[ { "title": "Notch maintains Drosophila type II neuroblasts by suppressing expression of the Fez transcription factor Earmuff.", "journal": "Development (Cambridge, England)", "date": "2016-07-15", "authors": "Li Xiaosu, Xie Yonggang, Zhu Sijun", "reference": { "type": "PubMed", "id": "27151950", "url": "https://pubmed.ncbi.nlm.nih.gov/27151950" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VQ56-1", "protein_name": "Fez family zinc finger protein erm", "gene_name": "erm", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P51023-1", "protein_name": "ETS-like protein pointed", "gene_name": "pnt", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.27151950", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mapping Sites of O-Glycosylation and Fringe Elongation on Drosophila Notch.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Harvey BM, Rana NA, Moss H, Leonardi J, Jafar-Nejad H, Haltiwanger RS", "reference": { "type": "PubMed", "id": "27268051", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1015, "start_aa": "Ser", "end_pos": 1015, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1015", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Fuc...) serine;O-fucosylation", "icn3d_view": {}, "start_pos": 1036, "start_aa": "Ser", "end_pos": 1036, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1036", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1053, "start_aa": "Ser", "end_pos": 1053, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1053", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 1066, "start_aa": "Ser", "end_pos": 1066, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1066", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 1074, "start_aa": "Thr", "end_pos": 1074, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1074", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1091, "start_aa": "Thr", "end_pos": 1091, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1091", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 110, "start_aa": "Thr", "end_pos": 110, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr110", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 1112, "start_aa": "Thr", "end_pos": 1112, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1112", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1129, "start_aa": "Thr", "end_pos": 1129, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1129", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 1189, "start_aa": "Ser", "end_pos": 1189, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1189", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 1197, "start_aa": "Thr", "end_pos": 1197, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1197", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 1235, "start_aa": "Thr", "end_pos": 1235, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1235", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Fuc...) serine;O-fucosylation", "icn3d_view": {}, "start_pos": 1273, "start_aa": "Ser", "end_pos": 1273, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1273", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 1303, "start_aa": "Ser", "end_pos": 1303, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1303", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 1381, "start_aa": "Ser", "end_pos": 1381, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1381", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 153, "start_aa": "Thr", "end_pos": 153, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr153", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 171, "start_aa": "Thr", "end_pos": 171, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr171", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 183, "start_aa": "Ser", "end_pos": 183, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser183", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 191, "start_aa": "Thr", "end_pos": 191, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr191", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 210, "start_aa": "Thr", "end_pos": 210, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr210", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc...) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 210, "start_aa": "Thr", "end_pos": 210, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr210", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00000001000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 223, "start_aa": "Ser", "end_pos": 223, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser223", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 231, "start_aa": "Thr", "end_pos": 231, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr231", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 248, "start_aa": "Thr", "end_pos": 248, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr248", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 307, "start_aa": "Thr", "end_pos": 307, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr307", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 348, "start_aa": "Thr", "end_pos": 348, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr348", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 386, "start_aa": "Thr", "end_pos": 386, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr386", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 403, "start_aa": "Thr", "end_pos": 403, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr403", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 427, "start_aa": "Ser", "end_pos": 427, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser427", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 481, "start_aa": "Thr", "end_pos": 481, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr481", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc...) threonine;O-GlcNAcylation", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7ALJ&bu=0&command=select+.A:481;+center+selection;+zoom+selection" }, "start_pos": 481, "start_aa": "Thr", "end_pos": 481, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr481", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" }, { "id": "7ALJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ALJ" } ], "filter_code": "000000000000000010000.00000001000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7ALJ&bu=0&command=select+.A:494;+center+selection;+zoom+selection" }, "start_pos": 494, "start_aa": "Ser", "end_pos": 494, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser494", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" }, { "id": "7ALJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ALJ" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Fuc...) serine;O-fucosylation", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7ALJ&bu=0&command=select+.A:502;+center+selection;+zoom+selection" }, "start_pos": 502, "start_aa": "Ser", "end_pos": 502, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser502", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" }, { "id": "7ALJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ALJ" } ], "filter_code": "000000000000000100000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 519, "start_aa": "Thr", "end_pos": 519, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr519", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc...) threonine;O-GlcNAcylation", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7ALJ&bu=0&command=select+.A:519;+center+selection;+zoom+selection" }, "start_pos": 519, "start_aa": "Thr", "end_pos": 519, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr519", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" }, { "id": "7ALJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ALJ" } ], "filter_code": "000000000000000010000.00000001000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 532, "start_aa": "Ser", "end_pos": 532, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser532", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 557, "start_aa": "Thr", "end_pos": 557, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr557", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 570, "start_aa": "Ser", "end_pos": 570, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser570", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 595, "start_aa": "Thr", "end_pos": 595, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr595", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc...) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 595, "start_aa": "Thr", "end_pos": 595, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr595", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00000001000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 608, "start_aa": "Ser", "end_pos": 608, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser608", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 632, "start_aa": "Thr", "end_pos": 632, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr632", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 645, "start_aa": "Ser", "end_pos": 645, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser645", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 670, "start_aa": "Ser", "end_pos": 670, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser670", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 683, "start_aa": "Ser", "end_pos": 683, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser683", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 691, "start_aa": "Thr", "end_pos": 691, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr691", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 708, "start_aa": "Thr", "end_pos": 708, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr708", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 721, "start_aa": "Ser", "end_pos": 721, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser721", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 72, "start_aa": "Thr", "end_pos": 72, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr72", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 759, "start_aa": "Ser", "end_pos": 759, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser759", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 784, "start_aa": "Thr", "end_pos": 784, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr784", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 797, "start_aa": "Ser", "end_pos": 797, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser797", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 805, "start_aa": "Thr", "end_pos": 805, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr805", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 822, "start_aa": "Thr", "end_pos": 822, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr822", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (GlcNAc...) threonine;O-GlcNAcylation", "icn3d_view": {}, "start_pos": 822, "start_aa": "Thr", "end_pos": 822, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr822", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00000001000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 843, "start_aa": "Thr", "end_pos": 843, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr843", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 900, "start_aa": "Thr", "end_pos": 900, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr900", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Fuc...) serine;O-fucosylation", "icn3d_view": {}, "start_pos": 922, "start_aa": "Ser", "end_pos": 922, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser922", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 952, "start_aa": "Ser", "end_pos": 952, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser952", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 960, "start_aa": "Thr", "end_pos": 960, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr960", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-glucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "O-linked (Glc...) serine;O-glucosylation", "icn3d_view": {}, "start_pos": 990, "start_aa": "Ser", "end_pos": 990, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser990", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.00000000100000.00.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-fucosylation", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "O-linked (Fuc...) threonine;O-fucosylation", "icn3d_view": {}, "start_pos": 998, "start_aa": "Thr", "end_pos": 998, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr998", "evidence": [ { "id": "P07207", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P07207#ptm_processing" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.00001000000000.00.01000", "uniprot_canonical_ac": "P07207-1" } ], "record_id": "pubmed.27268051", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 62 }, { "field": "total_sites", "count": 57 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 57 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 18 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 57 }, { "field": "exact_o_linked_sites", "count": 57 }, { "field": "exact_o_linked_glycan_sites", "count": 18 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 44 }, { "field": "total_sites", "count": 44 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 44 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 44 }, { "field": "exact_o_linked_sites", "count": 44 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 18 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 18 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 18 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 18 }, { "field": "exact_o_linked_sites", "count": 18 }, { "field": "exact_o_linked_glycan_sites", "count": 18 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hypervariability of simple sequences as a general source for polymorphic DNA markers.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Tautz D", "reference": { "type": "PubMed", "id": "2780284", "url": "https://pubmed.ncbi.nlm.nih.gov/2780284" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2780284", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AKAP200 promotes Notch stability by protecting it from Cbl/lysosome-mediated degradation in Drosophila melanogaster.", "journal": "PLoS genetics", "date": "2018", "authors": "Bala Tannan N, Collu G, Humphries AC, Serysheva E, Weber U, Mlodzik M", "reference": { "type": "PubMed", "id": "29309414", "url": "https://pubmed.ncbi.nlm.nih.gov/29309414" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VLL3-1", "protein_name": "A-kinase anchor protein 200", "gene_name": "Akap200", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.29309414", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "opa: a novel family of transcribed repeats shared by the Notch locus and other developmentally regulated loci in D. melanogaster.", "journal": "Cell", "date": "1985", "authors": "Wharton K A, Yedvobnick B, Finnerty V G, Artavanis-Tsakonas S", "reference": { "type": "PubMed", "id": "2981631", "url": "https://pubmed.ncbi.nlm.nih.gov/2981631" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2981631", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural Divergence in O-GlcNAc Glycans Displayed on Epidermal Growth Factor-like Repeats of Mammalian Notch1.", "journal": "Molecules (Basel, Switzerland)", "date": "2018", "authors": "Ogawa M, Senoo Y, Ikeda K, Takeuchi H, Okajima T", "reference": { "type": "PubMed", "id": "30018219", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q01705-1", "protein_name": "Neurogenic locus notch homolog protein 1", "gene_name": "Notch1", "tax_name": "Mouse" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1015, "start_aa": "Ser", "end_pos": 1015, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1015", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1053, "start_aa": "Ser", "end_pos": 1053, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser1053", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1091, "start_aa": "Thr", "end_pos": 1091, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1091", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1129, "start_aa": "Thr", "end_pos": 1129, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1129", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 171, "start_aa": "Thr", "end_pos": 171, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr171", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 210, "start_aa": "Thr", "end_pos": 210, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr210", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 248, "start_aa": "Thr", "end_pos": 248, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr248", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 403, "start_aa": "Thr", "end_pos": 403, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr403", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 481, "start_aa": "Thr", "end_pos": 481, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr481", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 519, "start_aa": "Thr", "end_pos": 519, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr519", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 557, "start_aa": "Thr", "end_pos": 557, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr557", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 595, "start_aa": "Thr", "end_pos": 595, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr595", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 632, "start_aa": "Thr", "end_pos": 632, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr632", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 670, "start_aa": "Ser", "end_pos": 670, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser670", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 708, "start_aa": "Thr", "end_pos": 708, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr708", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 784, "start_aa": "Thr", "end_pos": 784, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr784", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 822, "start_aa": "Thr", "end_pos": 822, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr822", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 900, "start_aa": "Thr", "end_pos": 900, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr900", "evidence": [ { "id": "23671640", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/23671640" }, { "id": "P07207", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=P07207" }, { "id": "22158438", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22158438" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "18948267", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/18948267" }, { "id": "27268051", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/27268051" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "P07207-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1052, "start_aa": "Thr", "end_pos": 1052, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1052", "evidence": [ { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1090, "start_aa": "Thr", "end_pos": 1090, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1090", "evidence": [ { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 1379, "start_aa": "Thr", "end_pos": 1379, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1379", "evidence": [ { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 405, "start_aa": "Thr", "end_pos": 405, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr405", "evidence": [ { "id": "30016717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30016717" }, { "id": "Q01705", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01705" }, { "id": "33789105", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33789105" }, { "id": "24730386", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24730386" }, { "id": "22310717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22310717" }, { "id": "24573683", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24573683" }, { "id": "28089369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28089369" }, { "id": "37838775", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37838775" }, { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "40885482", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40885482" }, { "id": "26192747", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26192747" }, { "id": "38474544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38474544" }, { "id": "28395734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28395734" }, { "id": "35290457", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35290457" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 445, "start_aa": "Thr", "end_pos": 445, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr445", "evidence": [ { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 559, "start_aa": "Thr", "end_pos": 559, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr559", "evidence": [ { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 596, "start_aa": "Thr", "end_pos": 596, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr596", "evidence": [ { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 784, "start_aa": "Ser", "end_pos": 784, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser784", "evidence": [ { "id": "30016717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30016717" }, { "id": "Q01705", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01705" }, { "id": "33789105", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33789105" }, { "id": "24730386", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24730386" }, { "id": "22310717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22310717" }, { "id": "24573683", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24573683" }, { "id": "28089369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28089369" }, { "id": "37838775", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37838775" }, { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "40885482", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40885482" }, { "id": "26192747", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26192747" }, { "id": "38474544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38474544" }, { "id": "28395734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28395734" }, { "id": "35290457", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35290457" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 822, "start_aa": "Thr", "end_pos": 822, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr822", "evidence": [ { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" }, { "id": "32848054", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32848054" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 900, "start_aa": "Thr", "end_pos": 900, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr900", "evidence": [ { "id": "30016717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30016717" }, { "id": "Q01705", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01705" }, { "id": "33789105", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33789105" }, { "id": "24730386", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24730386" }, { "id": "22310717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22310717" }, { "id": "24573683", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24573683" }, { "id": "28089369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28089369" }, { "id": "37838775", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37838775" }, { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "40885482", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40885482" }, { "id": "26192747", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26192747" }, { "id": "38474544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38474544" }, { "id": "28395734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28395734" }, { "id": "35290457", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35290457" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" }, { "id": "32782141", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32782141" } ], "filter_code": "000000000000000010000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 94, "start_aa": "Ser", "end_pos": 94, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser94", "evidence": [ { "id": "30016717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30016717" }, { "id": "Q01705", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=Q01705" }, { "id": "33789105", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33789105" }, { "id": "24730386", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24730386" }, { "id": "22310717", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22310717" }, { "id": "24573683", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/24573683" }, { "id": "28089369", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28089369" }, { "id": "37838775", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37838775" }, { "id": "22645316", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22645316" }, { "id": "38359610", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38359610" }, { "id": "40885482", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/40885482" }, { "id": "26192747", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/26192747" }, { "id": "38474544", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/38474544" }, { "id": "28395734", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28395734" }, { "id": "35290457", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35290457" }, { "id": "30018219", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30018219" }, { "id": "Q01705", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/Q01705" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q01705-1" } ], "record_id": "pubmed.30018219", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 29 }, { "field": "total_sites", "count": 29 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 29 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 29 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 29 }, { "field": "exact_o_linked_sites", "count": 29 }, { "field": "exact_o_linked_glycan_sites", "count": 29 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 29 }, { "field": "total_sites", "count": 29 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 29 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 29 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 29 }, { "field": "exact_o_linked_sites", "count": 29 }, { "field": "exact_o_linked_glycan_sites", "count": 29 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Restriction of P-element insertions at the Notch locus of Drosophila melanogaster.", "journal": "Mol. Cell. Biol.", "date": "1987", "authors": "Kelley M R, Kidd S, Berg R L, Young M W", "reference": { "type": "PubMed", "id": "3037327", "url": "https://pubmed.ncbi.nlm.nih.gov/3037327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.3037327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence of the notch locus of Drosophila melanogaster: relationship of the encoded protein to mammalian clotting and growth factors.", "journal": "Mol. Cell. Biol.", "date": "1986", "authors": "Kidd S, Kelley M R, Young M W", "reference": { "type": "PubMed", "id": "3097517", "url": "https://pubmed.ncbi.nlm.nih.gov/3097517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.3097517", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lethal (2) giant discs (Lgd)/CC2D1 is required for the full activity of the ESCRT machinery.", "journal": "BMC biology", "date": "2020-12-22", "authors": "Baeumers Miriam, Ruhnau Kristina, Breuer Thomas, Pannen Hendrik, Goerlich Bastian, Kniebel Anna, Haensch Sebastian, Weidtkamp-Peters Stefanie, Schmitt Lutz, Klein Thomas", "reference": { "type": "PubMed", "id": "33349255", "url": "https://pubmed.ncbi.nlm.nih.gov/33349255" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VKJ9-1", "protein_name": "Coiled-coil and C2 domain-containing protein 1-like", "gene_name": "l(2)gd1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8T0Q4-1", "protein_name": "Charged multivesicular body protein 4", "gene_name": "shrb", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q5T0F9-1", "protein_name": "Coiled-coil and C2 domain-containing protein 1B", "gene_name": "CC2D1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H444-1", "protein_name": "Charged multivesicular body protein 4b", "gene_name": "CHMP4B", "tax_name": "Human" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 86, "end_pos": 86, "sequence_org": "E", "sequence_mut": "R", "comment": "Prevents homopolymerization due to disruption of electrostatic interaction. Abolishes binding to l(2)gd1. Unable to rescue null phenotype; when associated with R-90 and R-93.", "evidence": [ { "database": "UniProtKB", "id": "Q8T0Q4", "url": "https://www.uniprot.org/uniprotkb/Q8T0Q4" }, { "database": "PubMed", "id": "28564595", "url": "https://pubmed.ncbi.nlm.nih.gov/28564595" }, { "database": "PubMed", "id": "27452459", "url": "https://pubmed.ncbi.nlm.nih.gov/27452459" }, { "database": "PubMed", "id": "33349255", "url": "https://pubmed.ncbi.nlm.nih.gov/33349255" } ], "uniprot_canonical_ac": "Q8T0Q4-1" }, { "start_pos": 90, "end_pos": 90, "sequence_org": "E", "sequence_mut": "R", "comment": "Unable to rescue null phenotype; when associated with R-86 and R-93.", "evidence": [ { "database": "UniProtKB", "id": "Q8T0Q4", "url": "https://www.uniprot.org/uniprotkb/Q8T0Q4" }, { "database": "PubMed", "id": "33349255", "url": "https://pubmed.ncbi.nlm.nih.gov/33349255" } ], "uniprot_canonical_ac": "Q8T0Q4-1" }, { "start_pos": 93, "end_pos": 93, "sequence_org": "E", "sequence_mut": "R", "comment": "Unable to rescue null phenotype; when associated with R-86 and R-90.", "evidence": [ { "database": "UniProtKB", "id": "Q8T0Q4", "url": "https://www.uniprot.org/uniprotkb/Q8T0Q4" }, { "database": "PubMed", "id": "33349255", "url": "https://pubmed.ncbi.nlm.nih.gov/33349255" } ], "uniprot_canonical_ac": "Q8T0Q4-1" }, { "start_pos": 180, "end_pos": 180, "sequence_org": "L", "sequence_mut": "C", "comment": "No loss of interaction with CC2D1B and forms a disulfide bond locking the protein in its folded closed conformation when exposed to oxidizing conditions; when associated with C-54.", "evidence": [ { "database": "UniProtKB", "id": "Q9H444", "url": "https://www.uniprot.org/uniprotkb/Q9H444" }, { "database": "PubMed", "id": "33349255", "url": "https://pubmed.ncbi.nlm.nih.gov/33349255" } ], "uniprot_canonical_ac": "Q9H444-1" }, { "start_pos": 54, "end_pos": 54, "sequence_org": "A", "sequence_mut": "C", "comment": "No loss of interaction with CC2D1B and forms a disulfide bond locking the protein in its folded closed conformation when exposed to oxidizing conditions; when associated with C-180.", "evidence": [ { "database": "UniProtKB", "id": "Q9H444", "url": "https://www.uniprot.org/uniprotkb/Q9H444" }, { "database": "PubMed", "id": "33349255", "url": "https://pubmed.ncbi.nlm.nih.gov/33349255" } ], "uniprot_canonical_ac": "Q9H444-1" } ], "record_id": "pubmed.33349255", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequence from the neurogenic locus notch implies a gene product that shares homology with proteins containing EGF-like repeats.", "journal": "Cell", "date": "1985-12", "authors": "Wharton K A, Johansen K M, Xu T, Artavanis-Tsakonas S", "reference": { "type": "PubMed", "id": "3935325", "url": "https://pubmed.ncbi.nlm.nih.gov/3935325" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.3935325", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytosolic interaction between deltex and Notch ankyrin repeats implicates deltex in the Notch signaling pathway.", "journal": "Development", "date": "1994", "authors": "Diederich R J, Matsuno K, Hing H, Artavanis-Tsakonas S", "reference": { "type": "PubMed", "id": "8162848", "url": "https://pubmed.ncbi.nlm.nih.gov/8162848" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8162848", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The neurogenic genes egghead and brainiac define a novel signaling pathway essential for epithelial morphogenesis during Drosophila oogenesis.", "journal": "Development", "date": "1996", "authors": "Goode S, Melnick M, Chou T B, Perrimon N", "reference": { "type": "PubMed", "id": "9012507", "url": "https://pubmed.ncbi.nlm.nih.gov/9012507" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P07207-1", "protein_name": "Neurogenic locus Notch protein", "gene_name": "N", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P13395-1", "protein_name": "Spectrin alpha chain", "gene_name": "alpha-Spec", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O01346-1", "protein_name": "Glycolipid beta-1,4-mannosyltransferase egh", "gene_name": "egh", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24157-1", "protein_name": "Beta-1,4-mannosylglycolipid beta-1,3-N-acetylglucosaminyltransferase brn", "gene_name": "brn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P07207", "url": "https://www.uniprot.org/uniprotkb/P07207" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9012507", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "chickadee encodes a profilin required for intercellular cytoplasm transport during Drosophila oogenesis.", "journal": "Cell", "date": "1992-04-03", "authors": "Cooley L, Verheyen E, Ayers K", "reference": { "type": "PubMed", "id": "1339308", "url": "https://pubmed.ncbi.nlm.nih.gov/1339308" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25843-1", "protein_name": "Profilin", "gene_name": "chic", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P25843", "url": "https://www.uniprot.org/uniprotkb/P25843" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1339308", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of Cdc42 in actin filament assembly, epithelial morphogenesis, and cell signaling during Drosophila development.", "journal": "Dev. Biol.", "date": "2000", "authors": "Genova J L, Jong S, Camp J T, Fehon R G", "reference": { "type": "PubMed", "id": "10772800", "url": "https://pubmed.ncbi.nlm.nih.gov/10772800" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P40793-1", "protein_name": "Cdc42 homolog", "gene_name": "Cdc42", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P40793", "url": "https://www.uniprot.org/uniprotkb/P40793" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10772800", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mbt, a Drosophila PAK protein, combines with Cdc42 to regulate photoreceptor cell morphogenesis.", "journal": "Development (Cambridge, England)", "date": "2003", "authors": "Schneeberger D, Raabe T", "reference": { "type": "PubMed", "id": "12490550", "url": "https://pubmed.ncbi.nlm.nih.gov/12490550" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P40793-1", "protein_name": "Cdc42 homolog", "gene_name": "Cdc42", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VXE5-1", "protein_name": "Serine/threonine-protein kinase PAK mbt", "gene_name": "mbt", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P40793", "url": "https://www.uniprot.org/uniprotkb/P40793" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 12, "end_pos": 12, "sequence_org": "G", "sequence_mut": "V", "comment": "Enhances interaction with mbt. Coexpression with mbt slightly reduced the substrate phosphorylation ability of mbt.", "evidence": [ { "database": "UniProtKB", "id": "P40793", "url": "https://www.uniprot.org/uniprotkb/P40793" }, { "database": "PubMed", "id": "12490550", "url": "https://pubmed.ncbi.nlm.nih.gov/12490550" } ], "uniprot_canonical_ac": "P40793-1" }, { "start_pos": 19, "end_pos": 19, "sequence_org": "H", "sequence_mut": "L", "comment": "Inhibits binding to Cdc42; when associated with L-22.", "evidence": [ { "database": "UniProtKB", "id": "Q9VXE5", "url": "https://www.uniprot.org/uniprotkb/Q9VXE5" }, { "database": "PubMed", "id": "12490550", "url": "https://pubmed.ncbi.nlm.nih.gov/12490550" } ], "uniprot_canonical_ac": "Q9VXE5-1" }, { "start_pos": 22, "end_pos": 22, "sequence_org": "H", "sequence_mut": "L", "comment": "Inhibits binding to Cdc42; when associated with L-19.", "evidence": [ { "database": "UniProtKB", "id": "Q9VXE5", "url": "https://www.uniprot.org/uniprotkb/Q9VXE5" }, { "database": "PubMed", "id": "12490550", "url": "https://pubmed.ncbi.nlm.nih.gov/12490550" } ], "uniprot_canonical_ac": "Q9VXE5-1" }, { "start_pos": 525, "end_pos": 525, "sequence_org": "T", "sequence_mut": "A", "comment": "Strongly reduces autophosphorylation and substrate phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q9VXE5", "url": "https://www.uniprot.org/uniprotkb/Q9VXE5" }, { "database": "PubMed", "id": "12490550", "url": "https://pubmed.ncbi.nlm.nih.gov/12490550" } ], "uniprot_canonical_ac": "Q9VXE5-1" } ], "record_id": "pubmed.12490550", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unique and Overlapping Functions of Formins Frl and DAAM During Ommatidial Rotation and Neuronal Development in Drosophila.", "journal": "Genetics", "date": "2016", "authors": "Dollar G, Gombos R, Barnett AA, Sanchez Hernandez D, Maung SM, Mihaly J, Jenny A", "reference": { "type": "PubMed", "id": "26801180", "url": "https://pubmed.ncbi.nlm.nih.gov/26801180" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P40793-1", "protein_name": "Cdc42 homolog", "gene_name": "Cdc42", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VUC6-1", "protein_name": "Formin-like protein", "gene_name": "Frl", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P40793", "url": "https://www.uniprot.org/uniprotkb/P40793" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 373, "end_pos": 1183, "sequence_org": "KGGHEIILGSFDNFKDVCQEKRRFQTLMEYFMNFEAFNIDFMVACMQFMNIVVHSVEDMNYRVHLQYEFTALGLDKYLERIRLTESEELKVQISAYLDNVFDVAALMEDSETKTSALERVQELEDQLEREIDRNSEFLYKYAELESESLTLKTEREQLAMIRQKLEEELTVMQRMLQHNEQELKKRDTLLHTKNMELQTLSRSLPRSASSGDGSLANGGLMAGSTSGAASLTLPPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGFSPLGSPSGSLASTAPSPPHAPPMLSSFQPPPPPVAGFMPAPDGAMTIKRKVPTKYKLPTLNWIALKPNQVRGTIFNELDDEKIFKQIDFNEFEERFKIGIGGALRNGSNGTEVDGSLQSSKRFKRPDNVSLLEHTRLRNIAISRRKLGMPIDDVIAAIHSLDLKKLSLENVELLQKMVPTDAEVKSYKEYIIERKDQQLLTEEDKFMLQLSRVERISSKLAIMNYMGNFVDSVHLISPQVQSIAGASTSLKQSRKFKAVLEIVLAFGNYLNSNKRGPAYGFKLQSLDTLIDTKSTDKRSSLLHYIVATIRAKFPELLNFESELYGTDKAASVALENVVADVQELEKGMDLVRKEAELRVKGAQTHILRDFLNNSEDKLKKIKSDLRHAQEAFKECVEYFGDSSRNADAAAFFALIVRFTRAFKQHDQENEQRLRLEKAAALAASKKENDQVLMRNKVNQKKQQLPSNGALSLQEAVINELKSKAHSVREKKLLQQDEVYNGALEDILLGLKSEPYRRADAVRRSQRRRIDNNRLSRTLEEMDC", "sequence_mut": "", "comment": "Loss of autoinhibition mediated by self-association results in severe eye defects including loss of R-cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9VUC6", "url": "https://www.uniprot.org/uniprotkb/Q9VUC6" }, { "database": "PubMed", "id": "26801180", "url": "https://pubmed.ncbi.nlm.nih.gov/26801180" } ], "uniprot_canonical_ac": "Q9VUC6-1" }, { "start_pos": 683, "end_pos": 1131, "sequence_org": "GAMTIKRKVPTKYKLPTLNWIALKPNQVRGTIFNELDDEKIFKQIDFNEFEERFKIGIGGALRNGSNGTEVDGSLQSSKRFKRPDNVSLLEHTRLRNIAISRRKLGMPIDDVIAAIHSLDLKKLSLENVELLQKMVPTDAEVKSYKEYIIERKDQQLLTEEDKFMLQLSRVERISSKLAIMNYMGNFVDSVHLISPQVQSIAGASTSLKQSRKFKAVLEIVLAFGNYLNSNKRGPAYGFKLQSLDTLIDTKSTDKRSSLLHYIVATIRAKFPELLNFESELYGTDKAASVALENVVADVQELEKGMDLVRKEAELRVKGAQTHILRDFLNNSEDKLKKIKSDLRHAQEAFKECVEYFGDSSRNADAAAFFALIVRFTRAFKQHDQENEQRLRLEKAAALAASKKENDQVLMRNKVNQKKQQLPSNGALSLQEAVINELKSKAHSVREKK", "sequence_mut": "", "comment": "Loss of autoinhibition mediated by self-association results in rotation defects in the adult eye.", "evidence": [ { "database": "UniProtKB", "id": "Q9VUC6", "url": "https://www.uniprot.org/uniprotkb/Q9VUC6" }, { "database": "PubMed", "id": "26801180", "url": "https://pubmed.ncbi.nlm.nih.gov/26801180" } ], "uniprot_canonical_ac": "Q9VUC6-1" } ], "record_id": "pubmed.26801180", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct morphogenetic functions of similar small GTPases: Drosophila Drac1 is involved in axonal outgrowth and myoblast fusion.", "journal": "Genes Dev.", "date": "1994", "authors": "Luo L, Liao Y J, Jan L Y, Jan Y N", "reference": { "type": "PubMed", "id": "7958857", "url": "https://pubmed.ncbi.nlm.nih.gov/7958857" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P40793-1", "protein_name": "Cdc42 homolog", "gene_name": "Cdc42", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P40792-1", "protein_name": "Ras-related protein Rac1", "gene_name": "Rac1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P40793", "url": "https://www.uniprot.org/uniprotkb/P40793" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7958857", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Drosophila homolog of the Rac- and Cdc42-activated serine/threonine kinase PAK is a potential focal adhesion and focal complex protein that colocalizes with dynamic actin structures.", "journal": "Mol. Cell. Biol.", "date": "1996", "authors": "Harden N, Lee J, Loh H Y, Ong Y M, Tan I, Leung T, Manser E, Lim L", "reference": { "type": "PubMed", "id": "8628256", "url": "https://pubmed.ncbi.nlm.nih.gov/8628256" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P40793-1", "protein_name": "Cdc42 homolog", "gene_name": "Cdc42", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P40792-1", "protein_name": "Ras-related protein Rac1", "gene_name": "Rac1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VI13-1", "protein_name": "Serine/threonine-protein kinase Pak", "gene_name": "Pak", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P40793", "url": "https://www.uniprot.org/uniprotkb/P40793" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8628256", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genghis Khan (Gek) as a putative effector for Drosophila Cdc42 and regulator of actin polymerization.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Luo L, Lee T, Tsai L, Tang G, Jan L Y, Jan Y N", "reference": { "type": "PubMed", "id": "9371783", "url": "https://pubmed.ncbi.nlm.nih.gov/9371783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P40793-1", "protein_name": "Cdc42 homolog", "gene_name": "Cdc42", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W1B0-1", "protein_name": "Serine/threonine-protein kinase Genghis Khan", "gene_name": "gek", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P40793", "url": "https://www.uniprot.org/uniprotkb/P40793" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9371783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A unique zinc finger protein is associated preferentially with active ecdysone-responsive loci in Drosophila.", "journal": "Genes & development", "date": "1991-02", "authors": "Amero S A, Elgin S C, Beyer A L", "reference": { "type": "PubMed", "id": "1899840", "url": "https://pubmed.ncbi.nlm.nih.gov/1899840" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P41073-1", "protein_name": "Zinc finger protein on ecdysone puffs", "gene_name": "Pep", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P41073", "url": "https://www.uniprot.org/uniprotkb/P41073" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1899840", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide variation at the runt locus in Drosophila melanogaster and Drosophila simulans.", "journal": "Mol. Biol. Evol.", "date": "1999", "authors": "Labate J A, Biermann C H, Eanes W F", "reference": { "type": "PubMed", "id": "10368951", "url": "https://pubmed.ncbi.nlm.nih.gov/10368951" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P22814-1", "protein_name": "Segmentation protein Runt", "gene_name": "run", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P22814", "url": "https://www.uniprot.org/uniprotkb/P22814" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10368951", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Non-African populations of Drosophila melanogaster have a unique origin.", "journal": "Mol. Biol. Evol.", "date": "2004", "authors": "Baudry Emmanuelle, Viginier Barbara, Veuille Michel", "reference": { "type": "PubMed", "id": "15014160", "url": "https://pubmed.ncbi.nlm.nih.gov/15014160" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P22814-1", "protein_name": "Segmentation protein Runt", "gene_name": "run", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P22814", "url": "https://www.uniprot.org/uniprotkb/P22814" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15014160", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Leukaemia/Drosophila homology.", "journal": "Nature", "date": "1992", "authors": "Daga A, Tighe J E, Calabi F", "reference": { "type": "PubMed", "id": "1560822", "url": "https://pubmed.ncbi.nlm.nih.gov/1560822" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P22814-1", "protein_name": "Segmentation protein Runt", "gene_name": "run", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q01196-1", "protein_name": "Runt-related transcription factor 1", "gene_name": "RUNX1", "tax_name": "Human" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P22814", "url": "https://www.uniprot.org/uniprotkb/P22814" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1560822", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila segmentation gene runt encodes a novel nuclear regulatory protein that is also expressed in the developing nervous system.", "journal": "Genes & development", "date": "1990", "authors": "Kania MA, Bonner AS, Duffy JB, Gergen JP", "reference": { "type": "PubMed", "id": "2249771", "url": "https://pubmed.ncbi.nlm.nih.gov/2249771" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P22814-1", "protein_name": "Segmentation protein Runt", "gene_name": "run", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P22814", "url": "https://www.uniprot.org/uniprotkb/P22814" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2249771", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "string of pearls encodes Drosophila ribosomal protein S2, has Minute-like characteristics, and is required during oogenesis.", "journal": "Genetics", "date": "1994-08", "authors": "Cramton S E, Laski F A", "reference": { "type": "PubMed", "id": "7982558", "url": "https://pubmed.ncbi.nlm.nih.gov/7982558" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31009-1", "protein_name": "Small ribosomal subunit protein uS5", "gene_name": "RpS2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P31009", "url": "https://www.uniprot.org/uniprotkb/P31009" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7982558", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning and analysis of the S2 ribosomal protein cDNA from Drosophila.", "journal": "Nucleic Acids Res.", "date": "1993", "authors": "Barrio R, del Arco A, Cabrera H, Arribas C", "reference": { "type": "PubMed", "id": "8441641", "url": "https://pubmed.ncbi.nlm.nih.gov/8441641" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P31009-1", "protein_name": "Small ribosomal subunit protein uS5", "gene_name": "RpS2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P31009", "url": "https://www.uniprot.org/uniprotkb/P31009" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8441641", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CYFIP/Sra-1 controls neuronal connectivity in Drosophila and links the Rac1 GTPase pathway to the fragile X protein.", "journal": "Neuron", "date": "2003", "authors": "Schenck Annette, Bardoni Barbara, Langmann Caillin, Harden Nicholas, Mandel Jean Louis, Giangrande Angela", "reference": { "type": "PubMed", "id": "12818175", "url": "https://pubmed.ncbi.nlm.nih.gov/12818175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P40792-1", "protein_name": "Ras-related protein Rac1", "gene_name": "Rac1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NFU0-1", "protein_name": "Fragile X messenger ribonucleoprotein 1 homolog", "gene_name": "Fmr1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VF87-1", "protein_name": "Cytoplasmic FMR1-interacting protein", "gene_name": "Cyfip", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P40792", "url": "https://www.uniprot.org/uniprotkb/P40792" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12818175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A dominant inhibitory version of the small GTP-binding protein Rac disrupts cytoskeletal structures and inhibits developmental cell shape changes in Drosophila.", "journal": "Development", "date": "1995", "authors": "Harden N, Loh H Y, Chia W, Lim L", "reference": { "type": "PubMed", "id": "7720592", "url": "https://pubmed.ncbi.nlm.nih.gov/7720592" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P40792-1", "protein_name": "Ras-related protein Rac1", "gene_name": "Rac1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P48554-1", "protein_name": "Ras-related protein Rac2", "gene_name": "Rac2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P40792", "url": "https://www.uniprot.org/uniprotkb/P40792" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7720592", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila cell survival gene discs lost encodes a cytoplasmic Codanin-1-like protein, not a homolog of tight junction PDZ protein Patj.", "journal": "Dev. Cell", "date": "2003", "authors": "Pielage Jan, Stork Tobias, Bunse Ingrid, Kl\u00e4mbt Christian", "reference": { "type": "PubMed", "id": "14667407", "url": "https://pubmed.ncbi.nlm.nih.gov/14667407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13395-1", "protein_name": "Spectrin alpha chain", "gene_name": "alpha-Spec", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9NB04-1", "protein_name": "Patj homolog", "gene_name": "Patj", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q8T626-1", "protein_name": "Protein disks lost", "gene_name": "dlt", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13395", "url": "https://www.uniprot.org/uniprotkb/P13395" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.14667407", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphatidylinositol 4,5-bisphosphate directs spermatid cell polarity and exocyst localization in Drosophila.", "journal": "Mol. Biol. Cell", "date": "2010", "authors": "Fabian Lacramioara, Wei Ho-Chun, Rollins Janet, Noguchi Tatsuhiko, Blankenship J Todd, Bellamkonda Kishan, Polevoy Gordon, Gervais Louis, Guichet Antoine, Fuller Margaret T, Brill Julie A", "reference": { "type": "PubMed", "id": "20237161", "url": "https://pubmed.ncbi.nlm.nih.gov/20237161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13395-1", "protein_name": "Spectrin alpha chain", "gene_name": "alpha-Spec", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P46150-1", "protein_name": "Moesin/ezrin/radixin homolog 1", "gene_name": "Moe", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V4P1-1", "protein_name": "Anillin", "gene_name": "scra", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9W2R3-1", "protein_name": "Phosphatidylinositol 4-phosphate 5-kinase type-1 sktl", "gene_name": "sktl", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13395", "url": "https://www.uniprot.org/uniprotkb/P13395" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.20237161", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Trans-synaptic Teneurin signalling in neuromuscular synapse organization and target choice.", "journal": "Nature", "date": "2012", "authors": "Mosca Timothy J, Hong Weizhe, Dani Vardhan S, Favaloro Vincenzo, Luo Liqun", "reference": { "type": "PubMed", "id": "22426000", "url": "https://pubmed.ncbi.nlm.nih.gov/22426000" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13395-1", "protein_name": "Spectrin alpha chain", "gene_name": "alpha-Spec", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O61307-1", "protein_name": "Teneurin-m", "gene_name": "Ten-m", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYN8-1", "protein_name": "Teneurin-a", "gene_name": "Ten-a", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13395", "url": "https://www.uniprot.org/uniprotkb/P13395" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.22426000", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila spectrin: the membrane skeleton during embryogenesis.", "journal": "J. Cell Biol.", "date": "1989", "authors": "Pesacreta T C, Byers T J, Dubreuil R, Kiehart D P, Branton D", "reference": { "type": "PubMed", "id": "2497103", "url": "https://pubmed.ncbi.nlm.nih.gov/2497103" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13395-1", "protein_name": "Spectrin alpha chain", "gene_name": "alpha-Spec", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13395", "url": "https://www.uniprot.org/uniprotkb/P13395" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2497103", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The complete sequence of Drosophila alpha-spectrin: conservation of structural domains between alpha-spectrins and alpha-actinin.", "journal": "J. Cell Biol.", "date": "1989", "authors": "Dubreuil R R, Byers T J, Sillman A L, Bar-Zvi D, Goldstein L S, Branton D", "reference": { "type": "PubMed", "id": "2808524", "url": "https://pubmed.ncbi.nlm.nih.gov/2808524" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13395-1", "protein_name": "Spectrin alpha chain", "gene_name": "alpha-Spec", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13395", "url": "https://www.uniprot.org/uniprotkb/P13395" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2808524", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophilia spectrin. I. Characterization of the purified protein.", "journal": "The Journal of cell biology", "date": "1987-11", "authors": "Dubreuil R, Byers T J, Branton D, Goldstein L S, Kiehart D P", "reference": { "type": "PubMed", "id": "3680372", "url": "https://pubmed.ncbi.nlm.nih.gov/3680372" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13395-1", "protein_name": "Spectrin alpha chain", "gene_name": "alpha-Spec", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q00963-1", "protein_name": "Spectrin beta chain", "gene_name": "beta-Spec", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13395", "url": "https://www.uniprot.org/uniprotkb/P13395" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.3680372", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the repetitive segments of spectrin.", "journal": "Science", "date": "1993", "authors": "Yan Y, Winograd E, Viel A, Cronin T, Harrison S C, Branton D", "reference": { "type": "PubMed", "id": "8266097", "url": "https://pubmed.ncbi.nlm.nih.gov/8266097" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13395-1", "protein_name": "Spectrin alpha chain", "gene_name": "alpha-Spec", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13395", "url": "https://www.uniprot.org/uniprotkb/P13395" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8266097", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell shape and interaction defects in alpha-spectrin mutants of Drosophila melanogaster.", "journal": "The Journal of cell biology", "date": "1993-12", "authors": "Lee J K, Coyne R S, Dubreuil R R, Goldstein L S, Branton D", "reference": { "type": "PubMed", "id": "8276898", "url": "https://pubmed.ncbi.nlm.nih.gov/8276898" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13395-1", "protein_name": "Spectrin alpha chain", "gene_name": "alpha-Spec", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13395", "url": "https://www.uniprot.org/uniprotkb/P13395" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8276898", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA and deduced amino acid sequence of Drosophila rp21C, another 'A'-type ribosomal protein.", "journal": "Nucleic Acids Res.", "date": "1987", "authors": "Wigboldus J D", "reference": { "type": "PubMed", "id": "3122177", "url": "https://pubmed.ncbi.nlm.nih.gov/3122177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08570-1", "protein_name": "Large ribosomal subunit protein P1", "gene_name": "RpLP1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P08570", "url": "https://www.uniprot.org/uniprotkb/P08570" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.3122177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila acidic ribosomal protein rpA2: sequence and characterization.", "journal": "J. Cell. Biochem.", "date": "1993", "authors": "Olson P F, Salo T, Garrison K, Fessler J H", "reference": { "type": "PubMed", "id": "8501137", "url": "https://pubmed.ncbi.nlm.nih.gov/8501137" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P08570-1", "protein_name": "Large ribosomal subunit protein P1", "gene_name": "RpLP1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P08570", "url": "https://www.uniprot.org/uniprotkb/P08570" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8501137", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of kraken, a gene encoding a putative hydrolytic enzyme in Drosophila melanogaster.", "journal": "Gene", "date": "1998", "authors": "Edwin Chan H Y, Harris S J, O'Kane C J", "reference": { "type": "PubMed", "id": "9831651", "url": "https://pubmed.ncbi.nlm.nih.gov/9831651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O18391-1", "protein_name": "Probable serine hydrolase", "gene_name": "kraken", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O18391", "url": "https://www.uniprot.org/uniprotkb/O18391" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9831651", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aberrant splicing of the Drosophila melanogaster phenylalanine hydroxylase pre-mRNA caused by the insertion of a B104/roo transposable element in the Henna locus.", "journal": "Insect Biochem. Mol. Biol.", "date": "1999", "authors": "Ruiz-V\u00e1zquez P, Silva F J", "reference": { "type": "PubMed", "id": "10333570", "url": "https://pubmed.ncbi.nlm.nih.gov/10333570" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17276-1", "protein_name": "Protein henna", "gene_name": "Hn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P17276", "url": "https://www.uniprot.org/uniprotkb/P17276" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10333570", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A single locus encodes both phenylalanine hydroxylase and tryptophan hydroxylase activities in Drosophila.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Neckameyer W S, White K", "reference": { "type": "PubMed", "id": "1371286", "url": "https://pubmed.ncbi.nlm.nih.gov/1371286" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17276-1", "protein_name": "Protein henna", "gene_name": "Hn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P17276", "url": "https://www.uniprot.org/uniprotkb/P17276" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1371286", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequence and expression of the Drosophila phenylalanine hydroxylase mRNA.", "journal": "Gene", "date": "1990", "authors": "Morales G, Requena J M, Jimenez-Ruiz A, Lopez M C, Ugarte M, Alonso C", "reference": { "type": "PubMed", "id": "2121612", "url": "https://pubmed.ncbi.nlm.nih.gov/2121612" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17276-1", "protein_name": "Protein henna", "gene_name": "Hn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P17276", "url": "https://www.uniprot.org/uniprotkb/P17276" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2121612", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the phenylalanine hydroxylase gene in Drosophila melanogaster and evidence of alternative promoter usage.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1996", "authors": "Ruiz-V\u00e1zquez P, Moulard M, Silva F J", "reference": { "type": "PubMed", "id": "8769124", "url": "https://pubmed.ncbi.nlm.nih.gov/8769124" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17276-1", "protein_name": "Protein henna", "gene_name": "Hn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P17276", "url": "https://www.uniprot.org/uniprotkb/P17276" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8769124", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The zinc finger protein schnurri acts as a Smad partner in mediating the transcriptional response to decapentaplegic.", "journal": "Developmental biology", "date": "2000-11-15", "authors": "Dai H, Hogan C, Gopalakrishnan B, Torres-Vazquez J, Nguyen M, Park S, Raftery L A, Warrior R, Arora K", "reference": { "type": "PubMed", "id": "11071761", "url": "https://pubmed.ncbi.nlm.nih.gov/11071761" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1Z8F4-1", "protein_name": "Protein schnurri", "gene_name": "shn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11071761", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The DSmurf ubiquitin-protein ligase restricts BMP signaling spatially and temporally during Drosophila embryogenesis.", "journal": "Dev. Cell", "date": "2001", "authors": "Podos S D, Hanson K K, Wang Y C, Ferguson E L", "reference": { "type": "PubMed", "id": "11703946", "url": "https://pubmed.ncbi.nlm.nih.gov/11703946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V853-1", "protein_name": "E3 ubiquitin-protein ligase Smurf1", "gene_name": "Smurf", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11703946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ACK family tyrosine kinase activity is a component of Dcdc42 signaling during dorsal closure in Drosophila melanogaster.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Sem KP, Zahedi B, Tan I, Deak M, Lim L, Harden N", "reference": { "type": "PubMed", "id": "11997505", "url": "https://pubmed.ncbi.nlm.nih.gov/11997505" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VZI2-1", "protein_name": "Activated Cdc42 kinase Ack", "gene_name": "Ack", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 156, "end_pos": 156, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of enzyme activity. Many embryos die before hatching. Fails to promote yki-dependent tissue growth in the eye and wing. Overexpression in wing imaginal disks frequently results in wings with blisters and ectopic veins. Eyes are disorganized and ommatidia are almost completely absent, eye bristles are not present in posterior two-thirds of the eye and bristle clusters occur at the anterior end. Increased Egfr endocytosis in embryos. No effect on Dpp expression in the leading edge cells.", "evidence": [ { "database": "UniProtKB", "id": "Q9VZI2", "url": "https://www.uniprot.org/uniprotkb/Q9VZI2" }, { "database": "PubMed", "id": "23579691", "url": "https://pubmed.ncbi.nlm.nih.gov/23579691" }, { "database": "PubMed", "id": "11997505", "url": "https://pubmed.ncbi.nlm.nih.gov/11997505" }, { "database": "PubMed", "id": "27462444", "url": "https://pubmed.ncbi.nlm.nih.gov/27462444" } ], "uniprot_canonical_ac": "Q9VZI2-1" } ], "record_id": "pubmed.11997505", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Conversion of an extracellular Dpp/BMP morphogen gradient into an inverse transcriptional gradient.", "journal": "Cell", "date": "2003-04-18", "authors": "M\u00fcller Bruno, Hartmann Britta, Pyrowolakis George, Affolter Markus, Basler Konrad", "reference": { "type": "PubMed", "id": "12705870", "url": "https://pubmed.ncbi.nlm.nih.gov/12705870" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1Z8F4-1", "protein_name": "Protein schnurri", "gene_name": "shn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12705870", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "dSmurf selectively degrades decapentaplegic-activated MAD, and its overexpression disrupts imaginal disc development.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Liang YY, Lin X, Liang M, Brunicardi FC, ten Dijke P, Chen Z, Choi KW, Feng XH", "reference": { "type": "PubMed", "id": "12754252", "url": "https://pubmed.ncbi.nlm.nih.gov/12754252" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V853-1", "protein_name": "E3 ubiquitin-protein ligase Smurf1", "gene_name": "Smurf", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 453, "end_pos": 455, "sequence_org": "SVS", "sequence_mut": "AVA", "comment": "Abolishes interaction with lack.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "12754252", "url": "https://pubmed.ncbi.nlm.nih.gov/12754252" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 1029, "end_pos": 1029, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes E3 ubiquitin-protein ligase activity. No change in interaction with MAD.", "evidence": [ { "database": "UniProtKB", "id": "Q9V853", "url": "https://www.uniprot.org/uniprotkb/Q9V853" }, { "database": "PubMed", "id": "12754252", "url": "https://pubmed.ncbi.nlm.nih.gov/12754252" }, { "database": "PubMed", "id": "24302888", "url": "https://pubmed.ncbi.nlm.nih.gov/24302888" } ], "uniprot_canonical_ac": "Q9V853-1" }, { "start_pos": 541, "end_pos": 541, "sequence_org": "W", "sequence_mut": "F", "comment": "Abolishes interaction with MAD; when associated with A-544.", "evidence": [ { "database": "UniProtKB", "id": "Q9V853", "url": "https://www.uniprot.org/uniprotkb/Q9V853" }, { "database": "PubMed", "id": "12754252", "url": "https://pubmed.ncbi.nlm.nih.gov/12754252" } ], "uniprot_canonical_ac": "Q9V853-1" }, { "start_pos": 544, "end_pos": 544, "sequence_org": "P", "sequence_mut": "A", "comment": "Abolishes interaction with MAD; when associated with F-541.", "evidence": [ { "database": "UniProtKB", "id": "Q9V853", "url": "https://www.uniprot.org/uniprotkb/Q9V853" }, { "database": "PubMed", "id": "12754252", "url": "https://pubmed.ncbi.nlm.nih.gov/12754252" } ], "uniprot_canonical_ac": "Q9V853-1" } ], "phosphorylation": [ { "start_pos": 453, "end_pos": 453, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "12754252", "url": "https://pubmed.ncbi.nlm.nih.gov/12754252" }, { "database": "PubMed", "id": "18327897", "url": "https://pubmed.ncbi.nlm.nih.gov/18327897" }, { "database": "iPTMnet", "id": "P42003", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42003" } ], "site_lbl": "Ser453", "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 455, "end_pos": 455, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "12754252", "url": "https://pubmed.ncbi.nlm.nih.gov/12754252" }, { "database": "PubMed", "id": "18327897", "url": "https://pubmed.ncbi.nlm.nih.gov/18327897" }, { "database": "iPTMnet", "id": "P42003", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42003" } ], "site_lbl": "Ser455", "uniprot_canonical_ac": "P42003-1" } ], "record_id": "pubmed.12754252", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stepwise formation of a SMAD activity gradient during dorsal-ventral patterning of the Drosophila embryo.", "journal": "Development (Cambridge, England)", "date": "2003-12", "authors": "Sutherland David J, Li Mingfa, Liu Xiao-Qing, Stefancsik Raymund, Raftery Laurel A", "reference": { "type": "PubMed", "id": "14534137", "url": "https://pubmed.ncbi.nlm.nih.gov/14534137" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24025-1", "protein_name": "Dorsal-ventral patterning protein Sog", "gene_name": "sog", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.14534137", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A simple molecular complex mediates widespread BMP-induced repression during Drosophila development.", "journal": "Developmental cell", "date": "2004-08", "authors": "Pyrowolakis George, Hartmann Britta, M\u00fcller Bruno, Basler Konrad, Affolter Markus", "reference": { "type": "PubMed", "id": "15296719", "url": "https://pubmed.ncbi.nlm.nih.gov/15296719" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1Z8F4-1", "protein_name": "Protein schnurri", "gene_name": "shn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15296719", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dpp-responsive silencers are bound by a trimeric Mad-Medea complex.", "journal": "The Journal of biological chemistry", "date": "2005-10-28", "authors": "Gao Sheng, Steffen Janet, Laughon Allen", "reference": { "type": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1Z8F4-1", "protein_name": "Protein schnurri", "gene_name": "shn", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 42, "end_pos": 42, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 46, "end_pos": 46, "sequence_org": "K", "sequence_mut": "A", "comment": "Slightly reduces formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 49, "end_pos": 49, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 53, "end_pos": 53, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 54, "end_pos": 54, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 56, "end_pos": 56, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 57, "end_pos": 57, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 58, "end_pos": 58, "sequence_org": "R", "sequence_mut": "A", "comment": "Prevents formation of a DNA binding Mad-Med complex, May be involved in protein-protein interactions.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 59, "end_pos": 59, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 88, "end_pos": 88, "sequence_org": "R", "sequence_mut": "A", "comment": "Prevents formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 90, "end_pos": 90, "sequence_org": "Q", "sequence_mut": "A", "comment": "Prevents formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 93, "end_pos": 93, "sequence_org": "H", "sequence_mut": "A", "comment": "Reduces formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 95, "end_pos": 95, "sequence_org": "K", "sequence_mut": "A", "comment": "Prevents formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 109, "end_pos": 109, "sequence_org": "R", "sequence_mut": "A", "comment": "Prevents formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 111, "end_pos": 111, "sequence_org": "Q", "sequence_mut": "A", "comment": "Prevents formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 116, "end_pos": 116, "sequence_org": "K", "sequence_mut": "A", "comment": "Prevents formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 65, "end_pos": 65, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 66, "end_pos": 66, "sequence_org": "R", "sequence_mut": "A", "comment": "Slightly reduces formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 73, "end_pos": 73, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 74, "end_pos": 74, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 76, "end_pos": 76, "sequence_org": "K", "sequence_mut": "A", "comment": "Slightly reduces formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 77, "end_pos": 77, "sequence_org": "E", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 78, "end_pos": 78, "sequence_org": "K", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 79, "end_pos": 79, "sequence_org": "R", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 80, "end_pos": 80, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces formation of a DNA binding Mad-Med complex, probably by disrupting DNA binding.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 81, "end_pos": 81, "sequence_org": "E", "sequence_mut": "A", "comment": "No effect on DNA binding Mad-Med complex formation.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "16109720", "url": "https://pubmed.ncbi.nlm.nih.gov/16109720" } ], "uniprot_canonical_ac": "O62609-1" } ], "record_id": "pubmed.16109720", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "dSno facilitates baboon signaling in the Drosophila brain by switching the affinity of Medea away from Mad and toward dSmad2.", "journal": "Genetics", "date": "2006", "authors": "Takaesu Norma T, Hyman-Walsh Cathy, Ye Ying, Wisotzkey Robert G, Stinchfield Michael J, O'connor Michael B, Wotton David, Newfeld Stuart J", "reference": { "type": "PubMed", "id": "16951053", "url": "https://pubmed.ncbi.nlm.nih.gov/16951053" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "A1Z7L8-1", "protein_name": "Receptor protein serine/threonine kinase babo", "gene_name": "babo", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O96660-1", "protein_name": "SMAD family member 2", "gene_name": "Smox", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16951053", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila Nemo antagonizes BMP signaling by phosphorylation of Mad and inhibition of its nuclear accumulation.", "journal": "Development (Cambridge, England)", "date": "2007", "authors": "Zeng YA, Rahnama M, Wang S, Sosu-Sedzorme W, Verheyen EM", "reference": { "type": "PubMed", "id": "17507407", "url": "https://pubmed.ncbi.nlm.nih.gov/17507407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 25, "end_pos": 25, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "17507407", "url": "https://pubmed.ncbi.nlm.nih.gov/17507407" } ], "uniprot_canonical_ac": "P42003-1" } ], "phosphorylation": [ { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "17507407", "url": "https://pubmed.ncbi.nlm.nih.gov/17507407" }, { "database": "iPTMnet", "id": "P42003", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42003" }, { "database": "PubMed", "id": "19451277", "url": "https://pubmed.ncbi.nlm.nih.gov/19451277" } ], "site_lbl": "Ser25", "uniprot_canonical_ac": "P42003-1" } ], "record_id": "pubmed.17507407", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nemo kinase interacts with Mad to coordinate synaptic growth at the Drosophila neuromuscular junction.", "journal": "The Journal of cell biology", "date": "2009-05-18", "authors": "Merino Carlos, Penney Jay, Gonz\u00e1lez Miranda, Tsurudome Kazuya, Moujahidine Myriam, O'Connor Michael B, Verheyen Esther M, Haghighi Pejmun", "reference": { "type": "PubMed", "id": "19451277", "url": "https://pubmed.ncbi.nlm.nih.gov/19451277" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "phosphorylation": [ { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "17507407", "url": "https://pubmed.ncbi.nlm.nih.gov/17507407" }, { "database": "iPTMnet", "id": "P42003", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42003" }, { "database": "PubMed", "id": "19451277", "url": "https://pubmed.ncbi.nlm.nih.gov/19451277" } ], "site_lbl": "Ser25", "uniprot_canonical_ac": "P42003-1" } ], "record_id": "pubmed.19451277", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of the MH2 domain of Drosophila Mad.", "journal": "Sci. China, Ser. C, Life Sci.", "date": "2009", "authors": "WANG Chong, CHEN Lei, WANG Le, WU JiaWei", "reference": { "type": "PubMed", "id": "19557331", "url": "https://pubmed.ncbi.nlm.nih.gov/19557331" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.19557331", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila LEM-domain protein MAN1 antagonizes BMP signaling at the neuromuscular junction and the wing crossveins.", "journal": "Dev. Biol.", "date": "2010", "authors": "Wagner Nicole, Weyhersm\u00fcller Annika, Blauth Anna, Schuhmann Tamara, Heckmann Manfred, Krohne Georg, Samakovlis Christos", "reference": { "type": "PubMed", "id": "20036230", "url": "https://pubmed.ncbi.nlm.nih.gov/20036230" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VLU0-1", "protein_name": "Barrier-to-autointegration factor", "gene_name": "baf", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7JRE4-1", "protein_name": "Inner nuclear membrane protein Man1", "gene_name": "MAN1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.20036230", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic screens to identify elements of the decapentaplegic signaling pathway in Drosophila.", "journal": "Genetics", "date": "1995-01", "authors": "Raftery L A, Twombly V, Wharton K, Gelbart W M", "reference": { "type": "PubMed", "id": "7705627", "url": "https://pubmed.ncbi.nlm.nih.gov/7705627" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7705627", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic characterization and cloning of mothers against dpp, a gene required for decapentaplegic function in Drosophila melanogaster.", "journal": "Genetics", "date": "1995", "authors": "Sekelsky JJ, Newfeld SJ, Raftery LA, Chartoff EH, Gelbart WM", "reference": { "type": "PubMed", "id": "7768443", "url": "https://pubmed.ncbi.nlm.nih.gov/7768443" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 409, "end_pos": 409, "sequence_org": "G", "sequence_mut": "S", "comment": "In allele Mad-10; pupal lethal.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "7768443", "url": "https://pubmed.ncbi.nlm.nih.gov/7768443" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 421, "end_pos": 421, "sequence_org": "S", "sequence_mut": "L", "comment": "In allele Mad-9; lethal.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "7768443", "url": "https://pubmed.ncbi.nlm.nih.gov/7768443" } ], "uniprot_canonical_ac": "P42003-1" } ], "record_id": "pubmed.7768443", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of Medea, a gene required for maximal function of the Drosophila BMP homolog Decapentaplegic.", "journal": "Annals of the New York Academy of Sciences", "date": "1996-06-08", "authors": "Raftery L A, Wisotzkey R G", "reference": { "type": "PubMed", "id": "8702167", "url": "https://pubmed.ncbi.nlm.nih.gov/8702167" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8702167", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Medea is a Drosophila Smad4 homolog that is differentially required to potentiate DPP responses.", "journal": "Development (Cambridge, England)", "date": "1998-04", "authors": "Wisotzkey R G, Mehra A, Sutherland D J, Dobens L L, Liu X, Dohrmann C, Attisano L, Raftery L A", "reference": { "type": "PubMed", "id": "9502724", "url": "https://pubmed.ncbi.nlm.nih.gov/9502724" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 452, "end_pos": 455, "sequence_org": "SSVS", "sequence_mut": "AAVA", "comment": "Reduces total level of phosphorylation. Abrogates interaction with Med. Prevents tkv induced nuclear localization of itself and Med.", "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" }, { "database": "PubMed", "id": "9502724", "url": "https://pubmed.ncbi.nlm.nih.gov/9502724" } ], "uniprot_canonical_ac": "P42003-1" }, { "start_pos": 727, "end_pos": 727, "sequence_org": "G", "sequence_mut": "D", "comment": "In allele Medea6; larval lethal. Abrogates interaction with Mad and prevents Mad-mediated nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "9502724", "url": "https://pubmed.ncbi.nlm.nih.gov/9502724" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 728, "end_pos": 771, "sequence_org": "WGPDYPRQSIKETPCWIEVHLHRALQLLDEVLHAMPIDGPRAAA", "sequence_mut": "", "comment": "In allele Medea8; larval lethal with ventralized cuticles. Abrogates interaction with Mad. Protein is unstable.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "9502724", "url": "https://pubmed.ncbi.nlm.nih.gov/9502724" } ], "uniprot_canonical_ac": "O62609-1" }, { "start_pos": 99, "end_pos": 99, "sequence_org": "C", "sequence_mut": "S", "comment": "In allele Medea7; larval lethal. Does not abrogate interaction with Mad but does prevent Mad-mediated nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "O62609", "url": "https://www.uniprot.org/uniprotkb/O62609" }, { "database": "PubMed", "id": "9502724", "url": "https://pubmed.ncbi.nlm.nih.gov/9502724" } ], "uniprot_canonical_ac": "O62609-1" } ], "record_id": "pubmed.9502724", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila gene Medea demonstrates the requirement for different classes of Smads in dpp signaling.", "journal": "Development (Cambridge, England)", "date": "1998-04", "authors": "Das P, Maduzia L L, Wang H, Finelli A L, Cho S H, Smith M M, Padgett R W", "reference": { "type": "PubMed", "id": "9502733", "url": "https://pubmed.ncbi.nlm.nih.gov/9502733" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9502733", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Smad proteins act in combination with synergistic and antagonistic regulators to target Dpp responses to the Drosophila mesoderm.", "journal": "Genes & development", "date": "1998-08-01", "authors": "Xu X, Yin Z, Hudson J B, Ferguson E L, Frasch M", "reference": { "type": "PubMed", "id": "9694800", "url": "https://pubmed.ncbi.nlm.nih.gov/9694800" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42003-1", "protein_name": "Protein mothers against dpp", "gene_name": "Mad", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P22711-1", "protein_name": "Muscle-specific homeobox protein tinman", "gene_name": "tin", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O62609-1", "protein_name": "SMAD family member 4", "gene_name": "Med", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42003", "url": "https://www.uniprot.org/uniprotkb/P42003" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9694800", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Key residues revealed in a major conformational epitope of the U1-70K protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999-12-07", "authors": "Welin Henriksson E, Wahren-Herlenius M, Lundberg I, Mellquist E, Pettersson I", "reference": { "type": "PubMed", "id": "10588732", "url": "https://pubmed.ncbi.nlm.nih.gov/10588732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17133-1", "protein_name": "U1 small nuclear ribonucleoprotein 70 kDa", "gene_name": "snRNP-U1-70K", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P17133", "url": "https://www.uniprot.org/uniprotkb/P17133" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10588732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila U1-70K protein is required for viability, but its arginine-rich domain is dispensable.", "journal": "Genetics", "date": "2004-12", "authors": "Salz Helen K, Mancebo Ricardo S Y, Nagengast Alexis A, Speck Olga, Psotka Mitchell, Mount Stephen M", "reference": { "type": "PubMed", "id": "15611175", "url": "https://pubmed.ncbi.nlm.nih.gov/15611175" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17133-1", "protein_name": "U1 small nuclear ribonucleoprotein 70 kDa", "gene_name": "snRNP-U1-70K", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P17133", "url": "https://www.uniprot.org/uniprotkb/P17133" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15611175", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis of the interaction between P-element somatic inhibitor and U1-70k essential for the alternative splicing of P-element transposase.", "journal": "J. Mol. Biol.", "date": "2005", "authors": "Ignjatovic Tijana, Yang Ji-Chun, Butler Jonathan, Neuhaus David, Nagai Kiyoshi", "reference": { "type": "PubMed", "id": "15990112", "url": "https://pubmed.ncbi.nlm.nih.gov/15990112" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17133-1", "protein_name": "U1 small nuclear ribonucleoprotein 70 kDa", "gene_name": "snRNP-U1-70K", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P17133", "url": "https://www.uniprot.org/uniprotkb/P17133" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15990112", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and expression of the Drosophila melanogaster gene for the U1 small nuclear ribonucleoprotein particle 70K protein.", "journal": "Mol. Cell. Biol.", "date": "1990", "authors": "Mancebo R, Lo P C, Mount S M", "reference": { "type": "PubMed", "id": "1692955", "url": "https://pubmed.ncbi.nlm.nih.gov/1692955" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17133-1", "protein_name": "U1 small nuclear ribonucleoprotein 70 kDa", "gene_name": "snRNP-U1-70K", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P17133", "url": "https://www.uniprot.org/uniprotkb/P17133" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1692955", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evolution of an RNP assembly system: a minimal SMN complex facilitates formation of UsnRNPs in Drosophila melanogaster.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2008", "authors": "Kroiss Matthias, Schultz J\u00f6rg, Wiesner Julia, Chari Ashwin, Sickmann Albert, Fischer Utz", "reference": { "type": "PubMed", "id": "18621711", "url": "https://pubmed.ncbi.nlm.nih.gov/18621711" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17133-1", "protein_name": "U1 small nuclear ribonucleoprotein 70 kDa", "gene_name": "snRNP-U1-70K", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "O44437-1", "protein_name": "Small nuclear ribonucleoprotein Sm D3", "gene_name": "SmD3", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P43332-1", "protein_name": "U1 small nuclear ribonucleoprotein A", "gene_name": "snf", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VV74-1", "protein_name": "Survival motor neuron protein", "gene_name": "Smn", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q05856-1", "protein_name": "Small nuclear ribonucleoprotein-associated protein B", "gene_name": "SmB", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24297-1", "protein_name": "Small nuclear ribonucleoprotein F", "gene_name": "SmF", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9V4Q8-1", "protein_name": "Probable U2 small nuclear ribonucleoprotein A'", "gene_name": "U2A", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VI10-1", "protein_name": "Probable small nuclear ribonucleoprotein Sm D2", "gene_name": "SmD2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VLV5-1", "protein_name": "Probable small nuclear ribonucleoprotein E", "gene_name": "SmE", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VU02-1", "protein_name": "Probable small nuclear ribonucleoprotein Sm D1", "gene_name": "SmD1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VVX0-1", "protein_name": "Gem-associated protein 2", "gene_name": "Gem2", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VXE0-1", "protein_name": "Probable small nuclear ribonucleoprotein G", "gene_name": "SNRPG", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P17133", "url": "https://www.uniprot.org/uniprotkb/P17133" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18621711", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila tissue polarity requires the cell-autonomous activity of the fuzzy gene, which encodes a novel transmembrane protein.", "journal": "Development (Cambridge, England)", "date": "1997-10", "authors": "Collier S, Gubb D", "reference": { "type": "PubMed", "id": "9374400", "url": "https://pubmed.ncbi.nlm.nih.gov/9374400" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O16868-1", "protein_name": "Protein fuzzy", "gene_name": "fuz; fy", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O16868", "url": "https://www.uniprot.org/uniprotkb/O16868" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9374400", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila ninaC locus encodes two photoreceptor cell specific proteins with domains homologous to protein kinases and the myosin heavy chain head.", "journal": "Cell", "date": "1988-03-11", "authors": "Montell C, Rubin G M", "reference": { "type": "PubMed", "id": "2449973", "url": "https://pubmed.ncbi.nlm.nih.gov/2449973" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P10676-1", "protein_name": "Neither inactivation nor afterpotential protein C", "gene_name": "ninaC", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P10676", "url": "https://www.uniprot.org/uniprotkb/P10676" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2449973", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The mesodermal expression of rolling stone (rost) is essential for myoblast fusion in Drosophila and encodes a potential transmembrane protein.", "journal": "The Journal of cell biology", "date": "1997-07-28", "authors": "Paululat A, Goubeaud A, Damm C, Knirr S, Burchard S, Renkawitz-Pohl R", "reference": { "type": "PubMed", "id": "9230076", "url": "https://pubmed.ncbi.nlm.nih.gov/9230076" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O44252-1", "protein_name": "Protein rolling stone", "gene_name": "rost", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O44252", "url": "https://www.uniprot.org/uniprotkb/O44252" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9230076", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reduced synaptic vesicle protein degradation at lysosomes curbs TBC1D24/sky-induced neurodegeneration.", "journal": "The Journal of cell biology", "date": "2014", "authors": "Fernandes AC, Uytterhoeven V, Kuenen S, Wang YC, Slabbaert JR, Swerts J, Kasprowicz J, Aerts S, Verstreken P", "reference": { "type": "PubMed", "id": "25422373", "url": "https://pubmed.ncbi.nlm.nih.gov/25422373" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VIH7-1", "protein_name": "GTPase-activating protein skywalker", "gene_name": "sky", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q24314-1", "protein_name": "Vacuolar protein sorting-associated protein 18 homolog", "gene_name": "dor", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VIH7", "url": "https://www.uniprot.org/uniprotkb/Q9VIH7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 508, "end_pos": 1002, "sequence_org": "RVTTKPMETDELDEDKMNIIKALVIWLIDLYLIQINMPDKDEEWRSSWQTEYDEFMMEAHVLSCTRQNRETVRQLIAEHADPRNMAQFAIAIGDYDEVVAQQLKAECYAEALQTLINQRNPELFYKYAPELITRLPKPTVDALMAQGSRLEVEKLVPTLIIMENREQREQTQRYLEFAIYKLNTTNDAIHNFLLHLYAEHEPKLLMKYLEIQGRDESLVHYDIYYAHKVCTDLDVKEARVFLECMLRKWISAVDLALTFDMKLAKETASRPSDSKIRRKLWLRIAYHDIKGTNDVKKALNLLKECDLLRIEDLLPFFADFEKIDNFKEAICDALRDYNQRIQELQREMAETTEQTDRVTAELQQLRQHSLTVESQDTCEICEMMLLVKPFFIFICGHKFHSDCLEKHVVPLLTKEQCRRLGTLKQQLEAEVQTQAQPQSGALSKQQAMELQRKRAALKTEIEDILAADCLFCGLLISTIDQPFVDDWEQVNVEWE", "sequence_mut": "", "comment": "In dor-36; reduced endolysosomal trafficking and thus reduced number of effective vesicles released in response to a nerve impulse (quantal content). This is likely largely due to the reduction in readily releasable vesicles. Accumulation of the mature form of CtsL1/Cathepsin L. Expression in sky mutants partially rescues increased neurotransmitter release at the larval neuromuscular junction and neurodegeneration in the retina. However it does not rescue the excessive recycling of vesicles to endosomal compartments in sky mutants.", "evidence": [ { "database": "UniProtKB", "id": "Q24314", "url": "https://www.uniprot.org/uniprotkb/Q24314" }, { "database": "PubMed", "id": "25422373", "url": "https://pubmed.ncbi.nlm.nih.gov/25422373" } ], "uniprot_canonical_ac": "Q24314-1" }, { "start_pos": 551, "end_pos": 1002, "sequence_org": "WRSSWQTEYDEFMMEAHVLSCTRQNRETVRQLIAEHADPRNMAQFAIAIGDYDEVVAQQLKAECYAEALQTLINQRNPELFYKYAPELITRLPKPTVDALMAQGSRLEVEKLVPTLIIMENREQREQTQRYLEFAIYKLNTTNDAIHNFLLHLYAEHEPKLLMKYLEIQGRDESLVHYDIYYAHKVCTDLDVKEARVFLECMLRKWISAVDLALTFDMKLAKETASRPSDSKIRRKLWLRIAYHDIKGTNDVKKALNLLKECDLLRIEDLLPFFADFEKIDNFKEAICDALRDYNQRIQELQREMAETTEQTDRVTAELQQLRQHSLTVESQDTCEICEMMLLVKPFFIFICGHKFHSDCLEKHVVPLLTKEQCRRLGTLKQQLEAEVQTQAQPQSGALSKQQAMELQRKRAALKTEIEDILAADCLFCGLLISTIDQPFVDDWEQVNVEWE", "sequence_mut": "", "comment": "In dor-30; Accumulation of the mature form of CtsL1/Cathepsin L.", "evidence": [ { "database": "UniProtKB", "id": "Q24314", "url": "https://www.uniprot.org/uniprotkb/Q24314" }, { "database": "PubMed", "id": "25422373", "url": "https://pubmed.ncbi.nlm.nih.gov/25422373" } ], "uniprot_canonical_ac": "Q24314-1" } ], "record_id": "pubmed.25422373", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Skywalker-TBC1D24 has a lipid-binding pocket mutated in epilepsy and required for synaptic function.", "journal": "Nature structural & molecular biology", "date": "2016", "authors": "Fischer B, Luthy K, Paesmans J, De Koninck C, Maes I, Swerts J, Kuenen S, Uytterhoeven V, Verstreken P, Versees W", "reference": { "type": "PubMed", "id": "27669036", "url": "https://pubmed.ncbi.nlm.nih.gov/27669036" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9VIH7-1", "protein_name": "GTPase-activating protein skywalker", "gene_name": "sky", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "Q9VIH7", "url": "https://www.uniprot.org/uniprotkb/Q9VIH7" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "mutagenesis": [ { "start_pos": 281, "end_pos": 281, "sequence_org": "R", "sequence_mut": "C", "comment": "Reduced binding to liposomes under low phosphatidylinositol 4,5-bisphosphate (PIP2) concentrations. Reduced binding to inositol 1,4,5-trisphosphate (IP3). In contrast to wild-type, expression only partially rescues the accumulation of sub-boutonic foci.", "evidence": [ { "database": "UniProtKB", "id": "Q9VIH7", "url": "https://www.uniprot.org/uniprotkb/Q9VIH7" }, { "database": "PubMed", "id": "27669036", "url": "https://pubmed.ncbi.nlm.nih.gov/27669036" } ], "uniprot_canonical_ac": "Q9VIH7-1" }, { "start_pos": 335, "end_pos": 335, "sequence_org": "R", "sequence_mut": "P", "comment": "Little effect on binding to liposomes, phosphatidylinositol 4,5-bisphosphate and inositol 1,4,5-trisphosphate.", "evidence": [ { "database": "UniProtKB", "id": "Q9VIH7", "url": "https://www.uniprot.org/uniprotkb/Q9VIH7" }, { "database": "PubMed", "id": "27669036", "url": "https://pubmed.ncbi.nlm.nih.gov/27669036" } ], "uniprot_canonical_ac": "Q9VIH7-1" }, { "start_pos": 79, "end_pos": 79, "sequence_org": "R", "sequence_mut": "C", "comment": "Loss of binding to liposomes containing phosphoinositides. In contrast to wild-type protein whose expression largely rescues mutant phenotypes, expression in mutant neurons only partially rescues the increase in synapse mobility and the abherent accumulation of large cisternal or endosomal-like structures in pre-synaptic terminals observed in mutants. In addition, the number of mutants displaying defective motor coordination, defective flight, hyperactivity, increased temperature sensitivity and seziures is increased compared to mutants expressing wild-type protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9VIH7", "url": "https://www.uniprot.org/uniprotkb/Q9VIH7" }, { "database": "PubMed", "id": "27669036", "url": "https://pubmed.ncbi.nlm.nih.gov/27669036" } ], "uniprot_canonical_ac": "Q9VIH7-1" } ], "record_id": "pubmed.27669036", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Down-regulation of RpS21, a putative translation initiation factor interacting with P40, produces viable minute imagos and larval lethality with overgrown hematopoietic organs and imaginal discs.", "journal": "Molecular and cellular biology", "date": "1999-03", "authors": "T\u00f6r\u00f6k I, Herrmann-Horle D, Kiss I, Tick G, Speer G, Schmitt R, Mechler B M", "reference": { "type": "PubMed", "id": "10022917", "url": "https://pubmed.ncbi.nlm.nih.gov/10022917" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O76927-1", "protein_name": "Small ribosomal subunit protein eS21", "gene_name": "RpS21", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "P38979-1", "protein_name": "Small ribosomal subunit protein uS2", "gene_name": "sta", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O76927", "url": "https://www.uniprot.org/uniprotkb/O76927" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.10022917", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila melanogaster homologue of the human BBC1 gene is highly expressed during embryogenesis.", "journal": "Gene", "date": "1995", "authors": "Helps N R, Adams S M, Brammar W J, Varley J M", "reference": { "type": "PubMed", "id": "7557437", "url": "https://pubmed.ncbi.nlm.nih.gov/7557437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P41126-1", "protein_name": "Large ribosomal subunit protein eL13", "gene_name": "RpL13", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P41126", "url": "https://www.uniprot.org/uniprotkb/P41126" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7557437", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila RNA polymerase II elongation factor DmS-II has homology to mouse S-II and sequence similarity to yeast PPR2.", "journal": "Nucleic Acids Res.", "date": "1990", "authors": "Marshall T K, Guo H, Price D H", "reference": { "type": "PubMed", "id": "2243775", "url": "https://pubmed.ncbi.nlm.nih.gov/2243775" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20232-1", "protein_name": "Transcription elongation factor S-II", "gene_name": "TfIIS", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P20232", "url": "https://www.uniprot.org/uniprotkb/P20232" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2243775", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of the gene encoding the Drosophila melanogaster transcriptional elongation factor, TFIIS.", "journal": "Biochim. Biophys. Acta", "date": "1995", "authors": "Oh Y, Yoon J, Baek K", "reference": { "type": "PubMed", "id": "7772609", "url": "https://pubmed.ncbi.nlm.nih.gov/7772609" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P20232-1", "protein_name": "Transcription elongation factor S-II", "gene_name": "TfIIS", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P20232", "url": "https://www.uniprot.org/uniprotkb/P20232" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7772609", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The nucleotide sequence of cDNA for a Drosophila ribosomal protein with homology to rat ribosomal protein S26.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Itoh N, Ohta K, Ohta M, Kawasaki T, Yamashina I", "reference": { "type": "PubMed", "id": "2911474", "url": "https://pubmed.ncbi.nlm.nih.gov/2911474" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13008-1", "protein_name": "Small ribosomal subunit protein eS26", "gene_name": "RpS26", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13008", "url": "https://www.uniprot.org/uniprotkb/P13008" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2911474", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The nucleotide sequence of a gene for a putative ribosomal protein S31 of Drosophila.", "journal": "Nucleic Acids Res.", "date": "1989", "authors": "Itoh N, Ohta K, Ohta M, Kawasaki T, Yamashina I", "reference": { "type": "PubMed", "id": "2928115", "url": "https://pubmed.ncbi.nlm.nih.gov/2928115" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13008-1", "protein_name": "Small ribosomal subunit protein eS26", "gene_name": "RpS26", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P13008", "url": "https://www.uniprot.org/uniprotkb/P13008" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2928115", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila melanogaster diphenol oxidase A2: gene structure and homology with the mouse mast-cell tum- transplantation antigen, P91A.", "journal": "Gene", "date": "1991", "authors": "Pentz E S, Wright T R", "reference": { "type": "PubMed", "id": "1909680", "url": "https://pubmed.ncbi.nlm.nih.gov/1909680" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25161-1", "protein_name": "Probable 26S proteasome non-ATPase regulatory subunit 3", "gene_name": "Rpn3", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P25161", "url": "https://www.uniprot.org/uniprotkb/P25161" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1909680", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila AP3, a presumptive DNA repair protein, is homologous to human ribosomal associated protein P0.", "journal": "Nucleic Acids Res.", "date": "1991", "authors": "Grabowski D T, Deutsch W A, Derda D, Kelley M R", "reference": { "type": "PubMed", "id": "1870984", "url": "https://pubmed.ncbi.nlm.nih.gov/1870984" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19889-1", "protein_name": "Large ribosomal subunit protein uL10", "gene_name": "RpLP0", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P19889", "url": "https://www.uniprot.org/uniprotkb/P19889" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.1870984", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Antibody to a human DNA repair protein allows for cloning of a Drosophila cDNA that encodes an apurinic endonuclease.", "journal": "Mol. Cell. Biol.", "date": "1989", "authors": "Kelley M R, Venugopal S, Harless J, Deutsch W A", "reference": { "type": "PubMed", "id": "2471063", "url": "https://pubmed.ncbi.nlm.nih.gov/2471063" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19889-1", "protein_name": "Large ribosomal subunit protein uL10", "gene_name": "RpLP0", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P19889", "url": "https://www.uniprot.org/uniprotkb/P19889" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.2471063", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila ribosomal protein PO contains apurinic/apyrimidinic endonuclease activity.", "journal": "Nucleic Acids Res.", "date": "1996", "authors": "Yacoub A, Kelley MR, Deutsch WA", "reference": { "type": "PubMed", "id": "8932386", "url": "https://pubmed.ncbi.nlm.nih.gov/8932386" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P19889-1", "protein_name": "Large ribosomal subunit protein uL10", "gene_name": "RpLP0", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P19889", "url": "https://www.uniprot.org/uniprotkb/P19889" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8932386", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila Ten-m and filamin affect motor neuron growth cone guidance.", "journal": "PloS one", "date": "2011", "authors": "Zheng Lihua, Michelson Yehudit, Freger Vita, Avraham Ziva, Venken Koen J T, Bellen Hugo J, Justice Monica J, Wides Ron", "reference": { "type": "PubMed", "id": "21857973", "url": "https://pubmed.ncbi.nlm.nih.gov/21857973" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O61307-1", "protein_name": "Teneurin-m", "gene_name": "Ten-m", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VEN1-1", "protein_name": "Filamin-A", "gene_name": "cher", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O61307", "url": "https://www.uniprot.org/uniprotkb/O61307" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.21857973", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Teneurins instruct synaptic partner matching in an olfactory map.", "journal": "Nature", "date": "2012-03-18", "authors": "Hong Weizhe, Mosca Timothy J, Luo Liqun", "reference": { "type": "PubMed", "id": "22425994", "url": "https://pubmed.ncbi.nlm.nih.gov/22425994" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O61307-1", "protein_name": "Teneurin-m", "gene_name": "Ten-m", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VYN8-1", "protein_name": "Teneurin-a", "gene_name": "Ten-a", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O61307", "url": "https://www.uniprot.org/uniprotkb/O61307" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.22425994", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Odd Oz: a novel Drosophila pair rule gene.", "journal": "Cell", "date": "1994", "authors": "Levine A, Bashan-Ahrend A, Budai-Hadrian O, Gartenberg D, Menasherow S, Wides R", "reference": { "type": "PubMed", "id": "7514504", "url": "https://pubmed.ncbi.nlm.nih.gov/7514504" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O61307-1", "protein_name": "Teneurin-m", "gene_name": "Ten-m", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O61307", "url": "https://www.uniprot.org/uniprotkb/O61307" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.7514504", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tenm, a Drosophila gene related to tenascin, is a new pair-rule gene.", "journal": "EMBO J.", "date": "1994", "authors": "Baumgartner S, Martin D, Hagios C, Chiquet-Ehrismann R", "reference": { "type": "PubMed", "id": "8070401", "url": "https://pubmed.ncbi.nlm.nih.gov/8070401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O61307-1", "protein_name": "Teneurin-m", "gene_name": "Ten-m", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O61307", "url": "https://www.uniprot.org/uniprotkb/O61307" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8070401", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The genetics and molecular structure of the Drosophila pair-rule gene odd Oz (odz).", "journal": "Gene", "date": "1997", "authors": "Levine A, Gartenberg D, Yakov R, Lieberman Y, Budai-Hadrian O, Bashan-Ahrend A, Wides R", "reference": { "type": "PubMed", "id": "9373139", "url": "https://pubmed.ncbi.nlm.nih.gov/9373139" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O61307-1", "protein_name": "Teneurin-m", "gene_name": "Ten-m", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O61307", "url": "https://www.uniprot.org/uniprotkb/O61307" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9373139", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Jarid2 Methylation via the PRC2 Complex Regulates H3K27me3 Deposition during Cell Differentiation.", "journal": "Molecular cell", "date": "2015-03-05", "authors": "Sanulli Serena, Justin Neil, Teissandier Aur\u00e9lie, Ancelin Katia, Portoso Manuela, Caron Matthieu, Michaud Audrey, Lombard Berang\u00e8re, da Rocha Simao T, Offer John, Loew Damarys, Servant Nicolas, Wassef Michel, Burlina Fabienne, Gamblin Steve J, Heard Edith, Margueron Rapha\u00ebl", "reference": { "type": "PubMed", "id": "25620564", "url": "https://pubmed.ncbi.nlm.nih.gov/25620564" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42124-1", "protein_name": "Histone-lysine N-methyltransferase E(z)", "gene_name": "E(z)", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VT00-1", "protein_name": "Jumonji, AT rich interactive domain protein 2", "gene_name": "Jarid2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42124", "url": "https://www.uniprot.org/uniprotkb/P42124" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.25620564", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila Polycomb-group gene Enhancer of zeste contains a region with sequence similarity to trithorax.", "journal": "Mol. Cell. Biol.", "date": "1993", "authors": "Jones R S, Gelbart W M", "reference": { "type": "PubMed", "id": "8413234", "url": "https://pubmed.ncbi.nlm.nih.gov/8413234" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42124-1", "protein_name": "Histone-lysine N-methyltransferase E(z)", "gene_name": "E(z)", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42124", "url": "https://www.uniprot.org/uniprotkb/P42124" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.8413234", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Drosophila Enhancer of zeste gene encodes a chromosomal protein: examination of wild-type and mutant protein distribution.", "journal": "Development", "date": "1996", "authors": "Carrington E A, Jones R S", "reference": { "type": "PubMed", "id": "9012527", "url": "https://pubmed.ncbi.nlm.nih.gov/9012527" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P42124-1", "protein_name": "Histone-lysine N-methyltransferase E(z)", "gene_name": "E(z)", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "P42124", "url": "https://www.uniprot.org/uniprotkb/P42124" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9012527", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The isolation, localization and characterization of the QM homolog in Drosophila melanogaster.", "journal": "DNA Seq.", "date": "1997", "authors": "Nguyen-Yue Y H, Loftus T M, Torok T, Bryant P, Stanbridge E J", "reference": { "type": "PubMed", "id": "9524813", "url": "https://pubmed.ncbi.nlm.nih.gov/9524813" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O61231-1", "protein_name": "Large ribosomal subunit protein uL16", "gene_name": "RpL10", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O61231", "url": "https://www.uniprot.org/uniprotkb/O61231" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9524813", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The invertebrate odorant-binding protein LUSH is required for normal olfactory behavior in Drosophila.", "journal": "Chemical senses", "date": "2001-02", "authors": "Kim M S, Smith D P", "reference": { "type": "PubMed", "id": "11238251", "url": "https://pubmed.ncbi.nlm.nih.gov/11238251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O02372-1", "protein_name": "General odorant-binding protein lush", "gene_name": "lush", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O02372", "url": "https://www.uniprot.org/uniprotkb/O02372" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11238251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression mosaic of odorant-binding proteins in Drosophila olfactory organs.", "journal": "Microsc. Res. Tech.", "date": "2001", "authors": "Shanbhag S R, Hekmat-Scafe D, Kim M S, Park S K, Carlson J R, Pikielny C, Smith D P, Steinbrecht R A", "reference": { "type": "PubMed", "id": "11754509", "url": "https://pubmed.ncbi.nlm.nih.gov/11754509" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O02372-1", "protein_name": "General odorant-binding protein lush", "gene_name": "lush", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O02372", "url": "https://www.uniprot.org/uniprotkb/O02372" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.11754509", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster.", "journal": "Nat. Struct. Biol.", "date": "2003", "authors": "Kruse Schoen W, Zhao Rui, Smith Dean P, Jones David N M", "reference": { "type": "PubMed", "id": "12881720", "url": "https://pubmed.ncbi.nlm.nih.gov/12881720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O02372-1", "protein_name": "General odorant-binding protein lush", "gene_name": "lush", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O02372", "url": "https://www.uniprot.org/uniprotkb/O02372" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.12881720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Revisiting the odorant-binding protein LUSH of Drosophila melanogaster: evidence for odour recognition and discrimination.", "journal": "FEBS letters", "date": "2004-01-30", "authors": "Zhou Jing-Jiang, Zhang Guo-An, Huang Wensheng, Birkett Michael A, Field Linda M, Pickett John A, Pelosi Paolo", "reference": { "type": "PubMed", "id": "14759510", "url": "https://pubmed.ncbi.nlm.nih.gov/14759510" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O02372-1", "protein_name": "General odorant-binding protein lush", "gene_name": "lush", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O02372", "url": "https://www.uniprot.org/uniprotkb/O02372" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.14759510", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drosophila OBP LUSH is required for activity of pheromone-sensitive neurons.", "journal": "Neuron", "date": "2005-01-20", "authors": "Xu Pingxi, Atkinson Rachel, Jones David N M, Smith Dean P", "reference": { "type": "PubMed", "id": "15664171", "url": "https://pubmed.ncbi.nlm.nih.gov/15664171" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O02372-1", "protein_name": "General odorant-binding protein lush", "gene_name": "lush", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O02372", "url": "https://www.uniprot.org/uniprotkb/O02372" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.15664171", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A pheromone receptor mediates 11-cis-vaccenyl acetate-induced responses in Drosophila.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2006-08-23", "authors": "Ha Tal Soo, Smith Dean P", "reference": { "type": "PubMed", "id": "16928861", "url": "https://pubmed.ncbi.nlm.nih.gov/16928861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O02372-1", "protein_name": "General odorant-binding protein lush", "gene_name": "lush", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VT92-1", "protein_name": "Odorant receptor 67d", "gene_name": "Or67d", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O02372", "url": "https://www.uniprot.org/uniprotkb/O02372" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.16928861", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An essential role for a CD36-related receptor in pheromone detection in Drosophila.", "journal": "Nature", "date": "2007-11-08", "authors": "Benton Richard, Vannice Kirsten S, Vosshall Leslie B", "reference": { "type": "PubMed", "id": "17943085", "url": "https://pubmed.ncbi.nlm.nih.gov/17943085" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O02372-1", "protein_name": "General odorant-binding protein lush", "gene_name": "lush", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VT92-1", "protein_name": "Odorant receptor 67d", "gene_name": "Or67d", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VDD3-1", "protein_name": "Sensory neuron membrane protein 1", "gene_name": "Snmp1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VNB5-1", "protein_name": "Odorant receptor coreceptor", "gene_name": "Orco", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O02372", "url": "https://www.uniprot.org/uniprotkb/O02372" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.17943085", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Activation of pheromone-sensitive neurons is mediated by conformational activation of pheromone-binding protein.", "journal": "Cell", "date": "2008-06-27", "authors": "Laughlin John D, Ha Tal Soo, Jones David N M, Smith Dean P", "reference": { "type": "PubMed", "id": "18585358", "url": "https://pubmed.ncbi.nlm.nih.gov/18585358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O02372-1", "protein_name": "General odorant-binding protein lush", "gene_name": "lush", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O02372", "url": "https://www.uniprot.org/uniprotkb/O02372" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.18585358", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LUSH odorant-binding protein mediates chemosensory responses to alcohols in Drosophila melanogaster.", "journal": "Genetics", "date": "1998-10", "authors": "Kim M S, Repp A, Smith D P", "reference": { "type": "PubMed", "id": "9755202", "url": "https://pubmed.ncbi.nlm.nih.gov/9755202" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O02372-1", "protein_name": "General odorant-binding protein lush", "gene_name": "lush", "tax_name": "Fruit fly" } ], "species": [ { "name": "Drosophila melanogaster", "taxid": 7227, "evidence": [ { "database": "UniProtKB", "id": "O02372", "url": "https://www.uniprot.org/uniprotkb/O02372" } ], "common_name": "Fruit fly", "glygen_name": "Fruit fly", "reference_species": "Drosophila melanogaster [7227]" } ], "record_id": "pubmed.9755202", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]