No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 128, "end_pos": 128, "sequence_org": "L", "sequence_mut": "C", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with E-113.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 132, "end_pos": 132, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreased alkylhydroperoxide reductase activity. No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 204, "end_pos": 204, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on alkylhydroperoxide reductase activity. No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 214, "end_pos": 214, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on alkylhydroperoxide reductase activity.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 258, "end_pos": 258, "sequence_org": "V", "sequence_mut": "R", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with L-259 and R-261.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 259, "end_pos": 259, "sequence_org": "E", "sequence_mut": "L", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with R-258 and R-261.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 261, "end_pos": 261, "sequence_org": "L", "sequence_mut": "R", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with R-258 and L-259.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 262, "end_pos": 264, "sequence_org": "MER", "sequence_mut": "LMM", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 264, "end_pos": 264, "sequence_org": "R", "sequence_mut": "P", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 336, "end_pos": 337, "sequence_org": "TF", "sequence_mut": "AA", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 340, "end_pos": 341, "sequence_org": "QD", "sequence_mut": "AA", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 373, "end_pos": 373, "sequence_org": "L", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-376.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 376, "end_pos": 376, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-373.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 385, "end_pos": 385, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-387.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 387, "end_pos": 387, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-385.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 399, "end_pos": 399, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on alkylhydroperoxide reductase activity. Altered ability to decrease intracellular reactive oxygen species. No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" }, { "database": "PubMed", "id": "15105503", "url": "https://pubmed.ncbi.nlm.nih.gov/15105503" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 406, "end_pos": 406, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on alkylhydroperoxide reductase activity. Loss of interaction with the GATOR2 complex. Unable to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 407, "end_pos": 407, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on alkylhydroperoxide reductase activity. Loss of interaction with the GATOR2 complex. Unable to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 409, "end_pos": 409, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-411 and A-415.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 411, "end_pos": 411, "sequence_org": "G", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-409 and A-415.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 415, "end_pos": 415, "sequence_org": "Q", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-409 and A-411.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 419, "end_pos": 419, "sequence_org": "R", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-422 and A-426.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 422, "end_pos": 422, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-419 and A-426.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 426, "end_pos": 426, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway; when associated with A-419 and A-422.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 430, "end_pos": 430, "sequence_org": "C", "sequence_mut": "S", "comment": "No effect on alkylhydroperoxide reductase activity. Altered ability to decrease intracellular reactive oxygen species. No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" }, { "database": "PubMed", "id": "15105503", "url": "https://pubmed.ncbi.nlm.nih.gov/15105503" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 87, "end_pos": 87, "sequence_org": "P", "sequence_mut": "S", "comment": "No effect on the ability to inhibit the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26612684", "url": "https://pubmed.ncbi.nlm.nih.gov/26612684" } ], "uniprot_canonical_ac": "P58004-1" } ], "record_id": "pubmed.26612684", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RING-type E3 ligase RNF186 ubiquitinates Sestrin-2 and thereby controls nutrient sensing.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Lear TB, Lockwood KC, Ouyang Y, Evankovich JW, Larsen MB, Lin B, Liu Y, Chen BB", "reference": { "type": "PubMed", "id": "31586034", "url": "https://pubmed.ncbi.nlm.nih.gov/31586034" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXI6-1", "protein_name": "E3 ubiquitin-protein ligase RNF186", "gene_name": "RNF186", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 60, "end_pos": 60, "sequence_org": "H", "sequence_mut": "W", "comment": "Loss of ability to decrease SESN2 protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9NXI6", "url": "https://www.uniprot.org/uniprotkb/Q9NXI6" }, { "database": "PubMed", "id": "31586034", "url": "https://pubmed.ncbi.nlm.nih.gov/31586034" } ], "uniprot_canonical_ac": "Q9NXI6-1" } ], "record_id": "pubmed.31586034", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sestrin2 Phosphorylation by ULK1 Induces Autophagic Degradation of Mitochondria Damaged by Copper-Induced Oxidative Stress.", "journal": "International journal of molecular sciences", "date": "2020-08-25", "authors": "Kim Heejeong, Jeon Byeong Tak, Kim Isaac M, Bennett Sydney J, Lorch Carolyn M, Viana Martonio Ponte, Myers Jacob F, Trupp Caroline J, Whipps Zachary T, Kundu Mondira, Chung Soonkyu, Sun Xinghui, Khalimonchuk Oleh, Lee Jaekwon, Ro Seung-Hyun", "reference": { "type": "PubMed", "id": "32854424", "url": "https://pubmed.ncbi.nlm.nih.gov/32854424" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 254, "end_pos": 254, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P58004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P58004" }, { "database": "PubMed", "id": "32854424", "url": "https://pubmed.ncbi.nlm.nih.gov/32854424" } ], "site_lbl": "Ser254", "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P58004", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P58004" }, { "database": "PubMed", "id": "32854424", "url": "https://pubmed.ncbi.nlm.nih.gov/32854424" } ], "site_lbl": "Ser73", "uniprot_canonical_ac": "P58004-1" } ], "record_id": "pubmed.32854424", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E3 ligase RNF167 and deubiquitinase STAMBPL1 modulate mTOR and cancer progression.", "journal": "Molecular cell", "date": "2022", "authors": "Wang D, Xu C, Yang W, Chen J, Ou Y, Guan Y, Guan J, Liu Y", "reference": { "type": "PubMed", "id": "35114100", "url": "https://pubmed.ncbi.nlm.nih.gov/35114100" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FJ0-1", "protein_name": "AMSH-like protease", "gene_name": "STAMBPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6Y7-1", "protein_name": "E3 ubiquitin-protein ligase RNF167", "gene_name": "RNF167", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 175, "end_pos": 175, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolished 'Lys-63'-linked ubiquitination by RNF167.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "35114100", "url": "https://pubmed.ncbi.nlm.nih.gov/35114100" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 261, "end_pos": 261, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased leucine-binding. Promotes interaction with RNF167.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26449471", "url": "https://pubmed.ncbi.nlm.nih.gov/26449471" }, { "database": "PubMed", "id": "35114100", "url": "https://pubmed.ncbi.nlm.nih.gov/35114100" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 390, "end_pos": 390, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of leucine-binding. Promotes interaction with RNF167. Constitutively interacts with the GATOR2 complex.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26586190", "url": "https://pubmed.ncbi.nlm.nih.gov/26586190" }, { "database": "PubMed", "id": "35114100", "url": "https://pubmed.ncbi.nlm.nih.gov/35114100" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 406, "end_pos": 407, "sequence_org": "DD", "sequence_mut": "AA", "comment": "Loss of interaction with the GATOR2 complex. No effect on leucine-binding.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26586190", "url": "https://pubmed.ncbi.nlm.nih.gov/26586190" }, { "database": "PubMed", "id": "35114100", "url": "https://pubmed.ncbi.nlm.nih.gov/35114100" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 292, "end_pos": 292, "sequence_org": "E", "sequence_mut": "A", "comment": "Complete loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96FJ0", "url": "https://www.uniprot.org/uniprotkb/Q96FJ0" }, { "database": "PubMed", "id": "18758443", "url": "https://pubmed.ncbi.nlm.nih.gov/18758443" }, { "database": "PubMed", "id": "35114100", "url": "https://pubmed.ncbi.nlm.nih.gov/35114100" } ], "uniprot_canonical_ac": "Q96FJ0-1" }, { "start_pos": 360, "end_pos": 360, "sequence_org": "D", "sequence_mut": "A", "comment": "Complete loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96FJ0", "url": "https://www.uniprot.org/uniprotkb/Q96FJ0" }, { "database": "PubMed", "id": "18758443", "url": "https://pubmed.ncbi.nlm.nih.gov/18758443" }, { "database": "PubMed", "id": "35114100", "url": "https://pubmed.ncbi.nlm.nih.gov/35114100" } ], "uniprot_canonical_ac": "Q96FJ0-1" } ], "record_id": "pubmed.35114100", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the nutrient-sensing hub GATOR2.", "journal": "Nature", "date": "2022-07", "authors": "Valenstein Max L, Rogala Kacper B, Lalgudi Pranav V, Brignole Edward J, Gu Xin, Saxton Robert A, Chantranupong Lynne, Kolibius Jonas, Quast Jan-Philipp, Sabatini David M", "reference": { "type": "PubMed", "id": "35831510", "url": "https://pubmed.ncbi.nlm.nih.gov/35831510" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S15-1", "protein_name": "GATOR2 complex protein WDR24", "gene_name": "WDR24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EE3-2", "protein_name": "Nucleoporin SEH1", "gene_name": "SEH1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXC5-1", "protein_name": "GATOR2 complex protein MIOS", "gene_name": "MIOS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PJI9-1", "protein_name": "GATOR2 complex protein WDR59", "gene_name": "WDR59", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 451, "end_pos": 451, "sequence_org": "M", "sequence_mut": "E", "comment": "Abolished interaction with WDR59 and assembly of the GATOR2 complex; when associated with E-632-633-E.", "evidence": [ { "database": "UniProtKB", "id": "Q96S15", "url": "https://www.uniprot.org/uniprotkb/Q96S15" }, { "database": "PubMed", "id": "35831510", "url": "https://pubmed.ncbi.nlm.nih.gov/35831510" } ], "uniprot_canonical_ac": "Q96S15-1" }, { "start_pos": 632, "end_pos": 633, "sequence_org": "FF", "sequence_mut": "EE", "comment": "Abolished interaction with WDR59 and assembly of the GATOR2 complex; when associated with E-451.", "evidence": [ { "database": "UniProtKB", "id": "Q96S15", "url": "https://www.uniprot.org/uniprotkb/Q96S15" }, { "database": "PubMed", "id": "35831510", "url": "https://pubmed.ncbi.nlm.nih.gov/35831510" } ], "uniprot_canonical_ac": "Q96S15-1" }, { "start_pos": 560, "end_pos": 560, "sequence_org": "A", "sequence_mut": "E", "comment": "Impaired assembly of the GATOR2 complex.", "evidence": [ { "database": "UniProtKB", "id": "Q9NXC5", "url": "https://www.uniprot.org/uniprotkb/Q9NXC5" }, { "database": "PubMed", "id": "35831510", "url": "https://pubmed.ncbi.nlm.nih.gov/35831510" } ], "uniprot_canonical_ac": "Q9NXC5-1" }, { "start_pos": 698, "end_pos": 698, "sequence_org": "L", "sequence_mut": "E", "comment": "Abolished interaction with WDR24 and assembly of the GATOR2 complex; when associated with 728-E--E-732.", "evidence": [ { "database": "UniProtKB", "id": "Q6PJI9", "url": "https://www.uniprot.org/uniprotkb/Q6PJI9" }, { "database": "PubMed", "id": "35831510", "url": "https://pubmed.ncbi.nlm.nih.gov/35831510" } ], "uniprot_canonical_ac": "Q6PJI9-1" }, { "start_pos": 728, "end_pos": 732, "sequence_org": "LLESL", "sequence_mut": "ELESE", "comment": "Abolished interaction with WDR24 and assembly of the GATOR2 complex; when associated with E-698.", "evidence": [ { "database": "UniProtKB", "id": "Q6PJI9", "url": "https://www.uniprot.org/uniprotkb/Q6PJI9" }, { "database": "PubMed", "id": "35831510", "url": "https://pubmed.ncbi.nlm.nih.gov/35831510" } ], "uniprot_canonical_ac": "Q6PJI9-1" } ], "record_id": "pubmed.35831510", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ring domains are essential for GATOR2-dependent mTORC1 activation.", "journal": "Molecular cell", "date": "2023-01-05", "authors": "Jiang Cong, Dai Xiaoming, He Shaohui, Zhou Hongfei, Fang Lan, Guo Jianping, Liu Songlei, Zhang Tao, Pan Weijuan, Yu Haihong, Fu Tianmin, Li Dali, Inuzuka Hiroyuki, Wang Ping, Xiao Jianru, Wei Wenyi", "reference": { "type": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96S15-1", "protein_name": "GATOR2 complex protein WDR24", "gene_name": "WDR24", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WTW4-1", "protein_name": "GATOR1 complex protein NPRL2", "gene_name": "NPRL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96EE3-2", "protein_name": "Nucleoporin SEH1", "gene_name": "SEH1L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55735-1", "protein_name": "Protein SEC13 homolog", "gene_name": "SEC13", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61077-1", "protein_name": "Ubiquitin-conjugating enzyme E2 D3", "gene_name": "UBE2D3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N2K1-1", "protein_name": "Ubiquitin-conjugating enzyme E2 J2", "gene_name": "UBE2J2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXC5-1", "protein_name": "GATOR2 complex protein MIOS", "gene_name": "MIOS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PJI9-1", "protein_name": "GATOR2 complex protein WDR59", "gene_name": "WDR59", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CFJ9-1", "protein_name": "GATOR2 complex protein WDR24", "gene_name": "Wdr24", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 190, "end_pos": 190, "sequence_org": "S", "sequence_mut": "W", "comment": "Loss of interaction with GATOR2. No effect on leucine-binding. Unable to mediate leucine-induced inhibition of the TORC1 signaling pathway.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26449471", "url": "https://pubmed.ncbi.nlm.nih.gov/26449471" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 261, "end_pos": 261, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased leucine-binding. Promotes interaction with RNF167.", "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" }, { "database": "PubMed", "id": "26449471", "url": "https://pubmed.ncbi.nlm.nih.gov/26449471" }, { "database": "PubMed", "id": "35114100", "url": "https://pubmed.ncbi.nlm.nih.gov/35114100" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "P58004-1" }, { "start_pos": 743, "end_pos": 746, "sequence_org": "CAVC", "sequence_mut": "AAVA", "comment": "Impaired amino-acid-mediated mTORC1 activation.", "evidence": [ { "database": "UniProtKB", "id": "Q96S15", "url": "https://www.uniprot.org/uniprotkb/Q96S15" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "Q96S15-1" }, { "start_pos": 158, "end_pos": 158, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased ubiquitination by the GATOR2 complex.", "evidence": [ { "database": "UniProtKB", "id": "Q8WTW4", "url": "https://www.uniprot.org/uniprotkb/Q8WTW4" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "Q8WTW4-1" }, { "start_pos": 328, "end_pos": 328, "sequence_org": "K", "sequence_mut": "R", "comment": "Does not affect ubiquitination by the GATOR2 complex.", "evidence": [ { "database": "UniProtKB", "id": "Q8WTW4", "url": "https://www.uniprot.org/uniprotkb/Q8WTW4" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "Q8WTW4-1" }, { "start_pos": 357, "end_pos": 357, "sequence_org": "K", "sequence_mut": "R", "comment": "Decreased ubiquitination by the GATOR2 complex.", "evidence": [ { "database": "UniProtKB", "id": "Q8WTW4", "url": "https://www.uniprot.org/uniprotkb/Q8WTW4" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "Q8WTW4-1" }, { "start_pos": 785, "end_pos": 788, "sequence_org": "CALC", "sequence_mut": "AALA", "comment": "Impaired amino-acid-mediated mTORC1 activation.", "evidence": [ { "database": "UniProtKB", "id": "Q9NXC5", "url": "https://www.uniprot.org/uniprotkb/Q9NXC5" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "Q9NXC5-1" }, { "start_pos": 924, "end_pos": 927, "sequence_org": "CAIC", "sequence_mut": "AAIA", "comment": "Impaired amino-acid-mediated mTORC1 activation.", "evidence": [ { "database": "UniProtKB", "id": "Q6PJI9", "url": "https://www.uniprot.org/uniprotkb/Q6PJI9" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "Q6PJI9-1" }, { "start_pos": 743, "end_pos": 790, "sequence_org": "CAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCPAGCGHLCEYS", "sequence_mut": "", "comment": "In delta-Ring; knockin mice show embryonic lethality due to impaired mTORC1 activation.", "evidence": [ { "database": "UniProtKB", "id": "Q8CFJ9", "url": "https://www.uniprot.org/uniprotkb/Q8CFJ9" }, { "database": "PubMed", "id": "36528027", "url": "https://pubmed.ncbi.nlm.nih.gov/36528027" } ], "uniprot_canonical_ac": "Q8CFJ9-1" } ], "record_id": "pubmed.36528027", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sestrin2 reduces ferroptosis via the Keap1/Nrf2 signaling pathway after intestinal ischemia-reperfusion.", "journal": "Free radical biology & medicine", "date": "2024-03", "authors": "Zhang Le-le, Ding Ke, Liao Shi-Shi, Zhang Yi-Guo, Liao Hui-Yang, Chen Rong, Meng Qing-Tao", "reference": { "type": "PubMed", "id": "38331008", "url": "https://pubmed.ncbi.nlm.nih.gov/38331008" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38331008", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sestrin 2 protects human lens epithelial cells from oxidative stress and apoptosis induced by hydrogen peroxide by regulating the mTOR/Nrf2 pathway.", "journal": "International journal of immunopathology and pharmacology", "date": "2024", "authors": "Tian Xiao, Wei Jie", "reference": { "type": "PubMed", "id": "38379215", "url": "https://pubmed.ncbi.nlm.nih.gov/38379215" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38379215", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sestrin2 Protects Human Lens Epithelial Cells (HLECs) Against Apoptosis in Cataracts Formation: Interaction Between Endoplasmic Reticulum (ER) Stress and Oxidative Stress (OS) is Involved.", "journal": "Current eye research", "date": "2024-09", "authors": "Sun Di, Cui Hui, Rong Liyuan, Ma Tianju, Li Xuanlong, Ye Zi, Li Zhaohui", "reference": { "type": "PubMed", "id": "38780907", "url": "https://pubmed.ncbi.nlm.nih.gov/38780907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38780907", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA methylation-driven gene FAM3D promotes colorectal cancer growth via the ATF4-SESN2-mTORC1 pathway.", "journal": "Aging", "date": "2024-10-10", "authors": "Zheng Ting, Zhang Ding, Fu Qingzhen, Wang Mingxue, Cheng Zesong, Cao Yukun, Wang Liwan, Liu Jinyin, Zhao Yashuang", "reference": { "type": "PubMed", "id": "39388305", "url": "https://pubmed.ncbi.nlm.nih.gov/39388305" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18848-1", "protein_name": "Cyclic AMP-dependent transcription factor ATF-4", "gene_name": "ATF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BQ1-1", "protein_name": "Protein FAM3D", "gene_name": "FAM3D", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39388305", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SETDB1 targeting SESN2 regulates mitochondrial damage and oxidative stress in renal ischemia-reperfusion injury.", "journal": "BMC biology", "date": "2024-10-23", "authors": "Xia Kang, Hui Yumin, Zhang Long, Qiu Qiangmin, Zhong Jiacheng, Chen Hui, Liu Xiuheng, Wang Lei, Chen Zhiyuan", "reference": { "type": "PubMed", "id": "39443993", "url": "https://pubmed.ncbi.nlm.nih.gov/39443993" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P58004-1", "protein_name": "Sestrin-2", "gene_name": "SESN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15047-1", "protein_name": "Histone-lysine N-methyltransferase SETDB1", "gene_name": "SETDB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P58004", "url": "https://www.uniprot.org/uniprotkb/P58004" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39443993", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of human syndecan-3.", "journal": "Journal of cellular biochemistry", "date": "2001", "authors": "Berndt C, Casaroli-Marano R P, Vilar\u00f3 S, Reina M", "reference": { "type": "PubMed", "id": "11527150", "url": "https://pubmed.ncbi.nlm.nih.gov/11527150" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11527150", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and characterization of a new human UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase, designated pp-GalNAc-T13, that is specifically expressed in neurons and synthesizes GalNAc alpha-serine/threonine antigen.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhang Y, Iwasaki H, Wang H, Kudo T, Kalka TB, Hennet T, Kubota T, Cheng L, Inaba N, Gotoh M, Togayachi A, Guo J, Hisatomi H, Nakajima K, Nishihara S, Nakamura M, Marth JD, Narimatsu H", "reference": { "type": "PubMed", "id": "12407114", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCQ5-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 9", "gene_name": "GALNT9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAX7-1", "protein_name": "Mucin-7", "gene_name": "MUC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC8-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 13", "gene_name": "GALNT13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CF93-1", "protein_name": "Polypeptide N-acetylgalactosaminyltransferase 13", "gene_name": "Galnt13", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 108, "start_aa": "Ser", "end_pos": 108, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser108", "evidence": [ { "id": "O75056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75056#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000100000.00000010000000.00.01000", "uniprot_canonical_ac": "O75056-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 109, "start_aa": "Thr", "end_pos": 109, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr109", "evidence": [ { "id": "O75056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75056#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "O75056-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 110, "start_aa": "Thr", "end_pos": 110, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr110", "evidence": [ { "id": "O75056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75056#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "O75056-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 160, "start_aa": "Ser", "end_pos": 160, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser160", "evidence": [ { "id": "O75056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75056#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "O75056-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 161, "start_aa": "Thr", "end_pos": 161, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr161", "evidence": [ { "id": "O75056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75056#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "O75056-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 162, "start_aa": "Thr", "end_pos": 162, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr162", "evidence": [ { "id": "O75056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75056#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "O75056-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 169, "start_aa": "Thr", "end_pos": 169, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr169", "evidence": [ { "id": "O75056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75056#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "O75056-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 170, "start_aa": "Ser", "end_pos": 170, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser170", "evidence": [ { "id": "O75056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75056#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000100000.00000010000000.00.01000", "uniprot_canonical_ac": "O75056-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 171, "start_aa": "Thr", "end_pos": 171, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr171", "evidence": [ { "id": "O75056", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O75056#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000010000.00000010000000.00.01000", "uniprot_canonical_ac": "O75056-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 176, "start_aa": "Thr", "end_pos": 176, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr176", "evidence": [ { "id": "Q8TAX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8TAX7#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "Q8TAX7-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 182, "start_aa": "Ser", "end_pos": 182, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser182", "evidence": [ { "id": "Q8TAX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8TAX7#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "Q8TAX7-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (GalNAc) serine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 183, "start_aa": "Ser", "end_pos": 183, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser183", "evidence": [ { "id": "Q8TAX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8TAX7#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000100000.00000010000000.00.01001", "uniprot_canonical_ac": "Q8TAX7-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 188, "start_aa": "Thr", "end_pos": 188, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr188", "evidence": [ { "id": "Q8TAX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8TAX7#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "Q8TAX7-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 189, "start_aa": "Thr", "end_pos": 189, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr189", "evidence": [ { "id": "Q8TAX7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q8TAX7#ptm_processing" }, { "id": "12407114", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/12407114" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "Q8TAX7-1" } ], "record_id": "pubmed.12407114", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 14 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 14 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 14 }, { "field": "exact_o_linked_sites", "count": 14 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 14 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 14 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 14 }, { "field": "exact_o_linked_sites", "count": 14 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Positive association of obesity with single nucleotide polymorphisms of syndecan 3 in the Korean population.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2006-12", "authors": "Ha Eunyoung, Kim Mi-Ja, Choi Bong-Keun, Rho Jung-Jae, Oh Dong-Jae, Rho Tae-Hoon, Kim Kyu-Hyun, Lee Hee Jae, Shin Dong-Hoon, Yim Sung Vin, Baik Hyung Hwan, Chung Joo-Ho, Kim Jong Woo", "reference": { "type": "PubMed", "id": "17018662", "url": "https://pubmed.ncbi.nlm.nih.gov/17018662" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "O75056", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O75056" }, { "id": "rs2491132", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2491132" }, { "id": "rs2491132", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2491132" }, { "id": "rs2491132", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2491132" }, { "id": "rs2491132", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2491132#frequency_tab" }, { "id": "rs2491132", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2491132" }, { "id": "17018662", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17018662" }, { "id": "rs2491132", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2491132" } ], "glycoeffect": [], "start_pos": 208, "end_pos": 208, "subjects_tested": "4799", "subjects_positive": "2", "frequency": "0.0", "sequence_org": "V", "sequence_mut": "I", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, gag-related).", "chr_id": "1", "chr_pos": "30876800", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "V208", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ], "unlinked_id_list": [ "DOID:4765" ], "evidence": [ { "id": "1324", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:1324" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "000000000000000000010.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "O75056-1" }, { "evidence": [ { "id": "O75056", "database": "BioMuta", "url": "https://hivelab.biochemistry.gwu.edu/biomuta/proteinview/O75056" }, { "id": "rs2282440", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2282440" }, { "id": "rs2282440", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2282440" }, { "id": "rs2282440", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2282440" }, { "id": "rs2282440", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs2282440#frequency_tab" }, { "id": "rs2282440", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs2282440" }, { "id": "17018662", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17018662" }, { "id": "rs2282440", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs2282440" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 329, "end_pos": 329, "subjects_tested": "3601", "subjects_positive": "1", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 filters: protein-of-interest(glycogene, gag-related).", "chr_id": "1", "chr_pos": "30874473", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T329", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ], "unlinked_id_list": [], "evidence": [ { "id": "9256", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:9256" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ], "unlinked_id_list": [ "DOID:0081452", "DOID:706", "DOID:1039", "DOID:5604", "DOID:6536", "DOID:0080638", "DOID:7757", "DOID:0050743", "DOID:4960", "DOID:8527", "DOID:1036", "DOID:5772" ], "evidence": [ { "id": "2531", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:2531" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ], "filter_code": "000000000000000010000.00000000000000.000000000001000000.00001.11.000.001", "uniprot_canonical_ac": "O75056-1" } ], "record_id": "pubmed.17018662", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.", "journal": "Structure", "date": "2013", "authors": "Liu X, Shepherd TR, Murray AM, Xu Z, Fuentes EJ", "reference": { "type": "PubMed", "id": "23395182", "url": "https://pubmed.ncbi.nlm.nih.gov/23395182" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13009-1", "protein_name": "Rho guanine nucleotide exchange factor TIAM1", "gene_name": "TIAM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9C0A0-1", "protein_name": "Contactin-associated protein-like 4", "gene_name": "CNTNAP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P18827-1", "protein_name": "Syndecan-1", "gene_name": "SDC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 879, "end_pos": 879, "sequence_org": "K", "sequence_mut": "E", "comment": "Strongly reduces affinity for SDC1.", "evidence": [ { "database": "UniProtKB", "id": "Q13009", "url": "https://www.uniprot.org/uniprotkb/Q13009" }, { "database": "PubMed", "id": "23395182", "url": "https://pubmed.ncbi.nlm.nih.gov/23395182" } ], "uniprot_canonical_ac": "Q13009-1" }, { "start_pos": 912, "end_pos": 912, "sequence_org": "K", "sequence_mut": "E", "comment": "Strongly reduces affinity for SDC1.", "evidence": [ { "database": "UniProtKB", "id": "Q13009", "url": "https://www.uniprot.org/uniprotkb/Q13009" }, { "database": "PubMed", "id": "23395182", "url": "https://pubmed.ncbi.nlm.nih.gov/23395182" } ], "uniprot_canonical_ac": "Q13009-1" } ], "record_id": "pubmed.23395182", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Interplay of Apoes with Syndecans in Influencing Key Cellular Events of Amyloid Pathology.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Hudak A, Josvay K, Domonkos I, Letoha A, Szilak L, Letoha T", "reference": { "type": "PubMed", "id": "34209175", "url": "https://pubmed.ncbi.nlm.nih.gov/34209175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34209175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Syndecan Family Gene and Protein Expression and Their Prognostic Values for Prostate Cancer.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Santos NJ, Barquilha CN, Barbosa IC, Macedo RT, Lima FO, Justulin LA, Barbosa GO, Carvalho HF, Felisbino SL", "reference": { "type": "PubMed", "id": "34445387", "url": "https://pubmed.ncbi.nlm.nih.gov/34445387" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34445387", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Cell Surface Heparan Sulfate Proteoglycan Syndecan-3 Promotes Ovarian Cancer Pathogenesis.", "journal": "International journal of molecular sciences", "date": "2022", "authors": "Hillemeyer L, Espinoza-Sanchez NA, Greve B, Hassan N, Chelariu-Raicu A, Kiesel L, Gotte M", "reference": { "type": "PubMed", "id": "35628603", "url": "https://pubmed.ncbi.nlm.nih.gov/35628603" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35628603", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A genome-wide association study identifies a novel association between SDC3 and apparent treatment-resistant hypertension.", "journal": "BMC medicine", "date": "2022-11-30", "authors": "Xiao Xiao, Li Rui, Wu Cunjin, Yan Yupeng, Yuan Mengmeng, Cui Bing, Zhang Yu, Zhang Channa, Zhang Xiaoxia, Zhang Weili, Hui Rutai, Wang Yibo", "reference": { "type": "PubMed", "id": "36447229", "url": "https://pubmed.ncbi.nlm.nih.gov/36447229" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36447229", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of recombinant N-syndecan (syndecan 3) core protein.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Asundi VK, Carey DJ", "reference": { "type": "PubMed", "id": "9388509", "url": "https://pubmed.ncbi.nlm.nih.gov/9388509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75056-1", "protein_name": "Syndecan-3", "gene_name": "SDC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "P54760-1", "kinase_gene_name": "EPHB4", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75056", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75056" }, { "database": "PubMed", "id": "9388509", "url": "https://pubmed.ncbi.nlm.nih.gov/9388509" } ], "site_lbl": "Tyr409", "uniprot_canonical_ac": "O75056-1" }, { "start_pos": 409, "end_pos": 409, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" }, { "database": "PubMed", "id": "9388509", "url": "https://pubmed.ncbi.nlm.nih.gov/9388509" }, { "database": "iPTMnet", "id": "O75056", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75056" } ], "site_lbl": "Tyr409", "uniprot_canonical_ac": "O75056-1" }, { "start_pos": 419, "end_pos": 419, "kinase_uniprot_canonical_ac": "P54760-1", "kinase_gene_name": "EPHB4", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75056", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75056" }, { "database": "PubMed", "id": "9388509", "url": "https://pubmed.ncbi.nlm.nih.gov/9388509" } ], "site_lbl": "Tyr419", "uniprot_canonical_ac": "O75056-1" }, { "start_pos": 419, "end_pos": 419, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" }, { "database": "PubMed", "id": "9388509", "url": "https://pubmed.ncbi.nlm.nih.gov/9388509" }, { "database": "iPTMnet", "id": "O75056", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75056" } ], "site_lbl": "Tyr419", "uniprot_canonical_ac": "O75056-1" }, { "start_pos": 431, "end_pos": 431, "kinase_uniprot_canonical_ac": "P54760-1", "kinase_gene_name": "EPHB4", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75056", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75056" }, { "database": "PubMed", "id": "9388509", "url": "https://pubmed.ncbi.nlm.nih.gov/9388509" } ], "site_lbl": "Tyr431", "uniprot_canonical_ac": "O75056-1" }, { "start_pos": 431, "end_pos": 431, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" }, { "database": "PubMed", "id": "9388509", "url": "https://pubmed.ncbi.nlm.nih.gov/9388509" }, { "database": "iPTMnet", "id": "O75056", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75056" } ], "site_lbl": "Tyr431", "uniprot_canonical_ac": "O75056-1" }, { "start_pos": 441, "end_pos": 441, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O75056", "url": "https://www.uniprot.org/uniprotkb/O75056" }, { "database": "PubMed", "id": "9388509", "url": "https://pubmed.ncbi.nlm.nih.gov/9388509" }, { "database": "iPTMnet", "id": "O75056", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75056" } ], "site_lbl": "Tyr441", "uniprot_canonical_ac": "O75056-1" } ], "record_id": "pubmed.9388509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nuclear transition protein 1 from ram elongating spermatids. Mass spectrometric characterization, primary structure and phosphorylation sites of two variants.", "journal": "European journal of biochemistry", "date": "1991", "authors": "Chirat F, Martinage A, Briand G, Kouach M, Van Dorsselaer A, Loir M, Sautiere P", "reference": { "type": "PubMed", "id": "2040274", "url": "https://pubmed.ncbi.nlm.nih.gov/2040274" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09430-1", "protein_name": "Spermatid nuclear transition protein 1", "gene_name": "TNP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09430", "url": "https://www.uniprot.org/uniprotkb/P09430" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 9, "end_pos": 9, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09430", "url": "https://www.uniprot.org/uniprotkb/P09430" }, { "database": "iPTMnet", "id": "P09430", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09430" }, { "database": "PubMed", "id": "2040274", "url": "https://pubmed.ncbi.nlm.nih.gov/2040274" } ], "site_lbl": "Ser9", "uniprot_canonical_ac": "P09430-1" } ], "record_id": "pubmed.2040274", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequence of the gene for human transition protein 1 and its chromosomal localization on chromosome 2.", "journal": "Genomics", "date": "1990", "authors": "Luerssen H, Mattei MG, Schroter M, Grzeschik KH, Adham IM, Engel W", "reference": { "type": "PubMed", "id": "2249851", "url": "https://pubmed.ncbi.nlm.nih.gov/2249851" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09430-1", "protein_name": "Spermatid nuclear transition protein 1", "gene_name": "TNP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09430", "url": "https://www.uniprot.org/uniprotkb/P09430" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2249851", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel Autoantigens Associated with Lupus Nephritis.", "journal": "PloS one", "date": "2015", "authors": "Onishi S, Adnan E, Ishizaki J, Miyazaki T, Tanaka Y, Matsumoto T, Suemori K, Shudou M, Okura T, Takeda H, Sawasaki T, Yasukawa M, Hasegawa H", "reference": { "type": "PubMed", "id": "26098692", "url": "https://pubmed.ncbi.nlm.nih.gov/26098692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09430-1", "protein_name": "Spermatid nuclear transition protein 1", "gene_name": "TNP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09430", "url": "https://www.uniprot.org/uniprotkb/P09430" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26098692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tobacco smoking and its impact on the expression level of sperm nuclear protein genes: H2BFWT, TNP1, TNP2, PRM1 and PRM2.", "journal": "Andrologia", "date": "2021", "authors": "Amor H, Zeyad A, Hammadeh ME", "reference": { "type": "PubMed", "id": "33440036", "url": "https://pubmed.ncbi.nlm.nih.gov/33440036" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09430-1", "protein_name": "Spermatid nuclear transition protein 1", "gene_name": "TNP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z2G1-2", "protein_name": "Histone H2B type W-T", "gene_name": "H2BW1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04554-1", "protein_name": "Protamine-2", "gene_name": "PRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05952-1", "protein_name": "Nuclear transition protein 2", "gene_name": "TNP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09430", "url": "https://www.uniprot.org/uniprotkb/P09430" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33440036", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The nucleotide sequence of human transition protein 1 cDNA.", "journal": "Nucleic Acids Res.", "date": "1988", "authors": "Luerssen H, Hoyer-Fender S, Engel W", "reference": { "type": "PubMed", "id": "3412903", "url": "https://pubmed.ncbi.nlm.nih.gov/3412903" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09430-1", "protein_name": "Spermatid nuclear transition protein 1", "gene_name": "TNP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09430", "url": "https://www.uniprot.org/uniprotkb/P09430" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3412903", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The amino acid sequence and phosphorylation sites of a boar transition protein 1.", "journal": "Biochemistry and molecular biology international", "date": "1994", "authors": "Akama K, Kojima S, Nakano M, Tobita T, Hayashi H", "reference": { "type": "PubMed", "id": "8019440", "url": "https://pubmed.ncbi.nlm.nih.gov/8019440" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09430-1", "protein_name": "Spermatid nuclear transition protein 1", "gene_name": "TNP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17306-1", "protein_name": "Spermatid nuclear transition protein 1", "gene_name": "TNP1", "tax_name": "Pig" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09430", "url": "https://www.uniprot.org/uniprotkb/P09430" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 40, "end_pos": 40, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P09430", "url": "https://www.uniprot.org/uniprotkb/P09430" }, { "database": "iPTMnet", "id": "P09430", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P09430" }, { "database": "PubMed", "id": "8019440", "url": "https://pubmed.ncbi.nlm.nih.gov/8019440" } ], "site_lbl": "Ser40", "uniprot_canonical_ac": "P09430-1" } ], "record_id": "pubmed.8019440", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of mRNA and protein of nucleoproteins during human spermiogenesis.", "journal": "Mol. Hum. Reprod.", "date": "1998", "authors": "Steger K, Klonisch T, Gavenis K, Drabent B, Doenecke D, Bergmann M", "reference": { "type": "PubMed", "id": "9809674", "url": "https://pubmed.ncbi.nlm.nih.gov/9809674" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09430-1", "protein_name": "Spermatid nuclear transition protein 1", "gene_name": "TNP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q05952-1", "protein_name": "Nuclear transition protein 2", "gene_name": "TNP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09430", "url": "https://www.uniprot.org/uniprotkb/P09430" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9809674", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Synergistic activations of REG I alpha and REG I beta promoters by IL-6 and Glucocorticoids through JAK/STAT pathway in human pancreatic beta cells.", "journal": "Journal of diabetes research", "date": "2015", "authors": "Yamauchi A, Itaya-Hironaka A, Sakuramoto-Tsuchida S, Takeda M, Yoshimoto K, Miyaoka T, Fujimura T, Tsujinaka H, Tsuchida C, Ota H, Takasawa S", "reference": { "type": "PubMed", "id": "25767811", "url": "https://pubmed.ncbi.nlm.nih.gov/25767811" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48304-1", "protein_name": "Lithostathine-1-beta", "gene_name": "REG1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48304", "url": "https://www.uniprot.org/uniprotkb/P48304" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25767811", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prognostic role of regenerating gene-I in patients with stage-IV head and neck squamous cell carcinoma.", "journal": "Diagnostic pathology", "date": "2016", "authors": "Aboshanif M, Kawasaki Y, Omori Y, Suzuki S, Honda K, Motoyama S, Ishikawa K", "reference": { "type": "PubMed", "id": "27539087", "url": "https://pubmed.ncbi.nlm.nih.gov/27539087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48304-1", "protein_name": "Lithostathine-1-beta", "gene_name": "REG1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48304", "url": "https://www.uniprot.org/uniprotkb/P48304" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27539087", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Faecal regenerating 1B protein concentration is not associated with child growth in rural Malawi.", "journal": "Journal of paediatrics and child health", "date": "2021", "authors": "Liu Z, Fan YM, Ashorn P, Cheung YB, Hallamaa L, Hyoty H, Maleta K, Lehto KM, Oikarinen S, Parkkila S, Ashorn U", "reference": { "type": "PubMed", "id": "33112481", "url": "https://pubmed.ncbi.nlm.nih.gov/33112481" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48304-1", "protein_name": "Lithostathine-1-beta", "gene_name": "REG1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48304", "url": "https://www.uniprot.org/uniprotkb/P48304" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33112481", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The glycan moiety of human pancreatic lithostathine. Structure characterization and possible pathophysiological implications.", "journal": "European journal of biochemistry", "date": "1995", "authors": "De Reggi M, Capon C, Gharib B, Wieruszeski JM, Michel R, Fournet B", "reference": { "type": "PubMed", "id": "7607222", "url": "https://pubmed.ncbi.nlm.nih.gov/7607222" }, "referenced_glycans": [ { "glytoucan_ac": "G08046LM" }, { "glytoucan_ac": "G08140FC" }, { "glytoucan_ac": "G60234BX" }, { "glytoucan_ac": "G06341YK" }, { "glytoucan_ac": "G84906ML" }, { "glytoucan_ac": "G86083AM" }, { "glytoucan_ac": "G32216IU" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P48304-1", "protein_name": "Lithostathine-1-beta", "gene_name": "REG1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48304", "url": "https://www.uniprot.org/uniprotkb/P48304" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GalNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GalNAc...) threonine;O-GalNAcylation", "icn3d_view": {}, "start_pos": 27, "start_aa": "Thr", "end_pos": 27, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr27", "evidence": [ { "id": "P48304", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P48304#ptm_processing" }, { "id": "7607222", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/7607222" } ], "filter_code": "000000000000000010000.00000010000000.00.01001", "uniprot_canonical_ac": "P48304-1" } ], "record_id": "pubmed.7607222", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation, structural determination and expression of a novel reg gene, human regI beta.", "journal": "Biochim. Biophys. Acta", "date": "1994", "authors": "Moriizumi S, Watanabe T, Unno M, Nakagawara K, Suzuki Y, Miyashita H, Yonekura H, Okamoto H", "reference": { "type": "PubMed", "id": "8110835", "url": "https://pubmed.ncbi.nlm.nih.gov/8110835" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48304-1", "protein_name": "Lithostathine-1-beta", "gene_name": "REG1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48304", "url": "https://www.uniprot.org/uniprotkb/P48304" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8110835", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A gene homologous to the reg gene is expressed in the human pancreas.", "journal": "FEBS Lett.", "date": "1993", "authors": "Bartoli C, Gharib B, Giorgi D, Sansonetti A, Dagorn J C, Berg\u00e9-Lefranc J L", "reference": { "type": "PubMed", "id": "8348956", "url": "https://pubmed.ncbi.nlm.nih.gov/8348956" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48304-1", "protein_name": "Lithostathine-1-beta", "gene_name": "REG1B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48304", "url": "https://www.uniprot.org/uniprotkb/P48304" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8348956", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Solution structure of human GAIP (Galpha interacting protein): a regulator of G protein signaling.", "journal": "J. Mol. Biol.", "date": "1999", "authors": "de Alba E, De Vries L, Farquhar M G, Tjandra N", "reference": { "type": "PubMed", "id": "10452897", "url": "https://pubmed.ncbi.nlm.nih.gov/10452897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49795-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "RGS19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10452897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Membrane-associated GAIP is a phosphoprotein and can be phosphorylated by clathrin-coated vesicles.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Fischer T, Elenko E, Wan L, Thomas G, Farquhar MG", "reference": { "type": "PubMed", "id": "10760275", "url": "https://pubmed.ncbi.nlm.nih.gov/10760275" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49795-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "RGS19", "tax_name": "Human" }, { "uniprot_canonical_ac": "O70521-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "Rgs19", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "10760275", "url": "https://pubmed.ncbi.nlm.nih.gov/10760275" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P49795-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "P19784-1", "kinase_gene_name": "CSNK2A2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "10760275", "url": "https://pubmed.ncbi.nlm.nih.gov/10760275" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P49795-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "10760275", "url": "https://pubmed.ncbi.nlm.nih.gov/10760275" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P49795-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CK2", "evidence": [ { "database": "UniProtKB", "id": "O70521", "url": "https://www.uniprot.org/uniprotkb/O70521" }, { "database": "iPTMnet", "id": "O70521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O70521" }, { "database": "PubMed", "id": "10760275", "url": "https://pubmed.ncbi.nlm.nih.gov/10760275" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "O70521-1" } ], "mutagenesis": [ { "start_pos": 24, "end_pos": 24, "sequence_org": "S", "sequence_mut": "A", "comment": "50% reduction of phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O70521", "url": "https://www.uniprot.org/uniprotkb/O70521" }, { "database": "PubMed", "id": "10760275", "url": "https://pubmed.ncbi.nlm.nih.gov/10760275" } ], "uniprot_canonical_ac": "O70521-1" } ], "record_id": "pubmed.10760275", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Erk1/2-dependent phosphorylation of Galpha-interacting protein stimulates its GTPase accelerating activity and autophagy in human colon cancer cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ogier-Denis E, Pattingre S, El Benna J, Codogno P", "reference": { "type": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49795-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "RGS19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 151, "end_pos": 151, "sequence_org": "S", "sequence_mut": "A", "comment": "Diminishes gap activity towards G(i)-alpha3 and autophagy in colon cancer cells.", "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "uniprot_canonical_ac": "P49795-1" } ], "phosphorylation": [ { "start_pos": 151, "end_pos": 151, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" }, { "database": "PubMed", "id": "15488168", "url": "https://pubmed.ncbi.nlm.nih.gov/15488168" } ], "site_lbl": "Ser151", "uniprot_canonical_ac": "P49795-1" }, { "start_pos": 151, "end_pos": 151, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1 and MAPK3", "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" }, { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "15488168", "url": "https://pubmed.ncbi.nlm.nih.gov/15488168" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "site_lbl": "Ser151", "uniprot_canonical_ac": "P49795-1" }, { "start_pos": 201, "end_pos": 201, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "site_lbl": "Thr201", "uniprot_canonical_ac": "P49795-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "10760275", "url": "https://pubmed.ncbi.nlm.nih.gov/10760275" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P49795-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "P19784-1", "kinase_gene_name": "CSNK2A2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "10760275", "url": "https://pubmed.ncbi.nlm.nih.gov/10760275" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P49795-1" }, { "start_pos": 24, "end_pos": 24, "kinase_uniprot_canonical_ac": "P68400-1", "kinase_gene_name": "CSNK2A1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "10760275", "url": "https://pubmed.ncbi.nlm.nih.gov/10760275" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "site_lbl": "Ser24", "uniprot_canonical_ac": "P49795-1" } ], "record_id": "pubmed.10993892", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analyses of Galpha-interacting protein and activator of G-protein-signaling-3 functions in macroautophagy.", "journal": "Methods in enzymology", "date": "2004", "authors": "Pattingre S, Petiot A, Codogno P", "reference": { "type": "PubMed", "id": "15488168", "url": "https://pubmed.ncbi.nlm.nih.gov/15488168" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49795-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "RGS19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 151, "end_pos": 151, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" }, { "database": "PubMed", "id": "15488168", "url": "https://pubmed.ncbi.nlm.nih.gov/15488168" } ], "site_lbl": "Ser151", "uniprot_canonical_ac": "P49795-1" }, { "start_pos": 151, "end_pos": 151, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK1 and MAPK3", "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" }, { "database": "iPTMnet", "id": "P49795", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49795" }, { "database": "PubMed", "id": "15488168", "url": "https://pubmed.ncbi.nlm.nih.gov/15488168" }, { "database": "PubMed", "id": "10993892", "url": "https://pubmed.ncbi.nlm.nih.gov/10993892" } ], "site_lbl": "Ser151", "uniprot_canonical_ac": "P49795-1" } ], "record_id": "pubmed.15488168", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RGS19 converts iron deprivation stress into a growth-inhibitory signal.", "journal": "Biochemical and biophysical research communications", "date": "2015", "authors": "Hwang J, Kim HS, Kang BS, Kim DH, Ryoo ZY, Choi SU, Lee S", "reference": { "type": "PubMed", "id": "26116529", "url": "https://pubmed.ncbi.nlm.nih.gov/26116529" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49795-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "RGS19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26116529", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genome-wide screening for the G-protein-coupled receptor (GPCR) pathway-related therapeutic gene RGS19 (regulator of G protein signaling 19) in bladder cancer.", "journal": "Bioengineered", "date": "2021", "authors": "Liu Y, Lou W, Chen G, Ding B, Kuang J, Zhang Y, Wang C, Duan S, Deng Y, Lu X", "reference": { "type": "PubMed", "id": "34482807", "url": "https://pubmed.ncbi.nlm.nih.gov/34482807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49795-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "RGS19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34482807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RGS19 activates the MYH9/\u03b2-catenin/c-Myc positive feedback loop in hepatocellular carcinoma.", "journal": "Experimental & molecular medicine", "date": "2024-06", "authors": "Ke Shanjia, Lu Shounan, Xu Yanan, Bai Miaoyu, Yu Hongjun, Yin Bing, Wang Chaoqun, Feng Zhigang, Li Zihao, Huang Jingjing, Li Xinglong, Qian Baolin, Hua Yongliang, Fu Yao, Sun Bei, Wu Yaohua, Ma Yong", "reference": { "type": "PubMed", "id": "38825640", "url": "https://pubmed.ncbi.nlm.nih.gov/38825640" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49795-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "RGS19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38825640", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GAIP, a protein that specifically interacts with the trimeric G protein G alpha i3, is a member of a protein family with a highly conserved core domain.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1995", "authors": "De Vries L, Mousli M, Wurmser A, Farquhar M G", "reference": { "type": "PubMed", "id": "8524874", "url": "https://pubmed.ncbi.nlm.nih.gov/8524874" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49795-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "RGS19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8524874", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GAIP is membrane-anchored by palmitoylation and interacts with the activated (GTP-bound) form of G alpha i subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "De Vries L, Elenko E, Hubler L, Jones TL, Farquhar MG", "reference": { "type": "PubMed", "id": "8986788", "url": "https://pubmed.ncbi.nlm.nih.gov/8986788" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49795-1", "protein_name": "Regulator of G protein signaling 19", "gene_name": "RGS19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49795", "url": "https://www.uniprot.org/uniprotkb/P49795" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8986788", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction between RGS7 and polycystin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Kim E, Arnould T, Sellin L, Benzing T, Comella N, Kocher O, Tsiokas L, Sukhatme VP, Walz G", "reference": { "type": "PubMed", "id": "10339594", "url": "https://pubmed.ncbi.nlm.nih.gov/10339594" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98161-1", "protein_name": "Polycystin-1", "gene_name": "PKD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10339594", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulators of G protein signaling 6 and 7. Purification of complexes with gbeta5 and assessment of their effects on g protein-mediated signaling pathways.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Posner BA, Gilman AG, Harris BA", "reference": { "type": "PubMed", "id": "10521509", "url": "https://pubmed.ncbi.nlm.nih.gov/10521509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49758-4", "protein_name": "Regulator of G protein signaling 6", "gene_name": "RGS6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10521509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "14-3-3 interacts with regulator of G protein signaling proteins and modulates their activity.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Benzing T, Yaffe MB, Arnould T, Sellin L, Schermer B, Schilling B, Schreiber R, Kunzelmann K, Leparc GG, Kim E, Walz G", "reference": { "type": "PubMed", "id": "10862767", "url": "https://pubmed.ncbi.nlm.nih.gov/10862767" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O54829-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "Rgs7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P27348-1", "protein_name": "14-3-3 protein theta", "gene_name": "YWHAQ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 434, "end_pos": 434, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" }, { "database": "PubMed", "id": "10862767", "url": "https://pubmed.ncbi.nlm.nih.gov/10862767" }, { "database": "iPTMnet", "id": "P49802", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49802" } ], "site_lbl": "Ser434", "uniprot_canonical_ac": "P49802-1" } ], "record_id": "pubmed.10862767", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Snapin interacts with the N-terminus of regulator of G protein signaling 7.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Hunt RA, Edris W, Chanda PK, Nieuwenhuijsen B, Young KH", "reference": { "type": "PubMed", "id": "12659861", "url": "https://pubmed.ncbi.nlm.nih.gov/12659861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95295-1", "protein_name": "SNARE-associated protein Snapin", "gene_name": "SNAPIN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12659861", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Palmitoylation regulates plasma membrane-nuclear shuttling of R7BP, a novel membrane anchor for the RGS7 family.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Drenan RM, Doupnik CA, Boyle MP, Muglia LJ, Huettner JE, Linder ME, Blumer KJ", "reference": { "type": "PubMed", "id": "15897264", "url": "https://pubmed.ncbi.nlm.nih.gov/15897264" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O54828-1", "protein_name": "Regulator of G protein signaling 9", "gene_name": "Rgs9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Z2H1-1", "protein_name": "Regulator of G protein signaling 11", "gene_name": "Rgs11", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BQP9-1", "protein_name": "Regulator of G protein signaling 7-binding protein", "gene_name": "Rgs7bp", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O54829-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "Rgs7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Z2H2-1", "protein_name": "Regulator of G protein signaling 6", "gene_name": "Rgs6", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 252, "end_pos": 252, "sequence_org": "C", "sequence_mut": "S", "comment": "Strongly reduces palmitoylation and its ability to regulate GPCR signaling. Abolishes palmitoylation and its ability to regulate GPCR signaling; when associated with S-253.", "evidence": [ { "database": "UniProtKB", "id": "Q8BQP9", "url": "https://www.uniprot.org/uniprotkb/Q8BQP9" }, { "database": "PubMed", "id": "15897264", "url": "https://pubmed.ncbi.nlm.nih.gov/15897264" } ], "uniprot_canonical_ac": "Q8BQP9-1" }, { "start_pos": 253, "end_pos": 253, "sequence_org": "C", "sequence_mut": "S", "comment": "Strongly reduces palmitoylation and its ability to regulate GPCR signaling. Abolishes palmitoylation and its ability to regulate GPCR signaling; when associated with S-252.", "evidence": [ { "database": "UniProtKB", "id": "Q8BQP9", "url": "https://www.uniprot.org/uniprotkb/Q8BQP9" }, { "database": "PubMed", "id": "15897264", "url": "https://pubmed.ncbi.nlm.nih.gov/15897264" } ], "uniprot_canonical_ac": "Q8BQP9-1" } ], "record_id": "pubmed.15897264", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nonclassical Ligand-Independent Regulation of Go Protein by an Orphan Class C G-Protein-Coupled Receptor.", "journal": "Molecular pharmacology", "date": "2019", "authors": "Hajj M, De Vita T, Vol C, Renassia C, Bologna JC, Brabet I, Cazade M, Pastore M, Blahos J, Labesse G, Pin JP, Prezeau L", "reference": { "type": "PubMed", "id": "31189666", "url": "https://pubmed.ncbi.nlm.nih.gov/31189666" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T848-1", "protein_name": "Metabotropic glycine receptor", "gene_name": "GPR158", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1007, "end_pos": 1009, "sequence_org": "CPW", "sequence_mut": "AAA", "comment": "In Mut1; decreased interaction with GNAO1.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "31189666", "url": "https://pubmed.ncbi.nlm.nih.gov/31189666" } ], "uniprot_canonical_ac": "Q5T848-1" }, { "start_pos": 1072, "end_pos": 1074, "sequence_org": "CLW", "sequence_mut": "AAA", "comment": "In Mut2; does not affect interaction with GNAO1.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "31189666", "url": "https://pubmed.ncbi.nlm.nih.gov/31189666" } ], "uniprot_canonical_ac": "Q5T848-1" }, { "start_pos": 1172, "end_pos": 1174, "sequence_org": "CPW", "sequence_mut": "AAA", "comment": "In Mut3; decreased interaction with GNAO1.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "31189666", "url": "https://pubmed.ncbi.nlm.nih.gov/31189666" } ], "uniprot_canonical_ac": "Q5T848-1" }, { "start_pos": 1172, "end_pos": 1174, "sequence_org": "CPW", "sequence_mut": "AAA", "comment": "In Mut4; does not affect interaction with GNAO1.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "31189666", "url": "https://pubmed.ncbi.nlm.nih.gov/31189666" } ], "uniprot_canonical_ac": "Q5T848-1" }, { "start_pos": 502, "end_pos": 502, "sequence_org": "K", "sequence_mut": "E", "comment": "Does not affect G protein alpha subunit activation.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "31189666", "url": "https://pubmed.ncbi.nlm.nih.gov/31189666" } ], "uniprot_canonical_ac": "Q5T848-1" }, { "start_pos": 505, "end_pos": 505, "sequence_org": "R", "sequence_mut": "E", "comment": "Does not affect G protein alpha subunit activation.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "31189666", "url": "https://pubmed.ncbi.nlm.nih.gov/31189666" } ], "uniprot_canonical_ac": "Q5T848-1" } ], "record_id": "pubmed.31189666", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cryo-EM structure of human GPR158 receptor coupled to the RGS7-Gbeta5 signaling complex.", "journal": "Science", "date": "2022", "authors": "Patil DN, Singh S, Laboute T, Strutzenberg TS, Qiu X, Wu D, Novick SJ, Robinson CV, Griffin PR, Hunt JF, Izard T, Singh AK, Martemyanov KA", "reference": { "type": "PubMed", "id": "34793198", "url": "https://pubmed.ncbi.nlm.nih.gov/34793198" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62881-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "Gnb5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q5T848-1", "protein_name": "Metabotropic glycine receptor", "gene_name": "GPR158", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34793198", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the class C orphan GPCR GPR158 in complex with RGS7-Gbeta5.", "journal": "Nat. Commun.", "date": "2021", "authors": "Jeong E, Kim Y, Jeong J, Cho Y", "reference": { "type": "PubMed", "id": "34815401", "url": "https://pubmed.ncbi.nlm.nih.gov/34815401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5T848-1", "protein_name": "Metabotropic glycine receptor", "gene_name": "GPR158", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14775-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-5", "gene_name": "GNB5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 135, "end_pos": 135, "sequence_org": "F", "sequence_mut": "A", "comment": "Does not affect ability to regulate cAMP levels; when associated with A-540 and A-578.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "34815401", "url": "https://pubmed.ncbi.nlm.nih.gov/34815401" } ], "uniprot_canonical_ac": "Q5T848-1" }, { "start_pos": 540, "end_pos": 540, "sequence_org": "F", "sequence_mut": "A", "comment": "Does not affect ability to regulate cAMP levels; when associated with A-135 and A-578.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "34815401", "url": "https://pubmed.ncbi.nlm.nih.gov/34815401" } ], "uniprot_canonical_ac": "Q5T848-1" }, { "start_pos": 578, "end_pos": 578, "sequence_org": "W", "sequence_mut": "A", "comment": "Does not affect ability to regulate cAMP levels; when associated with A-135 and A-540.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "34815401", "url": "https://pubmed.ncbi.nlm.nih.gov/34815401" } ], "uniprot_canonical_ac": "Q5T848-1" }, { "start_pos": 609, "end_pos": 609, "sequence_org": "E", "sequence_mut": "H", "comment": "Induces an increase of cAMP levels.", "evidence": [ { "database": "UniProtKB", "id": "Q5T848", "url": "https://www.uniprot.org/uniprotkb/Q5T848" }, { "database": "PubMed", "id": "34815401", "url": "https://pubmed.ncbi.nlm.nih.gov/34815401" } ], "uniprot_canonical_ac": "Q5T848-1" } ], "record_id": "pubmed.34815401", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A RGS7-CaMKII complex drives myocyte-intrinsic and myocyte-extrinsic mechanisms of chemotherapy-induced cardiotoxicity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2023-01-03", "authors": "Basak Madhuri, Sengar Abhishek Singh, Das Kiran, Mahata Tarun, Kumar Manish, Kumar Dinesh, Biswas Sayan, Sarkar Subhasish, Kumar Pranesh, Das Priyadip, Stewart Adele, Maity Biswanath", "reference": { "type": "PubMed", "id": "36574707", "url": "https://pubmed.ncbi.nlm.nih.gov/36574707" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "O54829-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "Rgs7", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36574707", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RGS7 silence protects palmitic acid-induced pancreatic \u03b2-cell injury by inactivating the chemokine signaling pathway.", "journal": "Autoimmunity", "date": "2023-12", "authors": "Zhu Yurong, Li Jun, Ba Tao, Sun Yuan, Chang Xiangyun", "reference": { "type": "PubMed", "id": "36999276", "url": "https://pubmed.ncbi.nlm.nih.gov/36999276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36999276", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RGS7 balances acetylation/de-acetylation of p65 to control chemotherapy-dependent cardiac inflammation.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2023-08-17", "authors": "Basak Madhuri, Das Kiran, Mahata Tarun, Kumar Dinesh, Nagar Nupur, Poluri Krishna Mohan, Kumar Pranesh, Das Priyadip, Stewart Adele, Maity Biswanath", "reference": { "type": "PubMed", "id": "37589751", "url": "https://pubmed.ncbi.nlm.nih.gov/37589751" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37589751", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins.", "journal": "Cell", "date": "1996", "authors": "Koelle MR, Horvitz HR", "reference": { "type": "PubMed", "id": "8548815", "url": "https://pubmed.ncbi.nlm.nih.gov/8548815" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49802-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "RGS7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49804-1", "protein_name": "Regulator of G protein signaling 8", "gene_name": "Rgs8", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49803-1", "protein_name": "Regulator of G protein signaling 7", "gene_name": "Rgs7", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49797-1", "protein_name": "Regulator of G protein signaling 3", "gene_name": "Rgs3", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49800-1", "protein_name": "Regulator of G protein signaling 5", "gene_name": "Rgs5", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49799-1", "protein_name": "Regulator of G protein signaling 4", "gene_name": "Rgs4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49801-1", "protein_name": "Regulator of G protein signaling 6", "gene_name": "Rgs6", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49805-1", "protein_name": "Regulator of G protein signaling 9", "gene_name": "Rgs9", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49806-1", "protein_name": "Regulator of G protein signaling 10", "gene_name": "Rgs10", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P49807-1", "protein_name": "Regulator of G protein signaling 11", "gene_name": "Rgs11", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49802", "url": "https://www.uniprot.org/uniprotkb/P49802" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8548815", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evolutionarily conserved, alternative splicing of reelin during brain development.", "journal": "Exp. Neurol.", "date": "1999", "authors": "Lambert de Rouvroit C, Bernier B, Royaux I, de Bergeyck V, Goffinet A M", "reference": { "type": "PubMed", "id": "10328932", "url": "https://pubmed.ncbi.nlm.nih.gov/10328932" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60841-1", "protein_name": "Reelin", "gene_name": "Reln", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P58751-1", "protein_name": "Reelin", "gene_name": "Reln", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10328932", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct binding of Reelin to VLDL receptor and ApoE receptor 2 induces tyrosine phosphorylation of disabled-1 and modulates tau phosphorylation.", "journal": "Neuron", "date": "1999", "authors": "Hiesberger T, Trommsdorff M, Howell BW, Goffinet A, Mumby MC, Cooper JA, Herz J", "reference": { "type": "PubMed", "id": "10571241", "url": "https://pubmed.ncbi.nlm.nih.gov/10571241" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98155-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "VLDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q60841-1", "protein_name": "Reelin", "gene_name": "Reln", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P98156-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "Vldlr", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75553-1", "protein_name": "Disabled homolog 1", "gene_name": "DAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10571241", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Autosomal recessive lissencephaly with cerebellar hypoplasia is associated with human RELN mutations.", "journal": "Nat. Genet.", "date": "2000", "authors": "Hong S E, Shugart Y Y, Huang D T, Shahwan S A, Grant P E, Hourihane J O, Martin N D, Walsh C A", "reference": { "type": "PubMed", "id": "10973257", "url": "https://pubmed.ncbi.nlm.nih.gov/10973257" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10973257", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reelin gene alleles and haplotypes as a factor predisposing to autistic disorder.", "journal": "Mol. Psychiatry", "date": "2001", "authors": "Persico A M, D'Agruma L, Maiorano N, Totaro A, Militerni R, Bravaccio C, Wassink T H, Schneider C, Melmed R, Trillo S, Montecchi F, Palermo M, Pascucci T, Puglisi-Allegra S, Reichelt K L, Conciatori M, Marino R, Quattrocchi C C, Baldi A, Zelante L, Gasparini P, Keller F,", "reference": { "type": "PubMed", "id": "11317216", "url": "https://pubmed.ncbi.nlm.nih.gov/11317216" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11317216", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The gene encoding disabled-1 (DAB1), the intracellular adaptor of the Reelin pathway, reveals unusual complexity in human and mouse.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Bar I, Tissir F, Lambert de Rouvroit C, De Backer O, Goffinet AM", "reference": { "type": "PubMed", "id": "12446734", "url": "https://pubmed.ncbi.nlm.nih.gov/12446734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98155-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "VLDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75553-1", "protein_name": "Disabled homolog 1", "gene_name": "DAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12446734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of Reelin signaling by Cyclin-dependent kinase 5.", "journal": "Brain research", "date": "2007", "authors": "Ohshima T, Suzuki H, Morimura T, Ogawa M, Mikoshiba K", "reference": { "type": "PubMed", "id": "16529723", "url": "https://pubmed.ncbi.nlm.nih.gov/16529723" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98155-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "VLDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75553-1", "protein_name": "Disabled homolog 1", "gene_name": "DAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16529723", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hierarchical disabled-1 tyrosine phosphorylation in Src family kinase activation and neurite formation.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Katyal S, Gao Z, Monckton E, Glubrecht D, Godbout R", "reference": { "type": "PubMed", "id": "17350651", "url": "https://pubmed.ncbi.nlm.nih.gov/17350651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98155-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "VLDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75553-1", "protein_name": "Disabled homolog 1", "gene_name": "DAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17350651", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reelin-Disabled-1 signaling in neuronal migration: splicing takes the stage.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2013", "authors": "Gao Z, Godbout R", "reference": { "type": "PubMed", "id": "23052211", "url": "https://pubmed.ncbi.nlm.nih.gov/23052211" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98155-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "VLDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75553-1", "protein_name": "Disabled homolog 1", "gene_name": "DAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23052211", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dab1-mediated colocalization of multi-adaptor protein CIN85 with Reelin receptors, ApoER2 and VLDLR, in neurons.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2013", "authors": "Fuchigami T, Sato Y, Tomita Y, Takano T, Miyauchi SY, Tsuchiya Y, Saito T, Kubo K, Nakajima K, Fukuda M, Hattori M, Hisanaga S", "reference": { "type": "PubMed", "id": "23506116", "url": "https://pubmed.ncbi.nlm.nih.gov/23506116" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98155-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "VLDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98156-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "Vldlr", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75553-1", "protein_name": "Disabled homolog 1", "gene_name": "DAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23506116", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heterozygous reelin mutations cause autosomal-dominant lateral temporal epilepsy.", "journal": "American journal of human genetics", "date": "2015", "authors": "Dazzo E, Fanciulli M, Serioli E, Minervini G, Pulitano P, Binelli S, Di Bonaventura C, Luisi C, Pasini E, Striano S, Striano P, Coppola G, Chiavegato A, Radovic S, Spadotto A, Uzzau S, La Neve A, Giallonardo AT, Mecarelli O, Tosatto SC, Ottman R, Michelucci R, Nobile C", "reference": { "type": "PubMed", "id": "26046367", "url": "https://pubmed.ncbi.nlm.nih.gov/26046367" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs794727996", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs794727996" }, { "id": "rs794727996", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs794727996" }, { "id": "26046367", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26046367" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 798, "end_pos": 798, "sequence_org": "H", "sequence_mut": "N", "comment": "Germline mutation passed 1 filters: n-glyco-sequon-gain (HYS->NYS).", "chr_id": "7", "chr_pos": "103635498", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "H798", "disease": [ { "disease_id": "DOID:0060751", "recommended_name": { "id": "DOID:0060751", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060751", "name": "familial temporal lobe epilepsy 7", "description": "A temporal lobe epilepsy characterized by autosomal dominant inheritance of focal seizures with prominent auditory symptoms and that has_material_basis_in heterozygous mutation in the RELN gene on chromosome 7q22." }, "synonyms": [ { "id": "DOID:0060751", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0060751", "name": "ETL7", "description": "" }, { "id": "MONDO:0014639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014639", "name": "familial temporal lobe epilepsy 7", "description": "A temporal lobe epilepsy characterized by autosomal dominant inheritance of focal seizures with prominent auditory symptoms and that has material basis in heterozygous mutation in the RELN gene on chromosome 7q22." }, { "id": "MONDO:0014639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014639", "name": "ETL7", "description": "" }, { "id": "MONDO:0014639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014639", "name": "epilepsy, familial temporal lobe, type 7", "description": "" }, { "id": "MONDO:0014639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014639", "name": "familial temporal lobe epilepsy type 7", "description": "" }, { "id": "MONDO:0014639", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014639", "name": "epilepsy, familial temporal lobe, 7", "description": "" }, { "id": "MIM:616436", "resource": "MIM", "url": "https://www.omim.org/entry/616436", "name": "Epilepsy, familial temporal lobe, 7", "description": "Epilepsy, familial temporal lobe, 7" } ], "unlinked_id_list": [], "evidence": [ { "id": "0060751", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060751" }, { "id": "0060751", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0060751" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000001000000000000.00000000000000.000000000001000000.00001.10.000.100", "uniprot_canonical_ac": "P78509-1" } ], "record_id": "pubmed.26046367", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The interaction of RELN-DNMT genes involving in neurotrophin signaling pathway contributes to schizophrenia susceptibility.", "journal": "International journal of developmental neuroscience : the official journal of the International Society for Developmental Neuroscience", "date": "2024-01-31", "authors": "Ping Junjiao, Wan Jing, Luo Jiali, Du Baoguo, Liu Xinxia, Jiang Tingyun, Zhang Jie", "reference": { "type": "PubMed", "id": "38296839", "url": "https://pubmed.ncbi.nlm.nih.gov/38296839" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38296839", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Exome sequencing in four families with neurodevelopmental disorders: genotype-phenotype correlation and identification of novel disease-causing variants in VPS13B and RELN.", "journal": "Molecular genetics and genomics : MGG", "date": "2024-05-21", "authors": "Afridi Tehseen Ullah Khan, Fatima Ambrin, Satti Humayoon Shafique, Akram Zaineb, Yousafzai Imran Khan, Naeem Wajahat Bin, Fatima Nasreen, Ali Asmat, Iqbal Zafar, Khan Ayaz, Shahzad Muhammad, Liu Chunyu, Toft Mathias, Zhang Feng, Tariq Muhammad, Davis Erica E, Khan Tahir N", "reference": { "type": "PubMed", "id": "38771357", "url": "https://pubmed.ncbi.nlm.nih.gov/38771357" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q7Z7G8-1", "protein_name": "Intermembrane lipid transfer protein VPS13B", "gene_name": "VPS13B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38771357", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "De novo monoallelic Reelin missense variants cause dominant neuronal migration disorders via a dominant-negative mechanism.", "journal": "The Journal of clinical investigation", "date": "2024-07-09", "authors": "Riva Martina, Ferreira Sofia, Hayashi Kotaro, Saillour Yoann, Medvedeva Vera P, Honda Takao, Hayashi Kanehiro, Altersitz Claire, Albadri Shahad, Rosello Marion, Dang Julie, Serafini Malo, Causeret Fr\u00e9d\u00e9ric, Henry Olivia J, Roux Charles-Joris, Bellesme C\u00e9line, Freri Elena, Josifova Dragana, Parrini Elena, Guerrini Renzo, Del Bene Filippo, Nakajima Kazunori, Bahi-Buisson Nadia, Pierani Alessandra", "reference": { "type": "PubMed", "id": "38980724", "url": "https://pubmed.ncbi.nlm.nih.gov/38980724" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38980724", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "OCRL1 Deficiency Affects the Intracellular Traffic of ApoER2 and Impairs Reelin-Induced Responses.", "journal": "Biomolecules", "date": "2024-07-05", "authors": "Fuentealba Luz M, Pizarro H\u00e9ctor, Marzolo Mar\u00eda-Paz", "reference": { "type": "PubMed", "id": "39062513", "url": "https://pubmed.ncbi.nlm.nih.gov/39062513" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14114-1", "protein_name": "Low-density lipoprotein receptor-related protein 8", "gene_name": "LRP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01968-1", "protein_name": "Inositol polyphosphate 5-phosphatase OCRL", "gene_name": "OCRL", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39062513", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proximity interactome of lymphatic VE-cadherin reveals mechanisms of junctional remodeling and reelin secretion.", "journal": "Nature communications", "date": "2024-09-04", "authors": "Serafin D Stephen, Harris Natalie R, B\u00e1lint L\u00e1szl\u00f3, Douglas Elizabeth S, Caron Kathleen M", "reference": { "type": "PubMed", "id": "39232006", "url": "https://pubmed.ncbi.nlm.nih.gov/39232006" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P33151-1", "protein_name": "Cadherin-5", "gene_name": "CDH5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39232006", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human reelin gene: isolation, sequencing, and mapping on chromosome 7.", "journal": "Genome Res.", "date": "1997", "authors": "DeSilva U, D'Arcangelo G, Braden VV, Chen J, Miao GG, Curran T, Green ED", "reference": { "type": "PubMed", "id": "9049633", "url": "https://pubmed.ncbi.nlm.nih.gov/9049633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98155-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "VLDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75553-1", "protein_name": "Disabled homolog 1", "gene_name": "DAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9049633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A decrease of reelin expression as a putative vulnerability factor in schizophrenia.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Impagnatiello F, Guidotti AR, Pesold C, Dwivedi Y, Caruncho H, Pisu MG, Uzunov DP, Smalheiser NR, Davis JM, Pandey GN, Pappas GD, Tueting P, Sharma RP, Costa E", "reference": { "type": "PubMed", "id": "9861036", "url": "https://pubmed.ncbi.nlm.nih.gov/9861036" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P78509-1", "protein_name": "Reelin", "gene_name": "RELN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P98155-1", "protein_name": "Very low-density lipoprotein receptor", "gene_name": "VLDLR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96B97-1", "protein_name": "SH3 domain-containing kinase-binding protein 1", "gene_name": "SH3KBP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75553-1", "protein_name": "Disabled homolog 1", "gene_name": "DAB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P78509", "url": "https://www.uniprot.org/uniprotkb/P78509" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9861036", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RGS1 is expressed in monocytes and acts as a GTPase-activating protein for G-protein-coupled chemoattractant receptors.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Denecke B, Meyerdierks A, Bottger EC", "reference": { "type": "PubMed", "id": "10480894", "url": "https://pubmed.ncbi.nlm.nih.gov/10480894" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08116-1", "protein_name": "Regulator of G protein signaling 1", "gene_name": "RGS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08116", "url": "https://www.uniprot.org/uniprotkb/Q08116" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10480894", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulator of G protein signaling-1 regulates immune infiltration and macrophage polarization in clear cell renal cell carcinoma.", "journal": "International urology and nephrology", "date": "2023-09-21", "authors": "Liu Kun, Xia Dian, Bian Hege, Peng Longfei, Dai Shuxin, Liu Chang, Jiang Chao, Wang Yi, Jin Juan, Bi Liangkuan", "reference": { "type": "PubMed", "id": "37735297", "url": "https://pubmed.ncbi.nlm.nih.gov/37735297" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08116-1", "protein_name": "Regulator of G protein signaling 1", "gene_name": "RGS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08116", "url": "https://www.uniprot.org/uniprotkb/Q08116" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37735297", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RGS1 Modulates Autophagic and Metabolic Programs and Is a Critical Mediator of Human Regulatory T Cell Function.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2023-12-01", "authors": "Flynn Alyssa L, Gans Joseph, Escobedo Javier, Zhu Cheng, Florescu Ana-Maria, Shankara Srinivas, Madden Stephen L, Kim Peter S, Pao Lily I", "reference": { "type": "PubMed", "id": "37850953", "url": "https://pubmed.ncbi.nlm.nih.gov/37850953" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08116-1", "protein_name": "Regulator of G protein signaling 1", "gene_name": "RGS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08116", "url": "https://www.uniprot.org/uniprotkb/Q08116" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37850953", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tumor-intrinsic RGS1 potentiates checkpoint blockade response via ATF3-IFNGR1 axis.", "journal": "Oncoimmunology", "date": "2023", "authors": "Wang Baojun, Jiang Bo, Du Lin, Chen Wenyuan, Zhang Qing, Chen Wei, Ding Meng, Cao Wenmin, Gao Jie, Deng Yongming, Fu Yao, Li Yan, Xiao Yonglong, Diao Wenli, Guo Hongqian", "reference": { "type": "PubMed", "id": "38264343", "url": "https://pubmed.ncbi.nlm.nih.gov/38264343" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08116-1", "protein_name": "Regulator of G protein signaling 1", "gene_name": "RGS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08116", "url": "https://www.uniprot.org/uniprotkb/Q08116" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38264343", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RGS1 and CREB5 are direct and common transcriptional targets of ZNF384-fusion proteins.", "journal": "Cancer medicine", "date": "2024-07", "authors": "Yamada Chiharu, Okada Kentaro, Odaira Koya, Tokoro Mahiru, Iwamoto Eisuke, Sanada Masashi, Noura Mina, Okamoto Syuichi, Yasuda Takahiko, Tsuzuki Shinobu, Kiyoi Hitoshi, Hayakawa Fumihiko", "reference": { "type": "PubMed", "id": "39015025", "url": "https://pubmed.ncbi.nlm.nih.gov/39015025" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08116-1", "protein_name": "Regulator of G protein signaling 1", "gene_name": "RGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q02930-1", "protein_name": "Cyclic AMP-responsive element-binding protein 5", "gene_name": "CREB5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TF68-1", "protein_name": "Zinc finger protein 384", "gene_name": "ZNF384", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08116", "url": "https://www.uniprot.org/uniprotkb/Q08116" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39015025", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RGS1 targeted by miR-191-3p inhibited the stemness properties of esophageal cancer cells by suppressing CXCR4/PI3K/AKT signaling.", "journal": "Acta histochemica", "date": "2024-10", "authors": "Xun Jing, Ma Yuan, Wang Botao, Jiang Xiaolin, Liu Bin, Gao Ruifang, Zhai Qiongli, Cheng Runfen, Wu Xueliang, Wu Yu, Zhang Qi", "reference": { "type": "PubMed", "id": "39173233", "url": "https://pubmed.ncbi.nlm.nih.gov/39173233" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08116-1", "protein_name": "Regulator of G protein signaling 1", "gene_name": "RGS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61073-1", "protein_name": "C-X-C chemokine receptor type 4", "gene_name": "CXCR4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08116", "url": "https://www.uniprot.org/uniprotkb/Q08116" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39173233", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A B cell specific immediate early human gene is located on chromosome band 1q31 and encodes an alpha helical basic phosphoprotein.", "journal": "Biochim. Biophys. Acta", "date": "1993", "authors": "Newton JS, Deed RW, Mitchell EL, Murphy JJ, Norton JD", "reference": { "type": "PubMed", "id": "8241276", "url": "https://pubmed.ncbi.nlm.nih.gov/8241276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08116-1", "protein_name": "Regulator of G protein signaling 1", "gene_name": "RGS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08116", "url": "https://www.uniprot.org/uniprotkb/Q08116" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8241276", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of a novel B cell activation gene.", "journal": "J. Immunol.", "date": "1993", "authors": "Hong J X, Wilson G L, Fox C H, Kehrl J H", "reference": { "type": "PubMed", "id": "8473738", "url": "https://pubmed.ncbi.nlm.nih.gov/8473738" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q08116-1", "protein_name": "Regulator of G protein signaling 1", "gene_name": "RGS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q08116", "url": "https://www.uniprot.org/uniprotkb/Q08116" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8473738", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a novel gene product, RIG, that is down-regulated in human glioblastoma.", "journal": "Oncogene", "date": "1997-03-06", "authors": "Ligon A H, Pershouse M A, Jasser S A, Yung W K, Steck P A", "reference": { "type": "PubMed", "id": "9070656", "url": "https://pubmed.ncbi.nlm.nih.gov/9070656" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13278-1", "protein_name": "Putative protein RIG", "gene_name": "RIG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13278", "url": "https://www.uniprot.org/uniprotkb/Q13278" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9070656", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and expression pattern of RGS21 gene, a novel RGS member.", "journal": "Acta Biochim. Pol.", "date": "2005", "authors": "Li X, Chen L, Ji C, Liu B, Gu J, Xu J, Zou X, Gu S, Mao Y", "reference": { "type": "PubMed", "id": "16302027", "url": "https://pubmed.ncbi.nlm.nih.gov/16302027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2M5E4-1", "protein_name": "Regulator of G protein signaling 21", "gene_name": "RGS21", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2M5E4", "url": "https://www.uniprot.org/uniprotkb/Q2M5E4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16302027", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulator of G-protein signaling-21 (RGS21) is an inhibitor of bitter gustatory signaling found in lingual and airway epithelia.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Cohen SP, Buckley BK, Kosloff M, Garland AL, Bosch DE, Cheng G Jr, Radhakrishna H, Brown MD, Willard FS, Arshavsky VY, Tarran R, Siderovski DP, Kimple AJ", "reference": { "type": "PubMed", "id": "23095746", "url": "https://pubmed.ncbi.nlm.nih.gov/23095746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q2M5E4-1", "protein_name": "Regulator of G protein signaling 21", "gene_name": "RGS21", "tax_name": "Human" }, { "uniprot_canonical_ac": "V9GXQ3-1", "protein_name": "Regulator of G-protein signalling 21", "gene_name": "Rgs21", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q2M5E4", "url": "https://www.uniprot.org/uniprotkb/Q2M5E4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23095746", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A unique region of RILP distinguishes it from its related proteins in its regulation of lysosomal morphology and interaction with Rab7 and Rab34.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Wang T, Wong KK, Hong W", "reference": { "type": "PubMed", "id": "14668488", "url": "https://pubmed.ncbi.nlm.nih.gov/14668488" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5EBL4-1", "protein_name": "RILP-like protein 1", "gene_name": "RILPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q969X0-1", "protein_name": "RILP-like protein 2", "gene_name": "RILPL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BZG1-1", "protein_name": "Ras-related protein Rab-34", "gene_name": "RAB34", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51149-1", "protein_name": "Ras-related protein Rab-7a", "gene_name": "RAB7A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96NA2-1", "protein_name": "Rab-interacting lysosomal protein", "gene_name": "RILP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14668488", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enhancement by GOSPEL protein of GAPDH aggregation induced by nitric oxide donor and its inhibition by NAD(.).", "journal": "FEBS letters", "date": "2016", "authors": "Gonzalez MC, Romero JM, Ingaramo MC, Munoz Sosa CJ, Curtino JA, Carrizo ME", "reference": { "type": "PubMed", "id": "27282776", "url": "https://pubmed.ncbi.nlm.nih.gov/27282776" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5EBL4-1", "protein_name": "RILP-like protein 1", "gene_name": "RILPL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27282776", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Systematic proteomic analysis of LRRK2-mediated Rab GTPase phosphorylation establishes a connection to ciliogenesis.", "journal": "eLife", "date": "2017", "authors": "Steger M, Diez F, Dhekne HS, Lis P, Nirujogi RS, Karayel O, Tonelli F, Martinez TN, Lorentzen E, Pfeffer SR, Alessi DR, Mann M", "reference": { "type": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5EBL4-1", "protein_name": "RILP-like protein 1", "gene_name": "RILPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8CG50-1", "protein_name": "Ras-related protein Rab-43", "gene_name": "Rab43", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P61028-1", "protein_name": "Ras-related protein Rab-8B", "gene_name": "Rab8b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q5S006-1", "protein_name": "Leucine-rich repeat serine/threonine-protein kinase 2", "gene_name": "Lrrk2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q969X0-1", "protein_name": "RILP-like protein 2", "gene_name": "RILPL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q86YS6-1", "protein_name": "Ras-related protein Rab-43", "gene_name": "RAB43", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62823-1", "protein_name": "Ras-related protein Rab-3C", "gene_name": "Rab3c", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P63011-1", "protein_name": "Ras-related protein Rab-3A", "gene_name": "Rab3a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q96E17-1", "protein_name": "Ras-related protein Rab-3C", "gene_name": "RAB3C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92930-1", "protein_name": "Ras-related protein Rab-8B", "gene_name": "RAB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95716-1", "protein_name": "Ras-related protein Rab-3D", "gene_name": "RAB3D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20337-1", "protein_name": "Ras-related protein Rab-3B", "gene_name": "RAB3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9CZT8-1", "protein_name": "Ras-related protein Rab-3B", "gene_name": "Rab3b", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P61020-1", "protein_name": "Ras-related protein Rab-5B", "gene_name": "RAB5B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61006-1", "protein_name": "Ras-related protein Rab-8A", "gene_name": "RAB8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61026-1", "protein_name": "Ras-related protein Rab-10", "gene_name": "RAB10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IQ22-1", "protein_name": "Ras-related protein Rab-12", "gene_name": "RAB12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20339-1", "protein_name": "Ras-related protein Rab-5A", "gene_name": "RAB5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6PHN9-1", "protein_name": "Ras-related protein Rab-35", "gene_name": "Rab35", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P35283-1", "protein_name": "Ras-related protein Rab-12", "gene_name": "Rab12", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P35276-1", "protein_name": "Ras-related protein Rab-3D", "gene_name": "Rab3d", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P51148-1", "protein_name": "Ras-related protein Rab-5C", "gene_name": "RAB5C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20336-1", "protein_name": "Ras-related protein Rab-3A", "gene_name": "RAB3A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15286-1", "protein_name": "Ras-related protein Rab-35", "gene_name": "RAB35", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55258-1", "protein_name": "Ras-related protein Rab-8A", "gene_name": "Rab8a", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P61027-1", "protein_name": "Ras-related protein Rab-10", "gene_name": "Rab10", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q5S007-1", "protein_name": "Leucine-rich repeat serine/threonine-protein kinase 2", "gene_name": "LRRK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 291, "end_pos": 291, "sequence_org": "R", "sequence_mut": "E", "comment": "Loss of interaction with RAB8A and RAB10.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 291, "end_pos": 291, "sequence_org": "R", "sequence_mut": "L", "comment": "Loss of interaction with RAB8A and RAB10.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 293, "end_pos": 293, "sequence_org": "R", "sequence_mut": "E", "comment": "Loss of interaction with RAB8A.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 293, "end_pos": 293, "sequence_org": "R", "sequence_mut": "L", "comment": "Loss of interaction with RAB8A.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 300, "end_pos": 300, "sequence_org": "R", "sequence_mut": "E", "comment": "No loss of interaction with RAB8A.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 300, "end_pos": 300, "sequence_org": "R", "sequence_mut": "L", "comment": "No loss of interaction with RAB8A.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 310, "end_pos": 310, "sequence_org": "K", "sequence_mut": "E", "comment": "Loss of interaction with RAB8A.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 310, "end_pos": 310, "sequence_org": "K", "sequence_mut": "L", "comment": "Loss of interaction with RAB8A.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 324, "end_pos": 324, "sequence_org": "K", "sequence_mut": "E", "comment": "No loss of interaction with RAB8A.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 324, "end_pos": 324, "sequence_org": "K", "sequence_mut": "L", "comment": "No loss of interaction with RAB8A.", "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q5EBL4-1" }, { "start_pos": 1441, "end_pos": 1441, "sequence_org": "R", "sequence_mut": "G", "comment": "Increases kinase activity. Reduces primary ciliogenesis. Causes fragmentation of the trans-Golgi network.", "evidence": [ { "database": "UniProtKB", "id": "Q5S006", "url": "https://www.uniprot.org/uniprotkb/Q5S006" }, { "database": "PubMed", "id": "29212815", "url": "https://pubmed.ncbi.nlm.nih.gov/29212815" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" } ], "uniprot_canonical_ac": "Q5S006-1" }, { "start_pos": 2019, "end_pos": 2019, "sequence_org": "G", "sequence_mut": "S", "comment": "Increases kinase activity. Causes loss of dopaminergic neurons in the substantia nigra of 20-month old mice due to increased phosphorylation of APP. Reduces primary ciliogenesis.", "evidence": [ { "database": "UniProtKB", "id": "Q5S006", "url": "https://www.uniprot.org/uniprotkb/Q5S006" }, { "database": "PubMed", "id": "28720718", "url": "https://pubmed.ncbi.nlm.nih.gov/28720718" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "uniprot_canonical_ac": "Q5S006-1" }, { "start_pos": 130, "end_pos": 130, "sequence_org": "R", "sequence_mut": "E", "comment": "Loss of interaction with RAB8A, RAB10 and RAB12.", "evidence": [ { "database": "UniProtKB", "id": "Q969X0", "url": "https://www.uniprot.org/uniprotkb/Q969X0" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q969X0-1" }, { "start_pos": 132, "end_pos": 132, "sequence_org": "R", "sequence_mut": "E", "comment": "Loss of interaction with RAB8A, RAB10 and RAB12.", "evidence": [ { "database": "UniProtKB", "id": "Q969X0", "url": "https://www.uniprot.org/uniprotkb/Q969X0" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q969X0-1" }, { "start_pos": 149, "end_pos": 149, "sequence_org": "K", "sequence_mut": "E", "comment": "Loss of interaction with RAB8A, RAB10 and RAB12.", "evidence": [ { "database": "UniProtKB", "id": "Q969X0", "url": "https://www.uniprot.org/uniprotkb/Q969X0" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q969X0-1" }, { "start_pos": 82, "end_pos": 82, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on binding of GDI1 and GDI2.", "evidence": [ { "database": "UniProtKB", "id": "Q86YS6", "url": "https://www.uniprot.org/uniprotkb/Q86YS6" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q86YS6-1" }, { "start_pos": 82, "end_pos": 82, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of binding to GDI1, GDI2, CHM and CHML.", "evidence": [ { "database": "UniProtKB", "id": "Q86YS6", "url": "https://www.uniprot.org/uniprotkb/Q86YS6" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q86YS6-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on GDI2, CHM and CHML binding.", "evidence": [ { "database": "UniProtKB", "id": "Q96E17", "url": "https://www.uniprot.org/uniprotkb/Q96E17" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q96E17-1" }, { "start_pos": 94, "end_pos": 94, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of GDI2, CHM and CHML binding.", "evidence": [ { "database": "UniProtKB", "id": "Q96E17", "url": "https://www.uniprot.org/uniprotkb/Q96E17" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q96E17-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on GDI1 and GDI2 binding. Reduced binding to CHM and CHML.", "evidence": [ { "database": "UniProtKB", "id": "Q92930", "url": "https://www.uniprot.org/uniprotkb/Q92930" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q92930-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of binding to GDI1, GDI2, CHM, and CHML.", "evidence": [ { "database": "UniProtKB", "id": "Q92930", "url": "https://www.uniprot.org/uniprotkb/Q92930" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q92930-1" }, { "start_pos": 86, "end_pos": 86, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. Reduced binding of CHM and CHML binding.", "evidence": [ { "database": "UniProtKB", "id": "O95716", "url": "https://www.uniprot.org/uniprotkb/O95716" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "O95716-1" }, { "start_pos": 86, "end_pos": 86, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of CHM and CHML binding.", "evidence": [ { "database": "UniProtKB", "id": "O95716", "url": "https://www.uniprot.org/uniprotkb/O95716" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "O95716-1" }, { "start_pos": 86, "end_pos": 86, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on GDI2, CHM and CHML binding.", "evidence": [ { "database": "UniProtKB", "id": "P20337", "url": "https://www.uniprot.org/uniprotkb/P20337" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P20337-1" }, { "start_pos": 86, "end_pos": 86, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of GDI2, CHM and CHML binding.", "evidence": [ { "database": "UniProtKB", "id": "P20337", "url": "https://www.uniprot.org/uniprotkb/P20337" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P20337-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on GDI1, GDI2, CHML and CHM binding.", "evidence": [ { "database": "UniProtKB", "id": "P61020", "url": "https://www.uniprot.org/uniprotkb/P61020" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P61020-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of GDI1, GDI2, CHML and CHM binding.", "evidence": [ { "database": "UniProtKB", "id": "P61020", "url": "https://www.uniprot.org/uniprotkb/P61020" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P61020-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on the binding of GDP or GTP. Localizes primarily to the Golgi complex but does not affect membrane localization. Does not translocate to LRRK2-positive lysosomes and does not suppress lysosomal enlargement.", "evidence": [ { "database": "UniProtKB", "id": "P61006", "url": "https://www.uniprot.org/uniprotkb/P61006" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" } ], "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. No effect on the binding of GDP or GTP. Loss of GDI1, GDI2, CHM, CHML, RABGGTA, RABGGTB, RAB3IP, TBC1D15, and INPP5B binding. Increases localization to the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P61006", "url": "https://www.uniprot.org/uniprotkb/P61006" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" } ], "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on GDI1 and GDI2 binding. Increases localization to the cytosol. Does not translocate to LRRK2-positive lysosomes and does not promote lysosomal content release.", "evidence": [ { "database": "UniProtKB", "id": "P61026", "url": "https://www.uniprot.org/uniprotkb/P61026" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" } ], "uniprot_canonical_ac": "P61026-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of GDI1 and GDI2 binding. Increases localization to the Golgi complex.", "evidence": [ { "database": "UniProtKB", "id": "P61026", "url": "https://www.uniprot.org/uniprotkb/P61026" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" } ], "uniprot_canonical_ac": "P61026-1" }, { "start_pos": 106, "end_pos": 106, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on GDI1 and GDI2 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q6IQ22", "url": "https://www.uniprot.org/uniprotkb/Q6IQ22" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "uniprot_canonical_ac": "Q6IQ22-1" }, { "start_pos": 106, "end_pos": 106, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of GDI1, GDI2, CHM and CHML binding.", "evidence": [ { "database": "UniProtKB", "id": "Q6IQ22", "url": "https://www.uniprot.org/uniprotkb/Q6IQ22" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "uniprot_canonical_ac": "Q6IQ22-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on GDI1 and GDI2 binding.", "evidence": [ { "database": "UniProtKB", "id": "P20339", "url": "https://www.uniprot.org/uniprotkb/P20339" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P20339-1" }, { "start_pos": 84, "end_pos": 84, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of GDI1 and GDI2 binding.", "evidence": [ { "database": "UniProtKB", "id": "P20339", "url": "https://www.uniprot.org/uniprotkb/P20339" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P20339-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on GDI1, GDI2, CHML and CHM binding.", "evidence": [ { "database": "UniProtKB", "id": "P51148", "url": "https://www.uniprot.org/uniprotkb/P51148" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P51148-1" }, { "start_pos": 85, "end_pos": 85, "sequence_org": "S", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of GDI1, GDI2, CHML and CHM binding.", "evidence": [ { "database": "UniProtKB", "id": "P51148", "url": "https://www.uniprot.org/uniprotkb/P51148" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P51148-1" }, { "start_pos": 86, "end_pos": 86, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P20336", "url": "https://www.uniprot.org/uniprotkb/P20336" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P20336-1" }, { "start_pos": 86, "end_pos": 86, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of GDI1, GDI2, CHM and CHML binding.", "evidence": [ { "database": "UniProtKB", "id": "P20336", "url": "https://www.uniprot.org/uniprotkb/P20336" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "P20336-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on binding to GDI1 and GDI2. Loss of interaction with ACAP2. No change in interaction with RUSC2, OCRL and MICAL1.", "evidence": [ { "database": "UniProtKB", "id": "Q15286", "url": "https://www.uniprot.org/uniprotkb/Q15286" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30905672", "url": "https://pubmed.ncbi.nlm.nih.gov/30905672" } ], "uniprot_canonical_ac": "Q15286-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of binding to GDI1, GDI2, CHM and CHML. Loss of interaction with ACAP2. No change in the interaction with RUSC2, OCRL and MICAL1.", "evidence": [ { "database": "UniProtKB", "id": "Q15286", "url": "https://www.uniprot.org/uniprotkb/Q15286" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "uniprot_canonical_ac": "Q15286-1" }, { "start_pos": 2017, "end_pos": 2017, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of kinase activity. Decreases proteasomal degradation of MAPT; when associated with A-1906 and N-1994. Loss of phosphorylation of RAB10; when associated with G-1441, C-1699, or S-2019.", "evidence": [ { "database": "UniProtKB", "id": "Q5S007", "url": "https://www.uniprot.org/uniprotkb/Q5S007" }, { "database": "PubMed", "id": "26014385", "url": "https://pubmed.ncbi.nlm.nih.gov/26014385" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30635421", "url": "https://pubmed.ncbi.nlm.nih.gov/30635421" }, { "database": "PubMed", "id": "29212815", "url": "https://pubmed.ncbi.nlm.nih.gov/29212815" }, { "database": "PubMed", "id": "38127736", "url": "https://pubmed.ncbi.nlm.nih.gov/38127736" } ], "uniprot_canonical_ac": "Q5S007-1" } ], "phosphorylation": [ { "start_pos": 80, "end_pos": 80, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "Q8CG50", "url": "https://www.uniprot.org/uniprotkb/Q8CG50" }, { "database": "iPTMnet", "id": "Q8CG50", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8CG50" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr80", "uniprot_canonical_ac": "Q8CG50-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P61028", "url": "https://www.uniprot.org/uniprotkb/P61028" }, { "database": "iPTMnet", "id": "P61028", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61028" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr72", "uniprot_canonical_ac": "P61028-1" }, { "start_pos": 82, "end_pos": 82, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "Q86YS6", "url": "https://www.uniprot.org/uniprotkb/Q86YS6" }, { "database": "iPTMnet", "id": "Q86YS6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q86YS6" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr82", "uniprot_canonical_ac": "Q86YS6-1" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P62823", "url": "https://www.uniprot.org/uniprotkb/P62823" }, { "database": "iPTMnet", "id": "P62823", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P62823" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr86", "uniprot_canonical_ac": "P62823-1" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P63011", "url": "https://www.uniprot.org/uniprotkb/P63011" }, { "database": "iPTMnet", "id": "P63011", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P63011" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr86", "uniprot_canonical_ac": "P63011-1" }, { "start_pos": 94, "end_pos": 94, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "Q96E17", "url": "https://www.uniprot.org/uniprotkb/Q96E17" }, { "database": "iPTMnet", "id": "Q96E17", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q96E17" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr94", "uniprot_canonical_ac": "Q96E17-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "Q92930", "url": "https://www.uniprot.org/uniprotkb/Q92930" }, { "database": "iPTMnet", "id": "Q92930", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q92930" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr72", "uniprot_canonical_ac": "Q92930-1" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "O95716", "url": "https://www.uniprot.org/uniprotkb/O95716" }, { "database": "iPTMnet", "id": "O95716", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O95716" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr86", "uniprot_canonical_ac": "O95716-1" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P20337", "url": "https://www.uniprot.org/uniprotkb/P20337" }, { "database": "iPTMnet", "id": "P20337", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20337" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr86", "uniprot_canonical_ac": "P20337-1" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "Q9CZT8", "url": "https://www.uniprot.org/uniprotkb/Q9CZT8" }, { "database": "iPTMnet", "id": "Q9CZT8", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9CZT8" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr86", "uniprot_canonical_ac": "Q9CZT8-1" }, { "start_pos": 84, "end_pos": 84, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P61020", "url": "https://www.uniprot.org/uniprotkb/P61020" }, { "database": "iPTMnet", "id": "P61020", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61020" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Ser84", "uniprot_canonical_ac": "P61020-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P61006", "url": "https://www.uniprot.org/uniprotkb/P61006" }, { "database": "IntAct", "id": "P61006", "url": "https://www.ebi.ac.uk/intact/interactors/id:P61006*" }, { "database": "iPTMnet", "id": "P61006", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61006" }, { "database": "PubMed", "id": "31663853", "url": "https://pubmed.ncbi.nlm.nih.gov/31663853" }, { "database": "PubMed", "id": "26471730", "url": "https://pubmed.ncbi.nlm.nih.gov/26471730" }, { "database": "PubMed", "id": "29357897", "url": "https://pubmed.ncbi.nlm.nih.gov/29357897" }, { "database": "PubMed", "id": "29482628", "url": "https://pubmed.ncbi.nlm.nih.gov/29482628" }, { "database": "PubMed", "id": "30709905", "url": "https://pubmed.ncbi.nlm.nih.gov/30709905" }, { "database": "PubMed", "id": "32227113", "url": "https://pubmed.ncbi.nlm.nih.gov/32227113" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "site_lbl": "Thr72", "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P61026", "url": "https://www.uniprot.org/uniprotkb/P61026" }, { "database": "IntAct", "id": "P61026", "url": "https://www.ebi.ac.uk/intact/interactors/id:P61026*" }, { "database": "iPTMnet", "id": "P61026", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61026" }, { "database": "PubMed", "id": "31663853", "url": "https://pubmed.ncbi.nlm.nih.gov/31663853" }, { "database": "PubMed", "id": "28860483", "url": "https://pubmed.ncbi.nlm.nih.gov/28860483" }, { "database": "PubMed", "id": "29127255", "url": "https://pubmed.ncbi.nlm.nih.gov/29127255" }, { "database": "PubMed", "id": "29305429", "url": "https://pubmed.ncbi.nlm.nih.gov/29305429" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" }, { "database": "PubMed", "id": "31527116", "url": "https://pubmed.ncbi.nlm.nih.gov/31527116" }, { "database": "PubMed", "id": "33177079", "url": "https://pubmed.ncbi.nlm.nih.gov/33177079" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "29212815", "url": "https://pubmed.ncbi.nlm.nih.gov/29212815" }, { "database": "PubMed", "id": "29562525", "url": "https://pubmed.ncbi.nlm.nih.gov/29562525" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "30635421", "url": "https://pubmed.ncbi.nlm.nih.gov/30635421" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "site_lbl": "Thr73", "uniprot_canonical_ac": "P61026-1" }, { "start_pos": 106, "end_pos": 106, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "Q6IQ22", "url": "https://www.uniprot.org/uniprotkb/Q6IQ22" }, { "database": "iPTMnet", "id": "Q6IQ22", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6IQ22" }, { "database": "PubMed", "id": "28860483", "url": "https://pubmed.ncbi.nlm.nih.gov/28860483" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser106", "uniprot_canonical_ac": "Q6IQ22-1" }, { "start_pos": 84, "end_pos": 84, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P20339", "url": "https://www.uniprot.org/uniprotkb/P20339" }, { "database": "iPTMnet", "id": "P20339", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20339" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Ser84", "uniprot_canonical_ac": "P20339-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "Q6PHN9", "url": "https://www.uniprot.org/uniprotkb/Q6PHN9" }, { "database": "iPTMnet", "id": "Q6PHN9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q6PHN9" }, { "database": "PubMed", "id": "30150626", "url": "https://pubmed.ncbi.nlm.nih.gov/30150626" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr72", "uniprot_canonical_ac": "Q6PHN9-1" }, { "start_pos": 105, "end_pos": 105, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P35283", "url": "https://www.uniprot.org/uniprotkb/P35283" }, { "database": "iPTMnet", "id": "P35283", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35283" }, { "database": "PubMed", "id": "33135724", "url": "https://pubmed.ncbi.nlm.nih.gov/33135724" }, { "database": "PubMed", "id": "21183079", "url": "https://pubmed.ncbi.nlm.nih.gov/21183079" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "19144319", "url": "https://pubmed.ncbi.nlm.nih.gov/19144319" } ], "site_lbl": "Ser105", "uniprot_canonical_ac": "P35283-1" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P35276", "url": "https://www.uniprot.org/uniprotkb/P35276" }, { "database": "iPTMnet", "id": "P35276", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P35276" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Thr86", "uniprot_canonical_ac": "P35276-1" }, { "start_pos": 85, "end_pos": 85, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P51148", "url": "https://www.uniprot.org/uniprotkb/P51148" }, { "database": "iPTMnet", "id": "P51148", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P51148" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" } ], "site_lbl": "Ser85", "uniprot_canonical_ac": "P51148-1" }, { "start_pos": 86, "end_pos": 86, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P20336", "url": "https://www.uniprot.org/uniprotkb/P20336" }, { "database": "iPTMnet", "id": "P20336", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P20336" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "site_lbl": "Thr86", "uniprot_canonical_ac": "P20336-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "Q15286", "url": "https://www.uniprot.org/uniprotkb/Q15286" }, { "database": "iPTMnet", "id": "Q15286", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q15286" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr72", "uniprot_canonical_ac": "Q15286-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P55258", "url": "https://www.uniprot.org/uniprotkb/P55258" }, { "database": "iPTMnet", "id": "P55258", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P55258" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "29743203", "url": "https://pubmed.ncbi.nlm.nih.gov/29743203" }, { "database": "PubMed", "id": "32643832", "url": "https://pubmed.ncbi.nlm.nih.gov/32643832" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "site_lbl": "Thr72", "uniprot_canonical_ac": "P55258-1" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P61027", "url": "https://www.uniprot.org/uniprotkb/P61027" }, { "database": "iPTMnet", "id": "P61027", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61027" }, { "database": "PubMed", "id": "27474410", "url": "https://pubmed.ncbi.nlm.nih.gov/27474410" }, { "database": "PubMed", "id": "29743203", "url": "https://pubmed.ncbi.nlm.nih.gov/29743203" }, { "database": "PubMed", "id": "33105882", "url": "https://pubmed.ncbi.nlm.nih.gov/33105882" }, { "database": "PubMed", "id": "33135724", "url": "https://pubmed.ncbi.nlm.nih.gov/33135724" }, { "database": "PubMed", "id": "33459343", "url": "https://pubmed.ncbi.nlm.nih.gov/33459343" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "site_lbl": "Thr73", "uniprot_canonical_ac": "P61027-1" } ], "record_id": "pubmed.29125462", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A pathway for Parkinson's Disease LRRK2 kinase to block primary cilia and Sonic hedgehog signaling in the brain.", "journal": "eLife", "date": "2018", "authors": "Dhekne HS, Yanatori I, Gomez RC, Tonelli F, Diez F, Schule B, Steger M, Alessi DR, Pfeffer SR", "reference": { "type": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5EBL4-1", "protein_name": "RILP-like protein 1", "gene_name": "RILPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5S006-1", "protein_name": "Leucine-rich repeat serine/threonine-protein kinase 2", "gene_name": "Lrrk2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P61006-1", "protein_name": "Ras-related protein Rab-8A", "gene_name": "RAB8A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61026-1", "protein_name": "Ras-related protein Rab-10", "gene_name": "RAB10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5S007-1", "protein_name": "Leucine-rich repeat serine/threonine-protein kinase 2", "gene_name": "LRRK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1441, "end_pos": 1441, "sequence_org": "R", "sequence_mut": "G", "comment": "Increases kinase activity. Reduces primary ciliogenesis. Causes fragmentation of the trans-Golgi network.", "evidence": [ { "database": "UniProtKB", "id": "Q5S006", "url": "https://www.uniprot.org/uniprotkb/Q5S006" }, { "database": "PubMed", "id": "29212815", "url": "https://pubmed.ncbi.nlm.nih.gov/29212815" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" } ], "uniprot_canonical_ac": "Q5S006-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on the binding of GDP or GTP. Localizes primarily to the Golgi complex but does not affect membrane localization. Does not translocate to LRRK2-positive lysosomes and does not suppress lysosomal enlargement.", "evidence": [ { "database": "UniProtKB", "id": "P61006", "url": "https://www.uniprot.org/uniprotkb/P61006" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" } ], "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. No effect on the binding of GDP or GTP. Loss of GDI1, GDI2, CHM, CHML, RABGGTA, RABGGTB, RAB3IP, TBC1D15, and INPP5B binding. Increases localization to the cell membrane.", "evidence": [ { "database": "UniProtKB", "id": "P61006", "url": "https://www.uniprot.org/uniprotkb/P61006" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" } ], "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of phosphorylation. No effect on GDI1 and GDI2 binding. Increases localization to the cytosol. Does not translocate to LRRK2-positive lysosomes and does not promote lysosomal content release.", "evidence": [ { "database": "UniProtKB", "id": "P61026", "url": "https://www.uniprot.org/uniprotkb/P61026" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" } ], "uniprot_canonical_ac": "P61026-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "E", "comment": "Phosphomimetic mutant. Loss of GDI1 and GDI2 binding. Increases localization to the Golgi complex.", "evidence": [ { "database": "UniProtKB", "id": "P61026", "url": "https://www.uniprot.org/uniprotkb/P61026" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" } ], "uniprot_canonical_ac": "P61026-1" } ], "phosphorylation": [ { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P61006", "url": "https://www.uniprot.org/uniprotkb/P61006" }, { "database": "IntAct", "id": "P61006", "url": "https://www.ebi.ac.uk/intact/interactors/id:P61006*" }, { "database": "iPTMnet", "id": "P61006", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61006" }, { "database": "PubMed", "id": "31663853", "url": "https://pubmed.ncbi.nlm.nih.gov/31663853" }, { "database": "PubMed", "id": "26471730", "url": "https://pubmed.ncbi.nlm.nih.gov/26471730" }, { "database": "PubMed", "id": "29357897", "url": "https://pubmed.ncbi.nlm.nih.gov/29357897" }, { "database": "PubMed", "id": "29482628", "url": "https://pubmed.ncbi.nlm.nih.gov/29482628" }, { "database": "PubMed", "id": "30709905", "url": "https://pubmed.ncbi.nlm.nih.gov/30709905" }, { "database": "PubMed", "id": "32227113", "url": "https://pubmed.ncbi.nlm.nih.gov/32227113" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "site_lbl": "Thr72", "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 73, "end_pos": 73, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P61026", "url": "https://www.uniprot.org/uniprotkb/P61026" }, { "database": "IntAct", "id": "P61026", "url": "https://www.ebi.ac.uk/intact/interactors/id:P61026*" }, { "database": "iPTMnet", "id": "P61026", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61026" }, { "database": "PubMed", "id": "31663853", "url": "https://pubmed.ncbi.nlm.nih.gov/31663853" }, { "database": "PubMed", "id": "28860483", "url": "https://pubmed.ncbi.nlm.nih.gov/28860483" }, { "database": "PubMed", "id": "29127255", "url": "https://pubmed.ncbi.nlm.nih.gov/29127255" }, { "database": "PubMed", "id": "29305429", "url": "https://pubmed.ncbi.nlm.nih.gov/29305429" }, { "database": "PubMed", "id": "30209220", "url": "https://pubmed.ncbi.nlm.nih.gov/30209220" }, { "database": "PubMed", "id": "31527116", "url": "https://pubmed.ncbi.nlm.nih.gov/31527116" }, { "database": "PubMed", "id": "33177079", "url": "https://pubmed.ncbi.nlm.nih.gov/33177079" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "29212815", "url": "https://pubmed.ncbi.nlm.nih.gov/29212815" }, { "database": "PubMed", "id": "29562525", "url": "https://pubmed.ncbi.nlm.nih.gov/29562525" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "30635421", "url": "https://pubmed.ncbi.nlm.nih.gov/30635421" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "site_lbl": "Thr73", "uniprot_canonical_ac": "P61026-1" } ], "record_id": "pubmed.30398148", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RAB8, RAB10 and RILPL1 contribute to both LRRK2 kinase-mediated centrosomal cohesion and ciliogenesis deficits.", "journal": "Human molecular genetics", "date": "2019", "authors": "Lara Ordonez AJ, Fernandez B, Fdez E, Romo-Lozano M, Madero-Perez J, Lobbestael E, Baekelandt V, Aiastui A, Lopez de Munain A, Melrose HL, Civiero L, Hilfiker S", "reference": { "type": "PubMed", "id": "31428781", "url": "https://pubmed.ncbi.nlm.nih.gov/31428781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5EBL4-1", "protein_name": "RILP-like protein 1", "gene_name": "RILPL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5S007-1", "protein_name": "Leucine-rich repeat serine/threonine-protein kinase 2", "gene_name": "LRRK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 935, "end_pos": 935, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q5S007", "url": "https://www.uniprot.org/uniprotkb/Q5S007" }, { "database": "PubMed", "id": "28720718", "url": "https://pubmed.ncbi.nlm.nih.gov/28720718" }, { "database": "PubMed", "id": "29127255", "url": "https://pubmed.ncbi.nlm.nih.gov/29127255" }, { "database": "PubMed", "id": "29212815", "url": "https://pubmed.ncbi.nlm.nih.gov/29212815" }, { "database": "PubMed", "id": "28202711", "url": "https://pubmed.ncbi.nlm.nih.gov/28202711" }, { "database": "PubMed", "id": "30635421", "url": "https://pubmed.ncbi.nlm.nih.gov/30635421" }, { "database": "iPTMnet", "id": "Q5S007", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q5S007" }, { "database": "PubMed", "id": "17200152", "url": "https://pubmed.ncbi.nlm.nih.gov/17200152" }, { "database": "PubMed", "id": "20642453", "url": "https://pubmed.ncbi.nlm.nih.gov/20642453" }, { "database": "PubMed", "id": "20659021", "url": "https://pubmed.ncbi.nlm.nih.gov/20659021" }, { "database": "PubMed", "id": "22004453", "url": "https://pubmed.ncbi.nlm.nih.gov/22004453" }, { "database": "PubMed", "id": "22952710", "url": "https://pubmed.ncbi.nlm.nih.gov/22952710" }, { "database": "PubMed", "id": "22988882", "url": "https://pubmed.ncbi.nlm.nih.gov/22988882" }, { "database": "PubMed", "id": "23916833", "url": "https://pubmed.ncbi.nlm.nih.gov/23916833" }, { "database": "PubMed", "id": "23938344", "url": "https://pubmed.ncbi.nlm.nih.gov/23938344" }, { "database": "PubMed", "id": "24836358", "url": "https://pubmed.ncbi.nlm.nih.gov/24836358" }, { "database": "PubMed", "id": "24917786", "url": "https://pubmed.ncbi.nlm.nih.gov/24917786" }, { "database": "PubMed", "id": "24942733", "url": "https://pubmed.ncbi.nlm.nih.gov/24942733" }, { "database": "PubMed", "id": "25009464", "url": "https://pubmed.ncbi.nlm.nih.gov/25009464" }, { "database": "PubMed", "id": "25118928", "url": "https://pubmed.ncbi.nlm.nih.gov/25118928" }, { "database": "PubMed", "id": "25830304", "url": "https://pubmed.ncbi.nlm.nih.gov/25830304" }, { "database": "PubMed", "id": "27911006", "url": "https://pubmed.ncbi.nlm.nih.gov/27911006" }, { "database": "PubMed", "id": "28353278", "url": "https://pubmed.ncbi.nlm.nih.gov/28353278" }, { "database": "PubMed", "id": "28353283", "url": "https://pubmed.ncbi.nlm.nih.gov/28353283" }, { "database": "PubMed", "id": "28453723", "url": "https://pubmed.ncbi.nlm.nih.gov/28453723" }, { "database": "PubMed", "id": "28553204", "url": "https://pubmed.ncbi.nlm.nih.gov/28553204" }, { "database": "PubMed", "id": "28860483", "url": "https://pubmed.ncbi.nlm.nih.gov/28860483" }, { "database": "PubMed", "id": "28973420", "url": "https://pubmed.ncbi.nlm.nih.gov/28973420" }, { "database": "PubMed", "id": "29127256", "url": "https://pubmed.ncbi.nlm.nih.gov/29127256" }, { "database": "PubMed", "id": "29129681", "url": "https://pubmed.ncbi.nlm.nih.gov/29129681" }, { "database": "PubMed", "id": "29166931", "url": "https://pubmed.ncbi.nlm.nih.gov/29166931" }, { "database": "PubMed", "id": "29311810", "url": "https://pubmed.ncbi.nlm.nih.gov/29311810" }, { "database": "PubMed", "id": "29513666", "url": "https://pubmed.ncbi.nlm.nih.gov/29513666" }, { "database": "PubMed", "id": "29541021", "url": "https://pubmed.ncbi.nlm.nih.gov/29541021" }, { "database": "PubMed", "id": "29743203", "url": "https://pubmed.ncbi.nlm.nih.gov/29743203" }, { "database": "PubMed", "id": "30592011", "url": "https://pubmed.ncbi.nlm.nih.gov/30592011" }, { "database": "PubMed", "id": "31428781", "url": "https://pubmed.ncbi.nlm.nih.gov/31428781" }, { "database": "PubMed", "id": "31527116", "url": "https://pubmed.ncbi.nlm.nih.gov/31527116" }, { "database": "PubMed", "id": "31663853", "url": "https://pubmed.ncbi.nlm.nih.gov/31663853" }, { "database": "PubMed", "id": "32499675", "url": "https://pubmed.ncbi.nlm.nih.gov/32499675" }, { "database": "PubMed", "id": "32736291", "url": "https://pubmed.ncbi.nlm.nih.gov/32736291" }, { "database": "PubMed", "id": "33057100", "url": "https://pubmed.ncbi.nlm.nih.gov/33057100" }, { "database": "PubMed", "id": "33297425", "url": "https://pubmed.ncbi.nlm.nih.gov/33297425" }, { "database": "PubMed", "id": "34125248", "url": "https://pubmed.ncbi.nlm.nih.gov/34125248" }, { "database": "PubMed", "id": "35675433", "url": "https://pubmed.ncbi.nlm.nih.gov/35675433" }, { "database": "PubMed", "id": "35950872", "url": "https://pubmed.ncbi.nlm.nih.gov/35950872" } ], "site_lbl": "Ser935", "uniprot_canonical_ac": "Q5S007-1" } ], "record_id": "pubmed.31428781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The CGG repeat expansion in RILPL1 is associated with oculopharyngodistal myopathy type 4.", "journal": "Am. J. Hum. Genet.", "date": "2022", "authors": "Yu J, Shan J, Yu M, Di L, Xie Z, Zhang W, Lv H, Meng L, Zheng Y, Zhao Y, Gang Q, Guo X, Wang Y, Xi J, Zhu W, Da Y, Hong D, Yuan Y, Yan C, Wang Z, Deng J", "reference": { "type": "PubMed", "id": "35148830", "url": "https://pubmed.ncbi.nlm.nih.gov/35148830" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5EBL4-1", "protein_name": "RILP-like protein 1", "gene_name": "RILPL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5EBL4", "url": "https://www.uniprot.org/uniprotkb/Q5EBL4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35148830", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]