[ { "title": "Localization and domain characterization of Arabidopsis golgin candidates.", "journal": "J. Exp. Bot.", "date": "2007", "authors": "Latijnhouwers Maita, Gillespie Trudi, Boevink Petra, Kriechbaumer Verena, Hawes Chris, Carvalho Claudine M", "reference": { "type": "PubMed", "id": "18182439", "url": "https://pubmed.ncbi.nlm.nih.gov/18182439" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B0F9L7-1", "protein_name": "Golgin candidate 2", "gene_name": "GC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8S8N9-1", "protein_name": "Golgin candidate 1", "gene_name": "GC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SMR4-1", "protein_name": "Ras-related protein RABH1c", "gene_name": "RABH1C", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VYU6-1", "protein_name": "Golgin candidate 4", "gene_name": "GC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WVL7-1", "protein_name": "Golgin candidate 5", "gene_name": "GC5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80501-1", "protein_name": "Ras-related protein RABH1b", "gene_name": "RABH1B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P28188-1", "protein_name": "Ras-related protein RABD2a", "gene_name": "RABD2A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZRE2-1", "protein_name": "Ras-related protein RABD1", "gene_name": "RABD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84WU4-1", "protein_name": "Golgin candidate 3", "gene_name": "GC3; GDAP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B0F9L4-1", "protein_name": "Golgin candidate 6", "gene_name": "GC6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B0F9L7", "url": "https://www.uniprot.org/uniprotkb/B0F9L7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18182439", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel interaction partner for the C-terminus of Arabidopsis thaliana plasma membrane H+-ATPase (AHA1 isoform): site and mechanism of action on H+-ATPase activity differ from those of 14-3-3 proteins.", "journal": "Plant J.", "date": "2002", "authors": "Morandini Piero, Valera Marco, Albumi Cristina, Bonza Maria Cristina, Giacometti Sonia, Ravera Giuseppe, Murgia Irene, Soave Carlo, De Michelis Maria Ida", "reference": { "type": "PubMed", "id": "12182706", "url": "https://pubmed.ncbi.nlm.nih.gov/12182706" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B3H4K7-1", "protein_name": "Proton pump-interactor 2", "gene_name": "PPI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0DKC0-1", "protein_name": "Proton pump-interactor 3B", "gene_name": "PPI3B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0DKC1-1", "protein_name": "Proton pump-interactor 3A", "gene_name": "PPI3A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VZN4-1", "protein_name": "Proton pump-interactor 4", "gene_name": "PPI4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O23144-1", "protein_name": "Proton pump-interactor 1", "gene_name": "PPI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P20649-1", "protein_name": "ATPase 1, plasma membrane-type", "gene_name": "AHA1; HA1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B3H4K7", "url": "https://www.uniprot.org/uniprotkb/B3H4K7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12182706", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The proton pump interactor (Ppi) gene family of Arabidopsis thaliana: expression pattern of Ppi1 and characterisation of knockout mutants for Ppi1 and 2.", "journal": "Plant Biol.", "date": "2008", "authors": "Anzi C, Pelucchi P, Vazzola V, Murgia I, Gomarasca S, Piccoli M Beretta, Morandini P", "reference": { "type": "PubMed", "id": "18304198", "url": "https://pubmed.ncbi.nlm.nih.gov/18304198" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B3H4K7-1", "protein_name": "Proton pump-interactor 2", "gene_name": "PPI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O23144-1", "protein_name": "Proton pump-interactor 1", "gene_name": "PPI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B3H4K7", "url": "https://www.uniprot.org/uniprotkb/B3H4K7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18304198", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel nucleus-encoded chloroplast protein, PIFI, is involved in NAD(P)H dehydrogenase complex-mediated chlororespiratory electron transport in Arabidopsis.", "journal": "Plant physiology", "date": "2007-08", "authors": "Wang Dafu, Portis Archie R", "reference": { "type": "PubMed", "id": "17573537", "url": "https://pubmed.ncbi.nlm.nih.gov/17573537" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVZ5-1", "protein_name": "Protein POST-ILLUMINATION CHLOROPHYLL FLUORESCENCE INCREASE, chloroplastic", "gene_name": "PIFI", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVZ5", "url": "https://www.uniprot.org/uniprotkb/Q9LVZ5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17573537", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The SUMO E3 ligase-like proteins PIAL1 and PIAL2 interact with MOM1 and form a novel complex required for transcriptional silencing.", "journal": "Plant Cell", "date": "2016", "authors": "Han Yong-Feng, Zhao Qiu-Yuan, Dang Liang-Liang, Luo Yu-Xi, Chen Shan-Shan, Shao Chang-Rong, Huang Huan-Wei, Li Yong-Qiang, Li Lin, Cai Tao, Chen She, He Xin-Jian", "reference": { "type": "PubMed", "id": "27113777", "url": "https://pubmed.ncbi.nlm.nih.gov/27113777" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B3H578-1", "protein_name": "PHD finger-containing protein 1", "gene_name": "PHD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RXT5-1", "protein_name": "ASI1-immunoprecipitated protein 3", "gene_name": "AIPP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A0A0A7EPL0-1", "protein_name": "E4 SUMO-protein ligase PIAL1", "gene_name": "PIAL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JYG0-1", "protein_name": "E4 SUMO-protein ligase PIAL2", "gene_name": "PIAL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M658-1", "protein_name": "Helicase protein MOM1", "gene_name": "MOM1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B3H578", "url": "https://www.uniprot.org/uniprotkb/B3H578" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 329, "end_pos": 329, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolished SUMO ligase activity but normal ability to regulate transcriptional gene silencing (TGS); when associated with A-331. Slight reduction of SUMO ligase activity; when associated with A-355. Complete loss of activity; when associated with A-355 and 425-A--A-428.", "evidence": [ { "database": "UniProtKB", "id": "F4JYG0", "url": "https://www.uniprot.org/uniprotkb/F4JYG0" }, { "database": "PubMed", "id": "25415977", "url": "https://pubmed.ncbi.nlm.nih.gov/25415977" }, { "database": "PubMed", "id": "27113777", "url": "https://pubmed.ncbi.nlm.nih.gov/27113777" } ], "uniprot_canonical_ac": "F4JYG0-1" }, { "start_pos": 331, "end_pos": 331, "sequence_org": "H", "sequence_mut": "A", "comment": "Abolished SUMO ligase activity but normal ability to regulate transcriptional gene silencing (TGS); when associated with A-329.", "evidence": [ { "database": "UniProtKB", "id": "F4JYG0", "url": "https://www.uniprot.org/uniprotkb/F4JYG0" }, { "database": "PubMed", "id": "27113777", "url": "https://pubmed.ncbi.nlm.nih.gov/27113777" } ], "uniprot_canonical_ac": "F4JYG0-1" }, { "start_pos": 425, "end_pos": 428, "sequence_org": "VFDL", "sequence_mut": "AAAA", "comment": "Slight reduction of SUMO ligase activity but normal ability to regulate transcriptional gene silencing (TGS). Complete loss of activity; when associated with A-329 and A-355.", "evidence": [ { "database": "UniProtKB", "id": "F4JYG0", "url": "https://www.uniprot.org/uniprotkb/F4JYG0" }, { "database": "PubMed", "id": "27113777", "url": "https://pubmed.ncbi.nlm.nih.gov/27113777" }, { "database": "PubMed", "id": "25415977", "url": "https://pubmed.ncbi.nlm.nih.gov/25415977" } ], "uniprot_canonical_ac": "F4JYG0-1" } ], "record_id": "pubmed.27113777", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A histone H3K27me3 reader cooperates with a family of PHD finger-containing proteins to regulate flowering time in Arabidopsis.", "journal": "Journal of integrative plant biology", "date": "2021-04", "authors": "Qian Feng, Zhao Qiu-Yuan, Zhang Tie-Nan, Li Yu-Lu, Su Yin-Na, Li Lin, Sui Jian-Hua, Chen She, He Xin-Jian", "reference": { "type": "PubMed", "id": "33433058", "url": "https://pubmed.ncbi.nlm.nih.gov/33433058" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B3H578-1", "protein_name": "PHD finger-containing protein 1", "gene_name": "PHD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4KE59-1", "protein_name": "Protein PARALOG OF AIPP2", "gene_name": "PAIPP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4K200-1", "protein_name": "PHD finger-containing protein 6", "gene_name": "MAF19.12; PHD6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RXT5-1", "protein_name": "ASI1-immunoprecipitated protein 3", "gene_name": "AIPP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNQ5-1", "protein_name": "PHD finger-containing protein 5", "gene_name": "MAF19.10; PHD5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNQ4-1", "protein_name": "PHD finger-containing protein 4", "gene_name": "PHD4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5YDB5-1", "protein_name": "RNA polymerase II C-terminal domain phosphatase-like 2", "gene_name": "CPL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IYH6-1", "protein_name": "ASI1-immunoprecipitated protein 2", "gene_name": "AIPP2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B3H578", "url": "https://www.uniprot.org/uniprotkb/B3H578" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 170, "end_pos": 170, "sequence_org": "W", "sequence_mut": "A", "comment": "Lost binding to methylated histone H3 lysine 27 (H3K27me3, H3K27me2 and H3K27me1). Not able to rescue disruption phenotype. Not able to rescue disruption phenotype; when associated with A-149 and A-172.", "evidence": [ { "database": "UniProtKB", "id": "Q8RXT5", "url": "https://www.uniprot.org/uniprotkb/Q8RXT5" }, { "database": "PubMed", "id": "33433058", "url": "https://pubmed.ncbi.nlm.nih.gov/33433058" }, { "database": "PubMed", "id": "33277495", "url": "https://pubmed.ncbi.nlm.nih.gov/33277495" } ], "uniprot_canonical_ac": "Q8RXT5-1" }, { "start_pos": 170, "end_pos": 170, "sequence_org": "W", "sequence_mut": "L", "comment": "Lost binding to methylated histone H3 lysine 27 (H3K27me3, H3K27me2 and H3K27me1) and accelerated flowering time under long-day conditions; when associated with A-172.", "evidence": [ { "database": "UniProtKB", "id": "Q8RXT5", "url": "https://www.uniprot.org/uniprotkb/Q8RXT5" }, { "database": "PubMed", "id": "33433058", "url": "https://pubmed.ncbi.nlm.nih.gov/33433058" } ], "uniprot_canonical_ac": "Q8RXT5-1" }, { "start_pos": 172, "end_pos": 172, "sequence_org": "Y", "sequence_mut": "A", "comment": "Lost binding to trimethylated histone H3 lysine 27 (H3K27me3). Lost binding to methylated histone H3 lysine 27 (H3K27me3, H3K27me2 and H3K27me1) and accelerated flowering time under long-day conditions; when associated with L-170. Not able to rescue disruption phenotype; when associated with A-149 and A-172.", "evidence": [ { "database": "UniProtKB", "id": "Q8RXT5", "url": "https://www.uniprot.org/uniprotkb/Q8RXT5" }, { "database": "PubMed", "id": "33277495", "url": "https://pubmed.ncbi.nlm.nih.gov/33277495" }, { "database": "PubMed", "id": "33433058", "url": "https://pubmed.ncbi.nlm.nih.gov/33433058" } ], "uniprot_canonical_ac": "Q8RXT5-1" } ], "record_id": "pubmed.33433058", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis thaliana ABSCISIC ACID-INSENSITIVE8 encodes a novel protein mediating abscisic acid and sugar responses essential for growth.", "journal": "Plant Cell", "date": "2004", "authors": "Brocard-Gifford In\u00e8s, Lynch Tim J, Garcia M Emily, Malhotra Bhupinder, Finkelstein Ruth R", "reference": { "type": "PubMed", "id": "14742875", "url": "https://pubmed.ncbi.nlm.nih.gov/14742875" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B3H5R0-1", "protein_name": "Glycosyltransferase-like At2g41451", "gene_name": "T26J13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XV99-1", "protein_name": "Glycosyltransferase-like At3g57200", "gene_name": "F28O9.50", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C9Z9-1", "protein_name": "Glycosyltransferase-like KOBITO 1", "gene_name": "ELD1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B3H5R0", "url": "https://www.uniprot.org/uniprotkb/B3H5R0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14742875", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The elongation defective1 mutant of Arabidopsis is impaired in the gene encoding a serine-rich secreted protein.", "journal": "Plant Mol. Biol.", "date": "2003", "authors": "Lertpiriyapong Kvin, Sung Zinmay Renee", "reference": { "type": "PubMed", "id": "15010620", "url": "https://pubmed.ncbi.nlm.nih.gov/15010620" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B3H5R0-1", "protein_name": "Glycosyltransferase-like At2g41451", "gene_name": "T26J13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5XV99-1", "protein_name": "Glycosyltransferase-like At3g57200", "gene_name": "F28O9.50", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C9Z9-1", "protein_name": "Glycosyltransferase-like KOBITO 1", "gene_name": "ELD1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B3H5R0", "url": "https://www.uniprot.org/uniprotkb/B3H5R0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15010620", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Breaking the WAVE complex: the point of Arabidopsis trichomes.", "journal": "Curr. Opin. Plant Biol.", "date": "2005", "authors": "Szymanski Daniel B", "reference": { "type": "PubMed", "id": "15653407", "url": "https://pubmed.ncbi.nlm.nih.gov/15653407" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B3H6Y2-1", "protein_name": "Actin-related protein 2/3 complex subunit 5B", "gene_name": "ARPC5B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJW6-1", "protein_name": "Actin-related protein 2/3 complex subunit 1B", "gene_name": "ARPC1B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80856-1", "protein_name": "Actin-related protein 2/3 complex subunit 1A", "gene_name": "ARPC1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IVU1-1", "protein_name": "Actin-related protein 2/3 complex subunit 2B", "gene_name": "ARPC2B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JUL9-1", "protein_name": "Actin-related protein 2/3 complex subunit 4", "gene_name": "ARPC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LGI3-1", "protein_name": "Actin-related protein 2/3 complex subunit 2A", "gene_name": "ARPC2A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LSD6-1", "protein_name": "Actin-related protein 2", "gene_name": "ARP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1ECJ7-1", "protein_name": "Actin-related protein 2/3 complex subunit 3", "gene_name": "ARPC3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M117-1", "protein_name": "Actin-related protein 2/3 complex subunit 5A", "gene_name": "ARPC5A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SAF1-1", "protein_name": "Actin-related protein 3", "gene_name": "ARP3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B3H6Y2", "url": "https://www.uniprot.org/uniprotkb/B3H6Y2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15653407", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Variations in CYP74B2 (hydroperoxide lyase) gene expression differentially affect hexenal signaling in the Columbia and Landsberg erecta ecotypes of Arabidopsis.", "journal": "Plant Physiol.", "date": "2005", "authors": "Duan Hui, Huang Meng-Yu, Palacio Kathryn, Schuler Mary A", "reference": { "type": "PubMed", "id": "16258015", "url": "https://pubmed.ncbi.nlm.nih.gov/16258015" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B3LF83-1", "protein_name": "Probable inactive linolenate hydroperoxide lyase", "gene_name": "CYP74B2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B3LF83", "url": "https://www.uniprot.org/uniprotkb/B3LF83" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16258015", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of an Arabidopsis gene encoding hydroperoxide lyase, a cytochrome P-450 that is wound inducible.", "journal": "Plant Physiol.", "date": "1998", "authors": "Bate N J, Sivasankar S, Moxon C, Riley J M, Thompson J E, Rothstein S J", "reference": { "type": "PubMed", "id": "9701595", "url": "https://pubmed.ncbi.nlm.nih.gov/9701595" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B3LF83-1", "protein_name": "Probable inactive linolenate hydroperoxide lyase", "gene_name": "CYP74B2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B3LF83", "url": "https://www.uniprot.org/uniprotkb/B3LF83" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9701595", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homogalacturonan synthesis in Arabidopsis thaliana requires a Golgi-localized protein with a putative methyltransferase domain.", "journal": "Plant J.", "date": "2007", "authors": "Mouille Gr\u00e9gory, Ralet Marie-Christine, Cavelier C\u00e9line, Eland Cathlene, Effroy Delphine, H\u00e9maty Kian, McCartney Lesley, Truong Hoai Nam, Gaudon Virginie, Thibault Jean-Fran\u00e7ois, Marchant Alan, H\u00f6fte Herman", "reference": { "type": "PubMed", "id": "17425712", "url": "https://pubmed.ncbi.nlm.nih.gov/17425712" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "B9DFI7-1", "protein_name": "Probable methyltransferase PMT2", "gene_name": "T2P11.4; T2P11_4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H118-1", "protein_name": "Probable methyltransferase PMT1", "gene_name": "MLM24.3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93YV7-1", "protein_name": "Probable methyltransferase PMT3", "gene_name": "FCAALL.222; dl3220c", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C9Q8-1", "protein_name": "Probable pectin methyltransferase QUA2", "gene_name": "QUA2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "B9DFI7", "url": "https://www.uniprot.org/uniprotkb/B9DFI7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17425712", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Computational identification and analysis of immune-associated nucleotide gene family in Arabidopsis thaliana.", "journal": "J. Plant Physiol.", "date": "2008", "authors": "Liu Chuang, Wang Tao, Zhang Wensheng, Li Xia", "reference": { "type": "PubMed", "id": "17723251", "url": "https://pubmed.ncbi.nlm.nih.gov/17723251" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4HT21-1", "protein_name": "Immune-associated nucleotide-binding protein 9", "gene_name": "IAN9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9T0F4-1", "protein_name": "Immune-associated nucleotide-binding protein 13", "gene_name": "IAN13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9T0F3-1", "protein_name": "Immune-associated nucleotide-binding protein 12", "gene_name": "IAN12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9T0F2-1", "protein_name": "Immune-associated nucleotide-binding protein 11", "gene_name": "IAN11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81025-1", "protein_name": "Immune-associated nucleotide-binding protein 10", "gene_name": "IAN10; PP2-A3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P54120-1", "protein_name": "Immune-associated nucleotide-binding protein 8", "gene_name": "AIG1; IAN8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8U2-1", "protein_name": "Immune-associated nucleotide-binding protein 1", "gene_name": "IAN1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8V2-1", "protein_name": "Immune-associated nucleotide-binding protein 7", "gene_name": "IAN7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8U5-1", "protein_name": "Immune-associated nucleotide-binding protein 2", "gene_name": "IAN2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8U6-1", "protein_name": "Immune-associated nucleotide-binding protein 3", "gene_name": "IAN3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8U7-1", "protein_name": "Immune-associated nucleotide-binding protein 4", "gene_name": "IAN4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8U8-1", "protein_name": "Immune-associated nucleotide-binding protein 5", "gene_name": "IAN5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8V0-1", "protein_name": "Immune-associated nucleotide-binding protein 6", "gene_name": "IAN6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4HT21", "url": "https://www.uniprot.org/uniprotkb/F4HT21" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17723251", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis STICHEL gene is a regulator of trichome branch number and encodes a novel protein.", "journal": "Plant Physiol.", "date": "2003", "authors": "Ilgenfritz Hilmar, Bouyer Daniel, Schnittger Arp, Mathur Jaideep, Kirik Victor, Schwab Birgit, Chua Nam-Hai, J\u00fcrgens Gerd, H\u00fclskamp Martin", "reference": { "type": "PubMed", "id": "12586888", "url": "https://pubmed.ncbi.nlm.nih.gov/12586888" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4HW65-1", "protein_name": "Protein STICHEL-like 1", "gene_name": "F14L17.24", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JRP8-1", "protein_name": "Protein STICHEL-like 2", "gene_name": "F22K18.10; F6I7.13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JRP0-1", "protein_name": "Protein STICHEL-like 3", "gene_name": "F28A21.230", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4KEM0-1", "protein_name": "Protein STICHEL-like 4", "gene_name": "MRA19.13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64728-1", "protein_name": "Protein STICHEL", "gene_name": "STI", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4HW65", "url": "https://www.uniprot.org/uniprotkb/F4HW65" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12586888", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic organization, transcript variants and comparative analysis of the human nucleoporin 155 (NUP155) gene.", "journal": "Gene", "date": "2002-04-17", "authors": "Zhang Xiuqing, Yang Huanming, Yu Jun, Chen Cong, Zhang Guangyu, Bao Jingyue, Du Yutao, Kibukawa Miho, Li Zhijie, Wang Jun, Hu Songnian, Dong Wei, Wang Jian, Gregersen Niels, Niebuhr Erik, Bolund Lars", "reference": { "type": "PubMed", "id": "12034489", "url": "https://pubmed.ncbi.nlm.nih.gov/12034489" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4HXV6-1", "protein_name": "Nuclear pore complex protein NUP155", "gene_name": "NUP155", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O75694-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "NUP155", "tax_name": "Human" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4HXV6", "url": "https://www.uniprot.org/uniprotkb/F4HXV6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12034489", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NUCLEAR FUSION DEFECTIVE1 encodes the Arabidopsis RPL21M protein and is required for karyogamy during female gametophyte development and fertilization.", "journal": "Plant physiology", "date": "2006-07", "authors": "Portereiko Michael F, Sandaklie-Nikolova Linda, Lloyd Alan, Dever Chad A, Otsuga Denichiro, Drews Gary N", "reference": { "type": "PubMed", "id": "16698901", "url": "https://pubmed.ncbi.nlm.nih.gov/16698901" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4I9E1-1", "protein_name": "Protein NUCLEAR FUSION DEFECTIVE 4", "gene_name": "NFD4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LEZ4-1", "protein_name": "Small ribosomal subunit protein mS77 (rPPR2)", "gene_name": "NFD5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VZT8-1", "protein_name": "Small ribosomal subunit protein uS11m", "gene_name": "NFD3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FYL8-1", "protein_name": "Protein NUCLEAR FUSION DEFECTIVE 2", "gene_name": "NFD2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93ZJ3-1", "protein_name": "Protein NUCLEAR FUSION DEFECTIVE 6, mitochondrial", "gene_name": "NFD6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LDF9-1", "protein_name": "High mobility group B protein 7", "gene_name": "HMGB6; HMGB7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L9A0-1", "protein_name": "Large ribosomal subunit protein bL21m", "gene_name": "RPL21M", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q05153-1", "protein_name": "FACT complex subunit SSRP1", "gene_name": "SSRP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SGS2-1", "protein_name": "High mobility group B protein 9", "gene_name": "HMGB9", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4I9E1", "url": "https://www.uniprot.org/uniprotkb/F4I9E1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16698901", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lectin-mediated resistance impairs plant virus infection at the cellular level.", "journal": "Plant Cell", "date": "2012", "authors": "Yamaji Yasuyuki, Maejima Kensaku, Ozeki Johji, Komatsu Ken, Shiraishi Takuya, Okano Yukari, Himeno Misako, Sugawara Kyoko, Neriya Yutaro, Minato Nami, Miura Chihiro, Hashimoto Masayoshi, Namba Shigetou", "reference": { "type": "PubMed", "id": "22307853", "url": "https://pubmed.ncbi.nlm.nih.gov/22307853" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4I9R6-1", "protein_name": "Jacalin-related lectin 15", "gene_name": "JAL15", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4I9R6", "url": "https://www.uniprot.org/uniprotkb/F4I9R6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22307853", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The expansin superfamily.", "journal": "Genome biology", "date": "2005", "authors": "Sampedro Javier, Cosgrove Daniel J", "reference": { "type": "PubMed", "id": "16356276", "url": "https://pubmed.ncbi.nlm.nih.gov/16356276" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4IBJ3-1", "protein_name": "Expansin-B6", "gene_name": "EXPB6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4IBJ3", "url": "https://www.uniprot.org/uniprotkb/F4IBJ3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16356276", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis mutant jason produces unreduced first division restitution male gametes through a parallel/fused spindle mechanism in meiosis II.", "journal": "Plant physiology", "date": "2011-03", "authors": "De Storme Nico, Geelen Danny", "reference": { "type": "PubMed", "id": "21257792", "url": "https://pubmed.ncbi.nlm.nih.gov/21257792" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4IDQ5-1", "protein_name": "Protein JASON", "gene_name": "JASON", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4IDQ5", "url": "https://www.uniprot.org/uniprotkb/F4IDQ5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21257792", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations of Arabidopsis TBL32 and TBL33 Affect Xylan Acetylation and Secondary Wall Deposition.", "journal": "PloS one", "date": "2016", "authors": "Yuan Youxi, Teng Quincy, Zhong Ruiqin, Haghighat Marziyeh, Richardson Elizabeth A, Ye Zheng-Hua", "reference": { "type": "PubMed", "id": "26745802", "url": "https://pubmed.ncbi.nlm.nih.gov/26745802" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4IH21-1", "protein_name": "Protein trichome birefringence-like 33", "gene_name": "TBL33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SRL3-1", "protein_name": "Protein trichome birefringence-like 32", "gene_name": "TBL32", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4IH21", "url": "https://www.uniprot.org/uniprotkb/F4IH21" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26745802", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the Arabidopsis homolog of LST8/G\u03b2L, a partner of the target of Rapamycin kinase, impair plant growth, flowering, and metabolic adaptation to long days.", "journal": "The Plant cell", "date": "2012-02", "authors": "Moreau Manon, Azzopardi Marianne, Cl\u00e9ment Gilles, Dobrenel Thomas, Marchive Chlo\u00e9, Renne Charlotte, Martin-Magniette Marie-Laure, Taconnat Ludivine, Renou Jean-Pierre, Robaglia Christophe, Meyer Christian", "reference": { "type": "PubMed", "id": "22307851", "url": "https://pubmed.ncbi.nlm.nih.gov/22307851" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4IIK6-1", "protein_name": "Non-functional target of rapamycin complex subunit LST8-2", "gene_name": "LST8-2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FR53-1", "protein_name": "Serine/threonine-protein kinase TOR", "gene_name": "TOR", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LV27-1", "protein_name": "Target of rapamycin complex subunit LST8-1", "gene_name": "LST8-1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4IIK6", "url": "https://www.uniprot.org/uniprotkb/F4IIK6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22307851", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of the enzymes responsible for m2,2G and acp3U formation on cytosolic tRNA from insects and plants.", "journal": "PloS one", "date": "2020", "authors": "Funk Holly M, Zhao Ruoxia, Thomas Maggie, Spigelmyer Sarah M, Sebree Nichlas J, Bales Regan O, Burchett Jamison B, Mamaril Justen B, Limbach Patrick A, Guy Michael P", "reference": { "type": "PubMed", "id": "33253256", "url": "https://pubmed.ncbi.nlm.nih.gov/33253256" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4IL05-1", "protein_name": "tRNA-uridine aminocarboxypropyltransferase A", "gene_name": "DTWD2A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SRU7-1", "protein_name": "tRNA (guanine(26)-N(2))-dimethyltransferase 2", "gene_name": "F11A12.1; F11A12_100; F14P3.2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFU5-1", "protein_name": "tRNA (guanine(26)-N(2))-dimethyltransferase 1", "gene_name": "F14F8_190", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9VK89-1", "protein_name": "tRNA (guanine(26)-N(2))-dimethyltransferase", "gene_name": "Trm1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9VI85-1", "protein_name": "tRNA-uridine aminocarboxypropyltransferase 2", "gene_name": "Dtwd2", "tax_name": "Fruit fly" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4IL05", "url": "https://www.uniprot.org/uniprotkb/F4IL05" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 144, "end_pos": 144, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "F4IL05", "url": "https://www.uniprot.org/uniprotkb/F4IL05" }, { "database": "PubMed", "id": "33253256", "url": "https://pubmed.ncbi.nlm.nih.gov/33253256" } ], "uniprot_canonical_ac": "F4IL05-1" }, { "start_pos": 147, "end_pos": 147, "sequence_org": "W", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "F4IL05", "url": "https://www.uniprot.org/uniprotkb/F4IL05" }, { "database": "PubMed", "id": "33253256", "url": "https://pubmed.ncbi.nlm.nih.gov/33253256" } ], "uniprot_canonical_ac": "F4IL05-1" }, { "start_pos": 200, "end_pos": 200, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9SRU7", "url": "https://www.uniprot.org/uniprotkb/Q9SRU7" }, { "database": "PubMed", "id": "33253256", "url": "https://pubmed.ncbi.nlm.nih.gov/33253256" } ], "uniprot_canonical_ac": "Q9SRU7-1" }, { "start_pos": 200, "end_pos": 200, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9LFU5", "url": "https://www.uniprot.org/uniprotkb/Q9LFU5" }, { "database": "PubMed", "id": "33253256", "url": "https://pubmed.ncbi.nlm.nih.gov/33253256" } ], "uniprot_canonical_ac": "Q9LFU5-1" } ], "record_id": "pubmed.33253256", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional identification of AtAVT3, a family of vacuolar amino acid transporters, in Arabidopsis.", "journal": "FEBS letters", "date": "2017-01", "authors": "Fujiki Yuki, Teshima Hiromitsu, Kashiwao Shinji, Kawano-Kawada Miyuki, Ohsumi Yoshinori, Kakinuma Yoshimi, Sekito Takayuki", "reference": { "type": "PubMed", "id": "27925655", "url": "https://pubmed.ncbi.nlm.nih.gov/27925655" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4ILY9-1", "protein_name": "Amino acid transporter AVT3B", "gene_name": "AVT3B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LXF8-1", "protein_name": "Amino acid transporter AVT1J", "gene_name": "AVT1J", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFE3-1", "protein_name": "Amino acid transporter AVT1H", "gene_name": "AVT1H", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LI61-1", "protein_name": "Amino acid transporter AVT6A", "gene_name": "AVT6A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LYM2-1", "protein_name": "Amino acid transporter AVT6C", "gene_name": "AVT6C", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M8L9-1", "protein_name": "Amino acid transporter AVT6E", "gene_name": "AVT6E", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVG0-1", "protein_name": "Amino acid transporter AVT3C", "gene_name": "AVT3C", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WQJ3-1", "protein_name": "Amino acid transporter AVT6D", "gene_name": "AVT6D", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1PER9-1", "protein_name": "Amino acid transporter AVT1G", "gene_name": "AVT1G", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LPF4-1", "protein_name": "Amino acid transporter AVT1E", "gene_name": "AVT1E", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FKY3-1", "protein_name": "Amino acid transporter AVT3A", "gene_name": "AVT3A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SF09-1", "protein_name": "Amino acid transporter ANT1", "gene_name": "ANT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GYS4-1", "protein_name": "Amino acid transporter AVT1D", "gene_name": "AVT1D", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IUW3-1", "protein_name": "Amino acid transporter AVT1C", "gene_name": "AVT1C", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4J1Q9-1", "protein_name": "Amino acid transporter AVT1I", "gene_name": "AVT1I", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IZW8-1", "protein_name": "Amino acid transporter AVT1F", "gene_name": "AVT1F", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JE35-1", "protein_name": "Amino acid transporter AVT1B", "gene_name": "AVT1B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4KBM7-1", "protein_name": "Amino acid transporter AVT6B", "gene_name": "AVT6B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80668-1", "protein_name": "Amino acid transporter AVT1A", "gene_name": "AVT1A", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4ILY9", "url": "https://www.uniprot.org/uniprotkb/F4ILY9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 241, "end_pos": 241, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes transport activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9FKY3", "url": "https://www.uniprot.org/uniprotkb/Q9FKY3" }, { "database": "PubMed", "id": "27925655", "url": "https://pubmed.ncbi.nlm.nih.gov/27925655" } ], "uniprot_canonical_ac": "Q9FKY3-1" } ], "record_id": "pubmed.27925655", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dissecting salt stress pathways.", "journal": "J. Exp. Bot.", "date": "2006", "authors": "Ma Shisong, Gong Qingqiu, Bohnert Hans J", "reference": { "type": "PubMed", "id": "16510518", "url": "https://pubmed.ncbi.nlm.nih.gov/16510518" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "F4IQG2-1", "protein_name": "AAA-ATPase At2g18190", "gene_name": "F8D23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LJJ5-1", "protein_name": "AAA-ATPase At3g28610", "gene_name": "MZN14.7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q147F9-1", "protein_name": "AAA-ATPase At3g50940", "gene_name": "F18B3.220", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4J0C0-1", "protein_name": "AAA-ATPase At3g28600", "gene_name": "MZN14.6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "F4IQG2", "url": "https://www.uniprot.org/uniprotkb/F4IQG2" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16510518", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis CAPRICE-LIKE MYB 3 (CPL3) controls endoreduplication and flowering development in addition to trichome and root hair formation.", "journal": "Development (Cambridge, England)", "date": "2008-04", "authors": "Tominaga Rumi, Iwata Mineko, Sano Ryosuke, Inoue Kayoko, Okada Kiyotaka, Wada Takuji", "reference": { "type": "PubMed", "id": "18305006", "url": "https://pubmed.ncbi.nlm.nih.gov/18305006" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M157-1", "protein_name": "MYB-like transcription factor ETC3", "gene_name": "CPL3; ETC3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M157", "url": "https://www.uniprot.org/uniprotkb/Q9M157" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18305006", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Replication stress leads to genome instabilities in Arabidopsis DNA polymerase delta mutants.", "journal": "Plant Cell", "date": "2009", "authors": "Schuermann David, Fritsch Olivier, Lucht Jan M, Hohn Barbara", "reference": { "type": "PubMed", "id": "19789281", "url": "https://pubmed.ncbi.nlm.nih.gov/19789281" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVN7-1", "protein_name": "DNA polymerase delta catalytic subunit", "gene_name": "GIS5; POLD1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVN7", "url": "https://www.uniprot.org/uniprotkb/Q9LVN7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19789281", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Putative proteins related to group II intron reverse transcriptase/maturases are encoded by nuclear genes in higher plants.", "journal": "Nucleic Acids Res.", "date": "2003", "authors": "Mohr Georg, Lambowitz Alan M", "reference": { "type": "PubMed", "id": "12527773", "url": "https://pubmed.ncbi.nlm.nih.gov/12527773" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LZA5-1", "protein_name": "Nuclear intron maturase 3, mitochondrial", "gene_name": "NMAT3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8R8-1", "protein_name": "Nuclear intron maturase 1, mitochondrial", "gene_name": "NMAT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CA78-1", "protein_name": "Nuclear intron maturase 4, mitochondrial", "gene_name": "NMAT4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FJR9-1", "protein_name": "Nuclear intron maturase 2, mitochondrial", "gene_name": "NMAT2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LZA5", "url": "https://www.uniprot.org/uniprotkb/Q9LZA5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12527773", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtnMat2, a nuclear-encoded maturase required for splicing of group-II introns in Arabidopsis mitochondria.", "journal": "RNA", "date": "2009", "authors": "Keren Ido, Bezawork-Geleta Ayenachew, Kolton Max, Maayan Inbar, Belausov Eduard, Levy Maggie, Mett Anahit, Gidoni David, Shaya Felix, Ostersetzer-Biran Oren", "reference": { "type": "PubMed", "id": "19946041", "url": "https://pubmed.ncbi.nlm.nih.gov/19946041" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LZA5-1", "protein_name": "Nuclear intron maturase 3, mitochondrial", "gene_name": "NMAT3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8R8-1", "protein_name": "Nuclear intron maturase 1, mitochondrial", "gene_name": "NMAT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CA78-1", "protein_name": "Nuclear intron maturase 4, mitochondrial", "gene_name": "NMAT4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FJR9-1", "protein_name": "Nuclear intron maturase 2, mitochondrial", "gene_name": "NMAT2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LZA5", "url": "https://www.uniprot.org/uniprotkb/Q9LZA5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19946041", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Group II intron splicing factors in plant mitochondria.", "journal": "Front. Plant Sci.", "date": "2014", "authors": "Brown Gregory G, Colas des Francs-Small Catherine, Ostersetzer-Biran Oren", "reference": { "type": "PubMed", "id": "24600456", "url": "https://pubmed.ncbi.nlm.nih.gov/24600456" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LZA5-1", "protein_name": "Nuclear intron maturase 3, mitochondrial", "gene_name": "NMAT3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8R8-1", "protein_name": "Nuclear intron maturase 1, mitochondrial", "gene_name": "NMAT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CA78-1", "protein_name": "Nuclear intron maturase 4, mitochondrial", "gene_name": "NMAT4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FJR9-1", "protein_name": "Nuclear intron maturase 2, mitochondrial", "gene_name": "NMAT2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LZA5", "url": "https://www.uniprot.org/uniprotkb/Q9LZA5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24600456", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two families of mechanosensitive channel proteins.", "journal": "Microbiol. Mol. Biol. Rev.", "date": "2003", "authors": "Pivetti Christopher D, Yen Ming-Ren, Miller Samantha, Busch Wolfgang, Tseng Yi-Hsiung, Booth Ian R, Saier Milton H", "reference": { "type": "PubMed", "id": "12626684", "url": "https://pubmed.ncbi.nlm.nih.gov/12626684" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q84M97-1", "protein_name": "Mechanosensitive ion channel protein 9", "gene_name": "MSL9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LYG9-1", "protein_name": "Mechanosensitive ion channel protein 10", "gene_name": "MSL10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LPG3-1", "protein_name": "Mechanosensitive ion channel protein 4", "gene_name": "MSL4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IME2-1", "protein_name": "Mechanosensitive ion channel protein 8", "gene_name": "MSL8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SYM1-1", "protein_name": "Mechanosensitive ion channel protein 6", "gene_name": "MSL6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VZL4-1", "protein_name": "Mechanosensitive ion channel protein 1, mitochondrial", "gene_name": "MSL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LH74-1", "protein_name": "Mechanosensitive ion channel protein 5", "gene_name": "MSL5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q56X46-1", "protein_name": "Mechanosensitive ion channel protein 2, chloroplastic", "gene_name": "MSL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L7W1-1", "protein_name": "Mechanosensitive ion channel protein 3, chloroplastic", "gene_name": "MSL3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IME1-1", "protein_name": "Mechanosensitive ion channel protein 7", "gene_name": "MSL7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q84M97", "url": "https://www.uniprot.org/uniprotkb/Q84M97" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12626684", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two MscS homologs provide mechanosensitive channel activities in the Arabidopsis root.", "journal": "Current biology : CB", "date": "2008-05-20", "authors": "Haswell Elizabeth S, Peyronnet R\u00e9mi, Barbier-Brygoo H\u00e9l\u00e8ne, Meyerowitz Elliot M, Frachisse Jean-Marie", "reference": { "type": "PubMed", "id": "18485707", "url": "https://pubmed.ncbi.nlm.nih.gov/18485707" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q84M97-1", "protein_name": "Mechanosensitive ion channel protein 9", "gene_name": "MSL9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LYG9-1", "protein_name": "Mechanosensitive ion channel protein 10", "gene_name": "MSL10", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q84M97", "url": "https://www.uniprot.org/uniprotkb/Q84M97" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18485707", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtMSL9 and AtMSL10: Sensors of plasma membrane tension in Arabidopsis roots.", "journal": "Plant signaling & behavior", "date": "2008-09", "authors": "Peyronnet R\u00e9mi, Haswell Elizabeth S, Barbier-Brygoo H\u00e9l\u00e8ne, Frachisse Jean-Marie", "reference": { "type": "PubMed", "id": "19704841", "url": "https://pubmed.ncbi.nlm.nih.gov/19704841" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q84M97-1", "protein_name": "Mechanosensitive ion channel protein 9", "gene_name": "MSL9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LYG9-1", "protein_name": "Mechanosensitive ion channel protein 10", "gene_name": "MSL10", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q84M97", "url": "https://www.uniprot.org/uniprotkb/Q84M97" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19704841", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The APG8/12-activating enzyme APG7 is required for proper nutrient recycling and senescence in Arabidopsis thaliana.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Doelling Jed H, Walker Joseph M, Friedman Eric M, Thompson Allison R, Vierstra Richard D", "reference": { "type": "PubMed", "id": "12070171", "url": "https://pubmed.ncbi.nlm.nih.gov/12070171" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8S924-1", "protein_name": "Ubiquitin-like protein ATG12A", "gene_name": "ATG12A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LRP7-1", "protein_name": "Autophagy-related protein 8i", "gene_name": "ATG8I", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LEM4-1", "protein_name": "Autophagy-related protein 8a", "gene_name": "APG8A; ATG8A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94CD5-1", "protein_name": "Ubiquitin-like modifier-activating enzyme atg7", "gene_name": "ATG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q8S924", "url": "https://www.uniprot.org/uniprotkb/Q8S924" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12070171", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a new family of protein kinases from Arabidopsis containing phosphoinositide 3/4-kinase and ubiquitin-like domains.", "journal": "Biochem. J.", "date": "2008", "authors": "Galv\u00e3o Rafaelo M, Kota Uma, Soderblom Erik J, Goshe Michael B, Boss Wendy F", "reference": { "type": "PubMed", "id": "17880284", "url": "https://pubmed.ncbi.nlm.nih.gov/17880284" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9C671-1", "protein_name": "Phosphatidylinositol 4-kinase gamma 5", "gene_name": "PI4KG5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P55034-1", "protein_name": "26S proteasome non-ATPase regulatory subunit 4 homolog", "gene_name": "RPN10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJV0-1", "protein_name": "Ubiquitin fusion degradation protein 1 B", "gene_name": "UFD1B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNF8-1", "protein_name": "Phosphatidylinositol 4-kinase gamma 3", "gene_name": "PI4KG3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SI52-1", "protein_name": "Phosphatidylinositol 4-kinase gamma 7", "gene_name": "PI4KG7; PI4K", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W4R8-1", "protein_name": "Phosphatidylinositol 4-kinase gamma 6", "gene_name": "PI4KG6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22199-1", "protein_name": "Phosphatidylinositol 4-kinase gamma 1", "gene_name": "PI4KG1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WMZ6-1", "protein_name": "Phosphatidylinositol 4-kinase gamma 8", "gene_name": "PI4KG8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SGW8-1", "protein_name": "Phosphatidylinositol 4-kinase gamma 2", "gene_name": "PI4KG2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZPY9-1", "protein_name": "Phosphatidylinositol 4-kinase gamma 4", "gene_name": "PI4KG4; PI4K", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9C671", "url": "https://www.uniprot.org/uniprotkb/Q9C671" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 284, "end_pos": 284, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes protein kinase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZPY9", "url": "https://www.uniprot.org/uniprotkb/Q9ZPY9" }, { "database": "PubMed", "id": "17880284", "url": "https://pubmed.ncbi.nlm.nih.gov/17880284" } ], "uniprot_canonical_ac": "Q9ZPY9-1" } ], "record_id": "pubmed.17880284", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Toward an interaction map of the two-component signaling pathway of Arabidopsis thaliana.", "journal": "J. Proteome Res.", "date": "2008", "authors": "Dortay Hakan, Gruhn Nijuscha, Pfeifer Andreas, Schwerdtner Mareike, Schm\u00fclling Thomas, Heyl Alexander", "reference": { "type": "PubMed", "id": "18642946", "url": "https://pubmed.ncbi.nlm.nih.gov/18642946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9C671-1", "protein_name": "Phosphatidylinositol 4-kinase gamma 5", "gene_name": "PI4KG5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZNV8-1", "protein_name": "Histidine-containing phosphotransfer protein 2", "gene_name": "AHP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LDK9-1", "protein_name": "Beta-adaptin-like protein A", "gene_name": "AP4B; BETAA-AD", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L9T7-1", "protein_name": "Histidine-containing phosphotransfer protein 5", "gene_name": "AHP5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GW78-1", "protein_name": "ATP-dependent Clp protease ATP-binding subunit CLPT2, chloroplastic", "gene_name": "CLPT2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RY18-1", "protein_name": "TNF receptor-associated factor homolog 1a", "gene_name": "TRAF1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80452-1", "protein_name": "AMP deaminase", "gene_name": "AMPD", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5U0-1", "protein_name": "Histidine kinase 4", "gene_name": "AHK4; WOL", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42697-1", "protein_name": "Phragmoplastin DRP1A", "gene_name": "DL1; DRP1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5U2-1", "protein_name": "Histidine kinase 2", "gene_name": "AHK2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZNV9-1", "protein_name": "Histidine-containing phosphotransfer protein 1", "gene_name": "AHP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P15459-1", "protein_name": "2S seed storage protein 3", "gene_name": "AT2S3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L8Z1-1", "protein_name": "CASP-like protein 1E1", "gene_name": "Dl3855w; FCAALL.230", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ASS6-1", "protein_name": "Photosynthetic NDH subunit of lumenal location 5, chloroplastic", "gene_name": "PNSL5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C598-1", "protein_name": "Protein ATAF2", "gene_name": "NAC081", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5U1-1", "protein_name": "Histidine kinase 3", "gene_name": "AHK3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CAR7-1", "protein_name": "Hypersensitive-induced response protein 2", "gene_name": "HIR2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FMJ0-1", "protein_name": "Phosphatidylinositol 4-kinase beta 1", "gene_name": "PI-4KBETA1; PI4KB1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SAZ5-1", "protein_name": "Histidine-containing phosphotransfer protein 3", "gene_name": "AHP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SCU5-1", "protein_name": "Probable serine/threonine-protein kinase WNK5", "gene_name": "WNK5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9C671", "url": "https://www.uniprot.org/uniprotkb/Q9C671" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18642946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A new family of RhoGEFs activates the Rop molecular switch in plants.", "journal": "Nature", "date": "2005", "authors": "Berken Antje, Thomas Christoph, Wittinghofer Alfred", "reference": { "type": "PubMed", "id": "15980860", "url": "https://pubmed.ncbi.nlm.nih.gov/15980860" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV40-1", "protein_name": "Rho guanine nucleotide exchange factor 8", "gene_name": "ROPGEF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LZN0-1", "protein_name": "Rop guanine nucleotide exchange factor 7", "gene_name": "ROPGEF7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M056-1", "protein_name": "Rop guanine nucleotide exchange factor 6", "gene_name": "ROPGEF6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVQ3-1", "protein_name": "Rop guanine nucleotide exchange factor 9", "gene_name": "ROPGEF9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "A4IJ27-1", "protein_name": "Rop guanine nucleotide exchange factor 3", "gene_name": "ROPGEF3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1KS66-1", "protein_name": "Rop guanine nucleotide exchange factor 10", "gene_name": "ROPGEF10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4J1G1-1", "protein_name": "Rop guanine nucleotide exchange factor 13", "gene_name": "ROPGEF13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q56WM6-1", "protein_name": "Rop guanine nucleotide exchange factor 14", "gene_name": "ROPGEF14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4K295-1", "protein_name": "Rop guanine nucleotide exchange factor 5", "gene_name": "ROPGEF5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WNP7-1", "protein_name": "Rop guanine nucleotide exchange factor 4", "gene_name": "ROPGEF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93ZY2-1", "protein_name": "Rop guanine nucleotide exchange factor 1", "gene_name": "ROPGEF1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CA89-1", "protein_name": "Rop guanine nucleotide exchange factor 12", "gene_name": "ROPGEF12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LQ89-1", "protein_name": "Rop guanine nucleotide exchange factor 2", "gene_name": "ROPGEF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M811-1", "protein_name": "Rop guanine nucleotide exchange factor 11", "gene_name": "ROPGEF11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15980860", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Members of a novel class of Arabidopsis Rho guanine nucleotide exchange factors control Rho GTPase-dependent polar growth.", "journal": "Plant Cell", "date": "2006", "authors": "Gu Ying, Li Shundai, Lord Elizabeth M, Yang Zhenbiao", "reference": { "type": "PubMed", "id": "16415208", "url": "https://pubmed.ncbi.nlm.nih.gov/16415208" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV40-1", "protein_name": "Rho guanine nucleotide exchange factor 8", "gene_name": "ROPGEF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVQ3-1", "protein_name": "Rop guanine nucleotide exchange factor 9", "gene_name": "ROPGEF9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q56WM6-1", "protein_name": "Rop guanine nucleotide exchange factor 14", "gene_name": "ROPGEF14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93ZY2-1", "protein_name": "Rop guanine nucleotide exchange factor 1", "gene_name": "ROPGEF1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CA89-1", "protein_name": "Rop guanine nucleotide exchange factor 12", "gene_name": "ROPGEF12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16415208", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural evidence for a common intermediate in small G protein-GEF reactions.", "journal": "Molecular cell", "date": "2007-01-12", "authors": "Thomas Christoph, Fricke Inka, Scrima Andrea, Berken Antje, Wittinghofer Alfred", "reference": { "type": "PubMed", "id": "17218277", "url": "https://pubmed.ncbi.nlm.nih.gov/17218277" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV40-1", "protein_name": "Rho guanine nucleotide exchange factor 8", "gene_name": "ROPGEF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38937-1", "protein_name": "Rac-like GTP-binding protein ARAC5", "gene_name": "ARAC5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 161, "end_pos": 161, "sequence_org": "F", "sequence_mut": "A", "comment": "Decreases GEF activity 25-fold; when associated with A-175.", "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" }, { "database": "PubMed", "id": "17218277", "url": "https://pubmed.ncbi.nlm.nih.gov/17218277" } ], "uniprot_canonical_ac": "Q9LV40-1" }, { "start_pos": 175, "end_pos": 175, "sequence_org": "E", "sequence_mut": "A", "comment": "Decreases GEF activity 25-fold; when associated with A-161.", "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" }, { "database": "PubMed", "id": "17218277", "url": "https://pubmed.ncbi.nlm.nih.gov/17218277" } ], "uniprot_canonical_ac": "Q9LV40-1" }, { "start_pos": 234, "end_pos": 234, "sequence_org": "W", "sequence_mut": "S", "comment": "Decreases GEF activity 14-fold.", "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" }, { "database": "PubMed", "id": "17218277", "url": "https://pubmed.ncbi.nlm.nih.gov/17218277" } ], "uniprot_canonical_ac": "Q9LV40-1" }, { "start_pos": 235, "end_pos": 235, "sequence_org": "W", "sequence_mut": "S", "comment": "Loss of GEF activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" }, { "database": "PubMed", "id": "17218277", "url": "https://pubmed.ncbi.nlm.nih.gov/17218277" } ], "uniprot_canonical_ac": "Q9LV40-1" }, { "start_pos": 413, "end_pos": 413, "sequence_org": "E", "sequence_mut": "A", "comment": "Decreases GEF activity 20-fold.", "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" }, { "database": "PubMed", "id": "17218277", "url": "https://pubmed.ncbi.nlm.nih.gov/17218277" } ], "uniprot_canonical_ac": "Q9LV40-1" }, { "start_pos": 98, "end_pos": 98, "sequence_org": "L", "sequence_mut": "D", "comment": "Loss of homodimerization and GEF activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" }, { "database": "PubMed", "id": "17218277", "url": "https://pubmed.ncbi.nlm.nih.gov/17218277" } ], "uniprot_canonical_ac": "Q9LV40-1" }, { "start_pos": 65, "end_pos": 65, "sequence_org": "E", "sequence_mut": "A", "comment": "Strongly impairs GEF-dependent nucleotide exchange.", "evidence": [ { "database": "UniProtKB", "id": "Q38937", "url": "https://www.uniprot.org/uniprotkb/Q38937" }, { "database": "PubMed", "id": "17218277", "url": "https://pubmed.ncbi.nlm.nih.gov/17218277" } ], "uniprot_canonical_ac": "Q38937-1" } ], "record_id": "pubmed.17218277", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "3D structure of a binary ROP-PRONE complex: the final intermediate for a complete set of molecular snapshots of the RopGEF reaction.", "journal": "Biol. Chem.", "date": "2009", "authors": "Thomas Christoph, Fricke Inka, Weyand Michael, Berken Antje", "reference": { "type": "PubMed", "id": "19335195", "url": "https://pubmed.ncbi.nlm.nih.gov/19335195" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV40-1", "protein_name": "Rho guanine nucleotide exchange factor 8", "gene_name": "ROPGEF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38937-1", "protein_name": "Rac-like GTP-binding protein ARAC5", "gene_name": "ARAC5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19335195", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ROPGEF1 and ROPGEF4 are functional regulators of ROP11 GTPase in ABA-mediated stomatal closure in Arabidopsis.", "journal": "FEBS Lett.", "date": "2012", "authors": "Li Zixing, Liu Dong", "reference": { "type": "PubMed", "id": "22500990", "url": "https://pubmed.ncbi.nlm.nih.gov/22500990" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV40-1", "protein_name": "Rho guanine nucleotide exchange factor 8", "gene_name": "ROPGEF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVQ3-1", "protein_name": "Rop guanine nucleotide exchange factor 9", "gene_name": "ROPGEF9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WNP7-1", "protein_name": "Rop guanine nucleotide exchange factor 4", "gene_name": "ROPGEF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93ZY2-1", "protein_name": "Rop guanine nucleotide exchange factor 1", "gene_name": "ROPGEF1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LQ89-1", "protein_name": "Rop guanine nucleotide exchange factor 2", "gene_name": "ROPGEF2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22500990", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tip-localized receptors control pollen tube growth and LURE sensing in Arabidopsis.", "journal": "Nature", "date": "2016", "authors": "Takeuchi Hidenori, Higashiyama Tetsuya", "reference": { "type": "PubMed", "id": "26961657", "url": "https://pubmed.ncbi.nlm.nih.gov/26961657" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV40-1", "protein_name": "Rho guanine nucleotide exchange factor 8", "gene_name": "ROPGEF8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVQ3-1", "protein_name": "Rop guanine nucleotide exchange factor 9", "gene_name": "ROPGEF9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4J1G1-1", "protein_name": "Rop guanine nucleotide exchange factor 13", "gene_name": "ROPGEF13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CA89-1", "protein_name": "Rop guanine nucleotide exchange factor 12", "gene_name": "ROPGEF12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1PDW3-1", "protein_name": "Receptor-like kinase LIP1", "gene_name": "LIP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3E991-1", "protein_name": "Pollen receptor-like kinase 6", "gene_name": "PRK6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M1L7-1", "protein_name": "Pollen receptor-like kinase 3", "gene_name": "PRK3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M8S2-1", "protein_name": "Receptor-like kinase LIP2", "gene_name": "LIP2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV40", "url": "https://www.uniprot.org/uniprotkb/Q9LV40" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26961657", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The identity of plant glutamate receptors.", "journal": "Science", "date": "2001", "authors": "Lacombe B, Becker D, Hedrich R, DeSalle R, Hollmann M, Kwak J M, Schroeder J I, Le Nov\u00e8re N, Nam H G, Spalding E P, Tester M, Turano F J, Chiu J, Coruzzi G", "reference": { "type": "PubMed", "id": "11379626", "url": "https://pubmed.ncbi.nlm.nih.gov/11379626" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV72-1", "protein_name": "Glutamate receptor 1.2", "gene_name": "GLR1.2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SW97-1", "protein_name": "Glutamate receptor 3.5", "gene_name": "GLR3.5; GLR35", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SHV2-1", "protein_name": "Glutamate receptor 2.3", "gene_name": "GLR2.3; GLR23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81078-1", "protein_name": "Glutamate receptor 2.9", "gene_name": "GLR2.9; GLR29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81776-1", "protein_name": "Glutamate receptor 2.4", "gene_name": "GLR2.4; GLR24", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04660-1", "protein_name": "Glutamate receptor 2.1", "gene_name": "GLR2.1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8E7-1", "protein_name": "Glutamate receptor 3.3", "gene_name": "GLR3.3; GLR33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5V5-1", "protein_name": "Glutamate receptor 2.8", "gene_name": "GLR2.8; GLR28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FH75-1", "protein_name": "Glutamate receptor 1.3", "gene_name": "GLR1.3; GLR13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LGN0-1", "protein_name": "Glutamate receptor 2.7", "gene_name": "GLR2.7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFN5-1", "protein_name": "Glutamate receptor 2.5", "gene_name": "GLR2.5; GLR25", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFN8-1", "protein_name": "Glutamate receptor 2.6", "gene_name": "GLR2.6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SDQ4-1", "protein_name": "Glutamate receptor 3.7", "gene_name": "GLR3.7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SHV1-1", "protein_name": "Glutamate receptor 2.2", "gene_name": "GLR2.2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84W41-1", "protein_name": "Glutamate receptor 3.6", "gene_name": "GLR3.6; GLR36", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GXJ4-1", "protein_name": "Glutamate receptor 3.4", "gene_name": "GLR3.4; GLR34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LGN1-1", "protein_name": "Glutamate receptor 1.4", "gene_name": "GLR1.4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93YT1-1", "protein_name": "Glutamate receptor 3.2", "gene_name": "GLR3.2; GLUR2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q7XJL2-1", "protein_name": "Glutamate receptor 3.1", "gene_name": "GLR3.1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M8W7-1", "protein_name": "Glutamate receptor 1.1", "gene_name": "GLR1.1; GLR11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV72", "url": "https://www.uniprot.org/uniprotkb/Q9LV72" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11379626", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phylogenetic and expression analysis of the glutamate-receptor-like gene family in Arabidopsis thaliana.", "journal": "Mol. Biol. Evol.", "date": "2002", "authors": "Chiu Joanna C, Brenner Eric D, DeSalle Rob, Nitabach Michael N, Holmes Todd C, Coruzzi Gloria M", "reference": { "type": "PubMed", "id": "12082126", "url": "https://pubmed.ncbi.nlm.nih.gov/12082126" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV72-1", "protein_name": "Glutamate receptor 1.2", "gene_name": "GLR1.2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SW97-1", "protein_name": "Glutamate receptor 3.5", "gene_name": "GLR3.5; GLR35", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SHV2-1", "protein_name": "Glutamate receptor 2.3", "gene_name": "GLR2.3; GLR23", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81078-1", "protein_name": "Glutamate receptor 2.9", "gene_name": "GLR2.9; GLR29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81776-1", "protein_name": "Glutamate receptor 2.4", "gene_name": "GLR2.4; GLR24", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04660-1", "protein_name": "Glutamate receptor 2.1", "gene_name": "GLR2.1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8E7-1", "protein_name": "Glutamate receptor 3.3", "gene_name": "GLR3.3; GLR33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5V5-1", "protein_name": "Glutamate receptor 2.8", "gene_name": "GLR2.8; GLR28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FH75-1", "protein_name": "Glutamate receptor 1.3", "gene_name": "GLR1.3; GLR13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LGN0-1", "protein_name": "Glutamate receptor 2.7", "gene_name": "GLR2.7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFN5-1", "protein_name": "Glutamate receptor 2.5", "gene_name": "GLR2.5; GLR25", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFN8-1", "protein_name": "Glutamate receptor 2.6", "gene_name": "GLR2.6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SDQ4-1", "protein_name": "Glutamate receptor 3.7", "gene_name": "GLR3.7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SHV1-1", "protein_name": "Glutamate receptor 2.2", "gene_name": "GLR2.2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84W41-1", "protein_name": "Glutamate receptor 3.6", "gene_name": "GLR3.6; GLR36", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GXJ4-1", "protein_name": "Glutamate receptor 3.4", "gene_name": "GLR3.4; GLR34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LGN1-1", "protein_name": "Glutamate receptor 1.4", "gene_name": "GLR1.4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93YT1-1", "protein_name": "Glutamate receptor 3.2", "gene_name": "GLR3.2; GLUR2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q7XJL2-1", "protein_name": "Glutamate receptor 3.1", "gene_name": "GLR3.1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M8W7-1", "protein_name": "Glutamate receptor 1.1", "gene_name": "GLR1.1; GLR11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV72", "url": "https://www.uniprot.org/uniprotkb/Q9LV72" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12082126", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A critical role for disproportionating enzyme in starch breakdown is revealed by a knock-out mutation in Arabidopsis.", "journal": "The Plant journal : for cell and molecular biology", "date": "2001-04", "authors": "Critchley J H, Zeeman S C, Takaha T, Smith A M, Smith S M", "reference": { "type": "PubMed", "id": "11359613", "url": "https://pubmed.ncbi.nlm.nih.gov/11359613" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV91-1", "protein_name": "4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic", "gene_name": "DPE1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV91", "url": "https://www.uniprot.org/uniprotkb/Q9LV91" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11359613", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Blocking the metabolism of starch breakdown products in Arabidopsis leaves triggers chloroplast degradation.", "journal": "Molecular plant", "date": "2009-11", "authors": "Stettler Michaela, Eicke Simona, Mettler Tabea, Messerli Ga\u00eblle, H\u00f6rtensteiner Stefan, Zeeman Samuel C", "reference": { "type": "PubMed", "id": "19946617", "url": "https://pubmed.ncbi.nlm.nih.gov/19946617" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LV91-1", "protein_name": "4-alpha-glucanotransferase DPE1, chloroplastic/amyloplastic", "gene_name": "DPE1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LV91", "url": "https://www.uniprot.org/uniprotkb/Q9LV91" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19946617", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis VILLIN5, an actin filament bundling and severing protein, is necessary for normal pollen tube growth.", "journal": "The Plant cell", "date": "2010-08", "authors": "Zhang Hua, Qu Xiaolu, Bao Chanchan, Khurana Parul, Wang Qiannan, Xie Yurong, Zheng Yiyan, Chen Naizhi, Blanchoin Laurent, Staiger Christopher J, Huang Shanjin", "reference": { "type": "PubMed", "id": "20807879", "url": "https://pubmed.ncbi.nlm.nih.gov/20807879" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVC6-1", "protein_name": "Villin-5", "gene_name": "VLN5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVC6", "url": "https://www.uniprot.org/uniprotkb/Q9LVC6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20807879", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis villins promote actin turnover at pollen tube tips and facilitate the construction of actin collars.", "journal": "The Plant cell", "date": "2013-05", "authors": "Qu Xiaolu, Zhang Hua, Xie Yurong, Wang Juan, Chen Naizhi, Huang Shanjin", "reference": { "type": "PubMed", "id": "23715472", "url": "https://pubmed.ncbi.nlm.nih.gov/23715472" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVC6-1", "protein_name": "Villin-5", "gene_name": "VLN5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81644-1", "protein_name": "Villin-2", "gene_name": "VLN2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVC6", "url": "https://www.uniprot.org/uniprotkb/Q9LVC6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23715472", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression profiling of four RelA/SpoT-like proteins, homologues of bacterial stringent factors, in Arabidopsis thaliana.", "journal": "Planta", "date": "2008-09", "authors": "Mizusawa Kazuki, Masuda Shinji, Ohta Hiroyuki", "reference": { "type": "PubMed", "id": "18535838", "url": "https://pubmed.ncbi.nlm.nih.gov/18535838" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVJ3-1", "protein_name": "Probable GTP diphosphokinase RSH2, chloroplastic", "gene_name": "RSH2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84R11-1", "protein_name": "Probable GTP diphosphokinase CRSH, chloroplastic", "gene_name": "CRSH", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JHA2-1", "protein_name": "Putative GTP diphosphokinase RSH1, chloroplastic", "gene_name": "RSH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SYH1-1", "protein_name": "Probable GTP diphosphokinase RSH3, chloroplastic", "gene_name": "RSH3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVJ3", "url": "https://www.uniprot.org/uniprotkb/Q9LVJ3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18535838", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Potential roles of YCF54 and ferredoxin-NADPH reductase for magnesium protoporphyrin monomethylester cyclase.", "journal": "The Plant journal : for cell and molecular biology", "date": "2018-05", "authors": "Herbst Josephine, Girke Annabel, Hajirezaei Mohammad Reza, Hanke Guy, Grimm Bernhard", "reference": { "type": "PubMed", "id": "29443418", "url": "https://pubmed.ncbi.nlm.nih.gov/29443418" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVM3-1", "protein_name": "Protein YCF54, chloroplastic", "gene_name": "YCF54", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M591-1", "protein_name": "Magnesium-protoporphyrin IX monomethyl ester [oxidative] cyclase, chloroplastic", "gene_name": "CRD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FKW6-1", "protein_name": "Ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic", "gene_name": "FNR1; LFNR1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVM3", "url": "https://www.uniprot.org/uniprotkb/Q9LVM3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.29443418", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "YKT6 is a core constituent of membrane fusion machineries at the Arabidopsis trans-Golgi network.", "journal": "Journal of molecular biology", "date": "2005-07-01", "authors": "Chen Yong, Shin Yeon-Kyun, Bassham Diane C", "reference": { "type": "PubMed", "id": "15919093", "url": "https://pubmed.ncbi.nlm.nih.gov/15919093" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVM9-1", "protein_name": "VAMP-like protein YKT62", "gene_name": "YKT62", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZRD6-1", "protein_name": "VAMP-like protein YKT61", "gene_name": "YKT61", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q946Y7-1", "protein_name": "Syntaxin-61", "gene_name": "SYP61", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65359-1", "protein_name": "Tlg2p-like protein a", "gene_name": "SYP41", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SEL5-1", "protein_name": "Vesicle transport v-SNARE 12", "gene_name": "VTI12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVM9", "url": "https://www.uniprot.org/uniprotkb/Q9LVM9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15919093", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional redundancy between trans-Golgi network SNARE family members in Arabidopsis thaliana.", "journal": "BMC biochemistry", "date": "2013-09-11", "authors": "Kim Sang-Jin, Bassham Diane C", "reference": { "type": "PubMed", "id": "24021022", "url": "https://pubmed.ncbi.nlm.nih.gov/24021022" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVM9-1", "protein_name": "VAMP-like protein YKT62", "gene_name": "YKT62", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SEL6-1", "protein_name": "Vesicle transport v-SNARE 11", "gene_name": "VTI11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65359-1", "protein_name": "Tlg2p-like protein a", "gene_name": "SYP41", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SWH4-1", "protein_name": "Syntaxin-42", "gene_name": "SYP42", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SEL5-1", "protein_name": "Vesicle transport v-SNARE 12", "gene_name": "VTI12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SUJ1-1", "protein_name": "Syntaxin-43", "gene_name": "SYP43", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVM9", "url": "https://www.uniprot.org/uniprotkb/Q9LVM9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24021022", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Induction of a homeodomain-leucine zipper gene by auxin is inhibited by cytokinin in Arabidopsis roots.", "journal": "Biochemical and biophysical research communications", "date": "2005-01-07", "authors": "Son Ora, Cho Hee-Yeon, Kim Mi-Ran, Lee Hyosoo, Lee Myeong-Sok, Song Eunsook, Park Jong Hoon, Nam Kyung Hee, Chun Jong-Yoon, Kim Ho-Jung, Hong Soon-Kwan, Chung Yong-Yoon, Hur Cheol-Goo, Cho Hyung-Taeg, Cheon Choong-Ill", "reference": { "type": "PubMed", "id": "15567172", "url": "https://pubmed.ncbi.nlm.nih.gov/15567172" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVR0-1", "protein_name": "Homeobox-leucine zipper protein ATHB-53", "gene_name": "ATHB-53", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVR0", "url": "https://www.uniprot.org/uniprotkb/Q9LVR0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15567172", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sucrose-specific induction of the anthocyanin biosynthetic pathway in Arabidopsis.", "journal": "Plant Physiol.", "date": "2006", "authors": "Solfanelli Cinzia, Poggi Alessandra, Loreti Elena, Alpi Amedeo, Perata Pierdomenico", "reference": { "type": "PubMed", "id": "16384906", "url": "https://pubmed.ncbi.nlm.nih.gov/16384906" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVW3-1", "protein_name": "Anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase", "gene_name": "A3G2XYLT", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q96323-1", "protein_name": "Leucoanthocyanidin dioxygenase", "gene_name": "LDOX", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVW3", "url": "https://www.uniprot.org/uniprotkb/Q9LVW3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16384906", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular mechanism for jasmonate-induction of anthocyanin accumulation in Arabidopsis.", "journal": "J. Exp. Bot.", "date": "2009", "authors": "Shan Xiaoyi, Zhang Yongsheng, Peng Wen, Wang Zhilong, Xie Daoxin", "reference": { "type": "PubMed", "id": "19596700", "url": "https://pubmed.ncbi.nlm.nih.gov/19596700" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVW3-1", "protein_name": "Anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase", "gene_name": "A3G2XYLT", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q96323-1", "protein_name": "Leucoanthocyanidin dioxygenase", "gene_name": "LDOX", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVW3", "url": "https://www.uniprot.org/uniprotkb/Q9LVW3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19596700", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Brassinosteroid enhances jasmonate-induced anthocyanin accumulation in Arabidopsis seedlings.", "journal": "J. Integr. Plant Biol.", "date": "2011", "authors": "Peng Zhihong, Han Chengyun, Yuan Libing, Zhang Kun, Huang Hongman, Ren Chunmei", "reference": { "type": "PubMed", "id": "21545406", "url": "https://pubmed.ncbi.nlm.nih.gov/21545406" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVW3-1", "protein_name": "Anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase", "gene_name": "A3G2XYLT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVW3", "url": "https://www.uniprot.org/uniprotkb/Q9LVW3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21545406", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two glycosyltransferases involved in anthocyanin modification delineated by transcriptome independent component analysis in Arabidopsis thaliana.", "journal": "The Plant journal : for cell and molecular biology", "date": "2012-01", "authors": "Yonekura-Sakakibara Keiko, Fukushima Atsushi, Nakabayashi Ryo, Hanada Kousuke, Matsuda Fumio, Sugawara Satoko, Inoue Eri, Kuromori Takashi, Ito Takuya, Shinozaki Kazuo, Wangwattana Bunyapa, Yamazaki Mami, Saito Kazuki", "reference": { "type": "PubMed", "id": "21899608", "url": "https://pubmed.ncbi.nlm.nih.gov/21899608" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVW3-1", "protein_name": "Anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase", "gene_name": "A3G2XYLT", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LVF0-1", "protein_name": "UDP-glycosyltransferase 84A2", "gene_name": "UGT84A2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVW3", "url": "https://www.uniprot.org/uniprotkb/Q9LVW3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21899608", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytokinins enhance sugar-induced anthocyanin biosynthesis in Arabidopsis.", "journal": "Mol. Cells", "date": "2012", "authors": "Das Prasanta Kumar, Shin Dong Ho, Choi Sang-Bong, Yoo Sang-Dong, Choi Giltsu, Park Youn-Il", "reference": { "type": "PubMed", "id": "22699753", "url": "https://pubmed.ncbi.nlm.nih.gov/22699753" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVW3-1", "protein_name": "Anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase", "gene_name": "A3G2XYLT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVW3", "url": "https://www.uniprot.org/uniprotkb/Q9LVW3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22699753", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparative genomics of the RBR family, including the Parkinson's disease-related gene parkin and the genes of the ariadne subfamily.", "journal": "Molecular biology and evolution", "date": "2002-12", "authors": "Mar\u00edn Ignacio, Ferr\u00fas Alberto", "reference": { "type": "PubMed", "id": "12446796", "url": "https://pubmed.ncbi.nlm.nih.gov/12446796" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVW9-1", "protein_name": "Putative E3 ubiquitin-protein ligase ARI4", "gene_name": "ARI4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LVX0-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI3", "gene_name": "ARI3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0C8K8-1", "protein_name": "Putative E3 ubiquitin-protein ligase ARI6", "gene_name": "ARI6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L829-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI5", "gene_name": "ARI5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5A4-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI16", "gene_name": "ARI16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFN9-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI13", "gene_name": "ARI13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SKC2-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI11", "gene_name": "ARI11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SKC3-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI9", "gene_name": "ARI9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SKC4-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI10", "gene_name": "ARI10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O60260-1", "protein_name": "E3 ubiquitin-protein ligase parkin", "gene_name": "PRKN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q84RQ9-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI12", "gene_name": "ARI12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q949V6-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI1", "gene_name": "ARI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W468-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI8", "gene_name": "ARI8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFP1-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI14", "gene_name": "ARI14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84RR2-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI2", "gene_name": "ARI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84RR0-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI7", "gene_name": "ARI7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84RQ8-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI15", "gene_name": "ARI15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4ITM1-1", "protein_name": "E3 ubiquitin-protein ligase RSL1", "gene_name": "RSL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVW9", "url": "https://www.uniprot.org/uniprotkb/Q9LVW9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12446796", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of the ARIADNE gene family in Arabidopsis. A group of putative E3 ligases.", "journal": "Plant Physiol.", "date": "2003", "authors": "Mladek Christina, Guger Klaus, Hauser Marie-Theres", "reference": { "type": "PubMed", "id": "12529512", "url": "https://pubmed.ncbi.nlm.nih.gov/12529512" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVW9-1", "protein_name": "Putative E3 ubiquitin-protein ligase ARI4", "gene_name": "ARI4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LVX0-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI3", "gene_name": "ARI3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P0C8K8-1", "protein_name": "Putative E3 ubiquitin-protein ligase ARI6", "gene_name": "ARI6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L829-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI5", "gene_name": "ARI5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5A4-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI16", "gene_name": "ARI16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFN9-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI13", "gene_name": "ARI13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SKC2-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI11", "gene_name": "ARI11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SKC3-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI9", "gene_name": "ARI9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SKC4-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI10", "gene_name": "ARI10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84RQ9-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI12", "gene_name": "ARI12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q949V6-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI1", "gene_name": "ARI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W468-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI8", "gene_name": "ARI8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFP1-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI14", "gene_name": "ARI14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84RR2-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI2", "gene_name": "ARI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84RR0-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI7", "gene_name": "ARI7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84RQ8-1", "protein_name": "Probable E3 ubiquitin-protein ligase ARI15", "gene_name": "ARI15", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVW9", "url": "https://www.uniprot.org/uniprotkb/Q9LVW9" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12529512", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and Partial Characterization of an L-Tyrosine Aminotransferase (TAT) from Arabidopsis thaliana.", "journal": "Biochemistry research international", "date": "2010", "authors": "Prabhu Pranav R, Hudson Andr\u00e9 O", "reference": { "type": "PubMed", "id": "21188077", "url": "https://pubmed.ncbi.nlm.nih.gov/21188077" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVY1-1", "protein_name": "Tyrosine aminotransferase", "gene_name": "TAT", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVY1", "url": "https://www.uniprot.org/uniprotkb/Q9LVY1" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21188077", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An enzyme regulating triacylglycerol composition is encoded by the ROD1 gene of Arabidopsis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009-11-03", "authors": "Lu Chaofu, Xin Zhanguo, Ren Zhonghai, Miquel Martine, Browse John", "reference": { "type": "PubMed", "id": "19833868", "url": "https://pubmed.ncbi.nlm.nih.gov/19833868" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVZ7-1", "protein_name": "Phosphatidylcholine:diacylglycerol cholinephosphotransferase 1", "gene_name": "ROD1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVZ7", "url": "https://www.uniprot.org/uniprotkb/Q9LVZ7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19833868", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The phosphatidylcholine diacylglycerol cholinephosphotransferase is required for efficient hydroxy fatty acid accumulation in transgenic Arabidopsis.", "journal": "Plant physiology", "date": "2012-04", "authors": "Hu Zhaohui, Ren Zhonghai, Lu Chaofu", "reference": { "type": "PubMed", "id": "22371508", "url": "https://pubmed.ncbi.nlm.nih.gov/22371508" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVZ7-1", "protein_name": "Phosphatidylcholine:diacylglycerol cholinephosphotransferase 1", "gene_name": "ROD1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVZ7", "url": "https://www.uniprot.org/uniprotkb/Q9LVZ7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22371508", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Acyl editing and headgroup exchange are the major mechanisms that direct polyunsaturated fatty acid flux into triacylglycerols.", "journal": "Plant physiology", "date": "2012-11", "authors": "Bates Philip D, Fatihi Abdelhak, Snapp Anna R, Carlsson Anders S, Browse John, Lu Chaofu", "reference": { "type": "PubMed", "id": "22932756", "url": "https://pubmed.ncbi.nlm.nih.gov/22932756" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LVZ7-1", "protein_name": "Phosphatidylcholine:diacylglycerol cholinephosphotransferase 1", "gene_name": "ROD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CAN8-1", "protein_name": "Lysophospholipid acyltransferase 2", "gene_name": "LPCAT2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IDU4-1", "protein_name": "Lysophospholipid acyltransferase 1", "gene_name": "LPCAT1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LVZ7", "url": "https://www.uniprot.org/uniprotkb/Q9LVZ7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22932756", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CUP-SHAPED COTYLEDON1 transcription factor activates the expression of LSH4 and LSH3, two members of the ALOG gene family, in shoot organ boundary cells.", "journal": "The Plant journal : for cell and molecular biology", "date": "2011-06", "authors": "Takeda Seiji, Hanano Keiko, Kariya Ayano, Shimizu Satoko, Zhao Li, Matsui Minami, Tasaka Masao, Aida Mitsuhiro", "reference": { "type": "PubMed", "id": "21435050", "url": "https://pubmed.ncbi.nlm.nih.gov/21435050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LW68-1", "protein_name": "Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 4", "gene_name": "LSH4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82268-1", "protein_name": "Protein LIGHT-DEPENDENT SHORT HYPOCOTYLS 3", "gene_name": "LSH3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LW68", "url": "https://www.uniprot.org/uniprotkb/Q9LW68" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21435050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MFP1 is a thylakoid-associated, nucleoid-binding protein with a coiled-coil structure.", "journal": "Nucleic acids research", "date": "2003-09-01", "authors": "Jeong Sun Yong, Rose Annkatrin, Meier Iris", "reference": { "type": "PubMed", "id": "12930969", "url": "https://pubmed.ncbi.nlm.nih.gov/12930969" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LW85-1", "protein_name": "MAR-binding filament-like protein 1", "gene_name": "MFP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LW85", "url": "https://www.uniprot.org/uniprotkb/Q9LW85" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12930969", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dual location of MAR-binding, filament-like protein 1 in Arabidopsis, tobacco, and tomato.", "journal": "Planta", "date": "2006", "authors": "Samaniego Rafael, Jeong Sun Yong, Meier Iris, de la Espina Susana Moreno D\u00edaz", "reference": { "type": "PubMed", "id": "16331467", "url": "https://pubmed.ncbi.nlm.nih.gov/16331467" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LW85-1", "protein_name": "MAR-binding filament-like protein 1", "gene_name": "MFP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LW85", "url": "https://www.uniprot.org/uniprotkb/Q9LW85" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16331467", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two Plastidial Coiled-Coil Proteins Are Essential for Normal Starch Granule Initiation in Arabidopsis.", "journal": "The Plant cell", "date": "2018-07", "authors": "Seung David, Schreier Tina B, B\u00fcrgy L\u00e9o, Eicke Simona, Zeeman Samuel C", "reference": { "type": "PubMed", "id": "29866647", "url": "https://pubmed.ncbi.nlm.nih.gov/29866647" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LW85-1", "protein_name": "MAR-binding filament-like protein 1", "gene_name": "MFP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1E5-1", "protein_name": "Protein involved in starch initiation 1", "gene_name": "PII1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LFY0-1", "protein_name": "Protein PTST homolog 2, chloroplastic", "gene_name": "PTST2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9MAQ0-1", "protein_name": "Granule-bound starch synthase 1, chloroplastic/amyloplastic", "gene_name": "GBSS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WVX5-1", "protein_name": "Probable starch synthase 4, chloroplastic/amyloplastic", "gene_name": "SS4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LW85", "url": "https://www.uniprot.org/uniprotkb/Q9LW85" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 475, "end_pos": 475, "sequence_org": "W", "sequence_mut": "A", "comment": "Loss of glucan-binding in vitro.", "evidence": [ { "database": "UniProtKB", "id": "Q9LFY0", "url": "https://www.uniprot.org/uniprotkb/Q9LFY0" }, { "database": "PubMed", "id": "29866647", "url": "https://pubmed.ncbi.nlm.nih.gov/29866647" } ], "uniprot_canonical_ac": "Q9LFY0-1" }, { "start_pos": 486, "end_pos": 486, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9MAQ0", "url": "https://www.uniprot.org/uniprotkb/Q9MAQ0" }, { "database": "PubMed", "id": "25710501", "url": "https://pubmed.ncbi.nlm.nih.gov/25710501" }, { "database": "PubMed", "id": "29866647", "url": "https://pubmed.ncbi.nlm.nih.gov/29866647" } ], "uniprot_canonical_ac": "Q9MAQ0-1" } ], "record_id": "pubmed.29866647", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MFP1 defines the subchloroplast location of starch granule initiation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2024-01-16", "authors": "Sharma Mayank, Abt Melanie R, Eicke Simona, Ilse Theresa E, Liu Chun, Lucas Miriam S, Pfister Barbara, Zeeman Samuel C", "reference": { "type": "PubMed", "id": "38190535", "url": "https://pubmed.ncbi.nlm.nih.gov/38190535" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LW85-1", "protein_name": "MAR-binding filament-like protein 1", "gene_name": "MFP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LW85", "url": "https://www.uniprot.org/uniprotkb/Q9LW85" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 71, "end_pos": 146, "sequence_org": "AKRRAFLLVGISVLPFLQLRSPALADERGNEIKTSKVDLETEVAVVSEGTSPNPFLALLNGLGIFSAGVLGALYAL", "sequence_mut": "", "comment": "Loss of membrane-bound localization in leaves. Less numerous punctate structures within the chloroplasts in epidermal mature leaf cells and isolated mesophyll protoplasts. Lower starch granule numbers per chloroplast compared to wild-type.", "evidence": [ { "database": "UniProtKB", "id": "Q9LW85", "url": "https://www.uniprot.org/uniprotkb/Q9LW85" }, { "database": "PubMed", "id": "38190535", "url": "https://pubmed.ncbi.nlm.nih.gov/38190535" } ], "uniprot_canonical_ac": "Q9LW85-1" } ], "record_id": "pubmed.38190535", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of myo-inositol-1-phosphate synthase to the endosperm in developing seeds of Arabidopsis.", "journal": "J. Exp. Bot.", "date": "2008", "authors": "Mitsuhashi Naoto, Kondo Maki, Nakaune Satoru, Ohnishi Miwa, Hayashi Makoto, Hara-Nishimura Ikuko, Richardson Alan, Fukaki Hidehiro, Nishimura Mikio, Mimura Tetsuro", "reference": { "type": "PubMed", "id": "18603618", "url": "https://pubmed.ncbi.nlm.nih.gov/18603618" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LX12-1", "protein_name": "Probable inositol 3-phosphate synthase isozyme 3", "gene_name": "IPS3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42801-1", "protein_name": "Inositol-3-phosphate synthase isozyme 1", "gene_name": "IPS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38862-1", "protein_name": "Inositol-3-phosphate synthase isozyme 2", "gene_name": "IPS2; MIPS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LX12", "url": "https://www.uniprot.org/uniprotkb/Q9LX12" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18603618", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crosstalks between myo-inositol metabolism, programmed cell death and basal immunity in Arabidopsis.", "journal": "PLoS ONE", "date": "2009", "authors": "Meng Ping Hong, Raynaud C\u00e9cile, Tcherkez Guillaume, Blanchet Sophie, Massoud Kamal, Domenichini S\u00e9verine, Henry Yves, Soubigou-Taconnat Ludivine, Lelarge-Trouverie Caroline, Saindrenan Patrick, Renou Jean Pierre, Bergounioux Catherine", "reference": { "type": "PubMed", "id": "19812700", "url": "https://pubmed.ncbi.nlm.nih.gov/19812700" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LX12-1", "protein_name": "Probable inositol 3-phosphate synthase isozyme 3", "gene_name": "IPS3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42801-1", "protein_name": "Inositol-3-phosphate synthase isozyme 1", "gene_name": "IPS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNE9-1", "protein_name": "Histone-lysine N-methyltransferase ATXR6", "gene_name": "ATXR6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38862-1", "protein_name": "Inositol-3-phosphate synthase isozyme 2", "gene_name": "IPS2; MIPS2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VZJ1-2", "protein_name": "Histone-lysine N-methyltransferase ATXR5", "gene_name": "ATXR5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LX12", "url": "https://www.uniprot.org/uniprotkb/Q9LX12" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19812700", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis thaliana Myo-inositol 1-phosphate synthase1 gene is required for Myo-inositol synthesis and suppression of cell death.", "journal": "The Plant cell", "date": "2010-03", "authors": "Donahue Janet L, Alford Shannon R, Torabinejad Javad, Kerwin Rachel E, Nourbakhsh Aida, Ray W Keith, Hernick Marcy, Huang Xinyi, Lyons Blair M, Hein Pyae P, Gillaspy Glenda E", "reference": { "type": "PubMed", "id": "20215587", "url": "https://pubmed.ncbi.nlm.nih.gov/20215587" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LX12-1", "protein_name": "Probable inositol 3-phosphate synthase isozyme 3", "gene_name": "IPS3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42801-1", "protein_name": "Inositol-3-phosphate synthase isozyme 1", "gene_name": "IPS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38862-1", "protein_name": "Inositol-3-phosphate synthase isozyme 2", "gene_name": "IPS2; MIPS2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LX12", "url": "https://www.uniprot.org/uniprotkb/Q9LX12" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20215587", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GUN4, a regulator of chlorophyll synthesis and intracellular signaling.", "journal": "Science (New York, N.Y.)", "date": "2003-02-07", "authors": "Larkin Robert M, Alonso Jose M, Ecker Joseph R, Chory Joanne", "reference": { "type": "PubMed", "id": "12574634", "url": "https://pubmed.ncbi.nlm.nih.gov/12574634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LX31-1", "protein_name": "Tetrapyrrole-binding protein, chloroplastic", "gene_name": "GUN4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNB0-1", "protein_name": "Magnesium-chelatase subunit ChlH, chloroplastic", "gene_name": "CHLH; GUN5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LX31", "url": "https://www.uniprot.org/uniprotkb/Q9LX31" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12574634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Light signalling pathways regulating the Mg-chelatase branchpoint of chlorophyll synthesis during de-etiolation in Arabidopsis thaliana.", "journal": "Photochem. Photobiol. Sci.", "date": "2008", "authors": "Stephenson Patrick G, Terry Matthew J", "reference": { "type": "PubMed", "id": "18846290", "url": "https://pubmed.ncbi.nlm.nih.gov/18846290" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LX31-1", "protein_name": "Tetrapyrrole-binding protein, chloroplastic", "gene_name": "GUN4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P16127-1", "protein_name": "Magnesium-chelatase subunit ChlI-1, chloroplastic", "gene_name": "CHLI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNB0-1", "protein_name": "Magnesium-chelatase subunit ChlH, chloroplastic", "gene_name": "CHLH; GUN5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SW18-1", "protein_name": "Magnesium protoporphyrin IX methyltransferase, chloroplastic", "gene_name": "CHLM", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJE1-1", "protein_name": "Magnesium-chelatase subunit ChlD, chloroplastic", "gene_name": "CHLD", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LX31", "url": "https://www.uniprot.org/uniprotkb/Q9LX31" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18846290", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Roles of the different components of magnesium chelatase in abscisic acid signal transduction.", "journal": "Plant molecular biology", "date": "2012-11", "authors": "Du Shu-Yuan, Zhang Xiao-Feng, Lu Zekuan, Xin Qi, Wu Zhen, Jiang Tao, Lu Yan, Wang Xiao-Fang, Zhang Da-Peng", "reference": { "type": "PubMed", "id": "23011401", "url": "https://pubmed.ncbi.nlm.nih.gov/23011401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LX31-1", "protein_name": "Tetrapyrrole-binding protein, chloroplastic", "gene_name": "GUN4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P16127-1", "protein_name": "Magnesium-chelatase subunit ChlI-1, chloroplastic", "gene_name": "CHLI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNB0-1", "protein_name": "Magnesium-chelatase subunit ChlH, chloroplastic", "gene_name": "CHLH; GUN5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJE1-1", "protein_name": "Magnesium-chelatase subunit ChlD, chloroplastic", "gene_name": "CHLD", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LX31", "url": "https://www.uniprot.org/uniprotkb/Q9LX31" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 642, "end_pos": 642, "sequence_org": "P", "sequence_mut": "L", "comment": "In cch; semi-dwarf plants with pale green leaves and ABA-insensitive stomatal movment.", "evidence": [ { "database": "UniProtKB", "id": "Q9FNB0", "url": "https://www.uniprot.org/uniprotkb/Q9FNB0" }, { "database": "PubMed", "id": "11172074", "url": "https://pubmed.ncbi.nlm.nih.gov/11172074" }, { "database": "PubMed", "id": "23011401", "url": "https://pubmed.ncbi.nlm.nih.gov/23011401" } ], "uniprot_canonical_ac": "Q9FNB0-1" }, { "start_pos": 690, "end_pos": 690, "sequence_org": "L", "sequence_mut": "F", "comment": "In rtl1; semi-dwarf plants with pale green leaves and ABA-insensitive stomatal movment.", "evidence": [ { "database": "UniProtKB", "id": "Q9FNB0", "url": "https://www.uniprot.org/uniprotkb/Q9FNB0" }, { "database": "PubMed", "id": "21562844", "url": "https://pubmed.ncbi.nlm.nih.gov/21562844" }, { "database": "PubMed", "id": "23011401", "url": "https://pubmed.ncbi.nlm.nih.gov/23011401" } ], "uniprot_canonical_ac": "Q9FNB0-1" } ], "record_id": "pubmed.23011401", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional induction of two genes for CCaPs, novel cytosolic proteins, in Arabidopsis thaliana in the dark.", "journal": "Plant Cell Physiol.", "date": "2007", "authors": "Ide Yuki, Tomioka Rie, Ouchi Yuya, Kamiya Takehiro, Maeshima Masayoshi", "reference": { "type": "PubMed", "id": "17145720", "url": "https://pubmed.ncbi.nlm.nih.gov/17145720" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LX34-1", "protein_name": "Cytosolic calcium-binding protein 3", "gene_name": "CCaP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65370-1", "protein_name": "Cytosolic calcium-binding protein 2", "gene_name": "CCaP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SXE9-1", "protein_name": "Cytosolic calcium-binding protein 1", "gene_name": "CCaP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LX34", "url": "https://www.uniprot.org/uniprotkb/Q9LX34" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17145720", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A proteomics dissection of Arabidopsis thaliana vacuoles isolated from cell culture.", "journal": "Mol. Cell. Proteomics", "date": "2007", "authors": "Jaquinod Michel, Villiers Florent, Kieffer-Jaquinod Sylvie, Hugouvieux V\u00e9ronique, Bruley Christophe, Garin J\u00e9r\u00f4me, Bourguignon Jacques", "reference": { "type": "PubMed", "id": "17151019", "url": "https://pubmed.ncbi.nlm.nih.gov/17151019" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LX65-1", "protein_name": "V-type proton ATPase subunit H", "gene_name": "VHA-H", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LVD9-1", "protein_name": "Protein DETOXIFICATION 40", "gene_name": "DTX40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JTB3-1", "protein_name": "Protein DETOXIFICATION 35", "gene_name": "DTX35", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82628-1", "protein_name": "V-type proton ATPase subunit G1", "gene_name": "VHA-G1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XGM1-1", "protein_name": "V-type proton ATPase subunit D", "gene_name": "VHA-D", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93XY5-1", "protein_name": "Tetraspanin-18", "gene_name": "TOM2AH2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C889-1", "protein_name": "PRA1 family protein F2", "gene_name": "PRA1F2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVU4-1", "protein_name": "Tetraspanin-20", "gene_name": "TOM2AH1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VXY7-1", "protein_name": "Equilibrative nucleotide transporter 1", "gene_name": "ENT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W4K3-1", "protein_name": "Cationic amino acid transporter 4, vacuolar", "gene_name": "CAT4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ASS7-1", "protein_name": "Cationic amino acid transporter 2, vacuolar", "gene_name": "CAT2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SEL6-1", "protein_name": "Vesicle transport v-SNARE 11", "gene_name": "VTI11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38956-1", "protein_name": "Protein DETOXIFICATION 29", "gene_name": "DTX29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZT63-1", "protein_name": "Metal tolerance protein 1", "gene_name": "MTP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q7DM58-1", "protein_name": "ABC transporter C family member 4", "gene_name": "ABCC4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W4S4-1", "protein_name": "V-type proton ATPase subunit a3", "gene_name": "VHA-a3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O23654-1", "protein_name": "V-type proton ATPase catalytic subunit A", "gene_name": "VHA-A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P31414-1", "protein_name": "Pyrophosphate-energized vacuolar membrane proton pump 1", "gene_name": "AVP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P46032-1", "protein_name": "Protein NRT1/ PTR FAMILY 8.3", "gene_name": "NPF8.3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94AP3-1", "protein_name": "Protein WALLS ARE THIN 1", "gene_name": "WAT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94KI8-1", "protein_name": "Two pore calcium channel protein 1", "gene_name": "TPC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C8G9-1", "protein_name": "ABC transporter C family member 1", "gene_name": "ABCC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84WG1-1", "protein_name": "Sodium/hydrogen exchanger 3", "gene_name": "NHX3; NHX4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WML0-1", "protein_name": "ABC transporter B family member 27", "gene_name": "ABCB27", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42093-1", "protein_name": "ABC transporter C family member 2", "gene_name": "ABCC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q41951-1", "protein_name": "Aquaporin TIP2-1", "gene_name": "TIP2-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22218-1", "protein_name": "Calcium-transporting ATPase 4, plasma membrane-type", "gene_name": "ACA4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SDS7-1", "protein_name": "V-type proton ATPase subunit C", "gene_name": "VHA-C", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJT7-1", "protein_name": "V-type proton ATPase subunit a2", "gene_name": "VHA-a2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SNV9-1", "protein_name": "Metal transporter Nramp3", "gene_name": "NRAMP3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LX65", "url": "https://www.uniprot.org/uniprotkb/Q9LX65" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17151019", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PELPK1 (At5g09530) contains a unique pentapeptide repeat and is a positive regulator of germination in Arabidopsis thaliana.", "journal": "Plant cell reports", "date": "2011-09", "authors": "Rashid Abdur, Deyholos Michael K", "reference": { "type": "PubMed", "id": "21559969", "url": "https://pubmed.ncbi.nlm.nih.gov/21559969" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXB8-1", "protein_name": "Protein PELPK1", "gene_name": "PELPK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LXB7-1", "protein_name": "Protein PELPK2", "gene_name": "PELPK2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXB8", "url": "https://www.uniprot.org/uniprotkb/Q9LXB8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21559969", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Sub-cellular localization of PELPK1 in Arabidopsis thaliana as determined by translational fusion with green fluorescent protein reporter].", "journal": "Mol. Biol. (Mosk.)", "date": "2014", "authors": "Rashid A", "reference": { "type": "PubMed", "id": "25850299", "url": "https://pubmed.ncbi.nlm.nih.gov/25850299" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXB8-1", "protein_name": "Protein PELPK1", "gene_name": "PELPK1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXB8", "url": "https://www.uniprot.org/uniprotkb/Q9LXB8" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25850299", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of the arabidopsis DRM methyltransferases in de novo DNA methylation and gene silencing.", "journal": "Current biology : CB", "date": "2002-07-09", "authors": "Cao Xiaofeng, Jacobsen Steven E", "reference": { "type": "PubMed", "id": "12121623", "url": "https://pubmed.ncbi.nlm.nih.gov/12121623" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXE5-1", "protein_name": "DNA (cytosine-5)-methyltransferase DRM1", "gene_name": "DRM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M548-1", "protein_name": "DNA (cytosine-5)-methyltransferase DRM2", "gene_name": "DRM2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXE5", "url": "https://www.uniprot.org/uniprotkb/Q9LXE5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12121623", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Locus-specific control of asymmetric and CpNpG methylation by the DRM and CMT3 methyltransferase genes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002-12-10", "authors": "Cao Xiaofeng, Jacobsen Steven E", "reference": { "type": "PubMed", "id": "12151602", "url": "https://pubmed.ncbi.nlm.nih.gov/12151602" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXE5-1", "protein_name": "DNA (cytosine-5)-methyltransferase DRM1", "gene_name": "DRM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M548-1", "protein_name": "DNA (cytosine-5)-methyltransferase DRM2", "gene_name": "DRM2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXE5", "url": "https://www.uniprot.org/uniprotkb/Q9LXE5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12151602", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of the DRM and CMT3 methyltransferases in RNA-directed DNA methylation.", "journal": "Current biology : CB", "date": "2003-12-16", "authors": "Cao Xiaofeng, Aufsatz Werner, Zilberman Daniel, Mette M Florian, Huang Michael S, Matzke Marjori, Jacobsen Steven E", "reference": { "type": "PubMed", "id": "14680640", "url": "https://pubmed.ncbi.nlm.nih.gov/14680640" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXE5-1", "protein_name": "DNA (cytosine-5)-methyltransferase DRM1", "gene_name": "DRM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94F88-1", "protein_name": "DNA (cytosine-5)-methyltransferase CMT3", "gene_name": "CMT3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M548-1", "protein_name": "DNA (cytosine-5)-methyltransferase DRM2", "gene_name": "DRM2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXE5", "url": "https://www.uniprot.org/uniprotkb/Q9LXE5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14680640", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Efficient discovery of DNA polymorphisms in natural populations by Ecotilling.", "journal": "Plant J.", "date": "2004", "authors": "Comai Luca, Young Kim, Till Bradley J, Reynolds Steven H, Greene Elizabeth A, Codomo Christine A, Enns Linda C, Johnson Jessica E, Burtner Chris, Odden Anthony R, Henikoff Steven", "reference": { "type": "PubMed", "id": "14871304", "url": "https://pubmed.ncbi.nlm.nih.gov/14871304" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXE5-1", "protein_name": "DNA (cytosine-5)-methyltransferase DRM1", "gene_name": "DRM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JWT7-1", "protein_name": "tRNA (cytosine(38)-C(5))-methyltransferase 2", "gene_name": "DNMT2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84LH3-1", "protein_name": "3'-5' exonuclease", "gene_name": "WEX", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6QPM2-1", "protein_name": "GATA transcription factor 19", "gene_name": "GATA19", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXE5", "url": "https://www.uniprot.org/uniprotkb/Q9LXE5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14871304", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel protein family mediates Casparian strip formation in the endodermis.", "journal": "Nature", "date": "2011-05-19", "authors": "Roppolo Daniele, De Rybel Bert, D\u00e9nervaud Tendon Val\u00e9rie, Pfister Alexandre, Alassimone Julien, Vermeer Joop E M, Yamazaki Misako, Stierhof York-Dieter, Beeckman Tom, Geldner Niko", "reference": { "type": "PubMed", "id": "21593871", "url": "https://pubmed.ncbi.nlm.nih.gov/21593871" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXF3-1", "protein_name": "Casparian strip membrane protein 5", "gene_name": "CASP5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9CAX3-1", "protein_name": "Casparian strip membrane protein 2", "gene_name": "CASP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFZ7-1", "protein_name": "Casparian strip membrane protein 4", "gene_name": "CASP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZQI2-1", "protein_name": "Casparian strip membrane protein 3", "gene_name": "CASP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SIH4-1", "protein_name": "Casparian strip membrane protein 1", "gene_name": "CASP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXF3", "url": "https://www.uniprot.org/uniprotkb/Q9LXF3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21593871", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and expression profile of the sucrose synthase multigene family in Arabidopsis.", "journal": "J. Exp. Bot.", "date": "2004", "authors": "Baud S\u00e9bastien, Vaultier Marie-No\u00eblle, Rochat Christine", "reference": { "type": "PubMed", "id": "14739263", "url": "https://pubmed.ncbi.nlm.nih.gov/14739263" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXL5-1", "protein_name": "Sucrose synthase 4", "gene_name": "SUS4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4K5W8-1", "protein_name": "Sucrose synthase 5", "gene_name": "SUS5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FX32-1", "protein_name": "Sucrose synthase 6", "gene_name": "SUS6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q00917-1", "protein_name": "Sucrose synthase 2", "gene_name": "SUS2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49040-1", "protein_name": "Sucrose synthase 1", "gene_name": "SUS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M111-1", "protein_name": "Sucrose synthase 3", "gene_name": "SUS3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXL5", "url": "https://www.uniprot.org/uniprotkb/Q9LXL5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14739263", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the sucrose synthase gene family in Arabidopsis.", "journal": "Plant J.", "date": "2007", "authors": "Bieniawska Zuzanna, Paul Barratt D H, Garlick Andrew P, Thole Vera, Kruger Nicholas J, Martin Cathie, Zrenner Rita, Smith Alison M", "reference": { "type": "PubMed", "id": "17257168", "url": "https://pubmed.ncbi.nlm.nih.gov/17257168" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXL5-1", "protein_name": "Sucrose synthase 4", "gene_name": "SUS4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4K5W8-1", "protein_name": "Sucrose synthase 5", "gene_name": "SUS5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FX32-1", "protein_name": "Sucrose synthase 6", "gene_name": "SUS6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q00917-1", "protein_name": "Sucrose synthase 2", "gene_name": "SUS2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49040-1", "protein_name": "Sucrose synthase 1", "gene_name": "SUS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M111-1", "protein_name": "Sucrose synthase 3", "gene_name": "SUS3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXL5", "url": "https://www.uniprot.org/uniprotkb/Q9LXL5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17257168", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Localization of sucrose synthase in developing seed and siliques of Arabidopsis thaliana reveals diverse roles for SUS during development.", "journal": "J. Exp. Bot.", "date": "2008", "authors": "Fallahi Hossein, Scofield Graham N, Badger Murray R, Chow Wah Soon, Furbank Robert T, Ruan Yong-Ling", "reference": { "type": "PubMed", "id": "18635527", "url": "https://pubmed.ncbi.nlm.nih.gov/18635527" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXL5-1", "protein_name": "Sucrose synthase 4", "gene_name": "SUS4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4K5W8-1", "protein_name": "Sucrose synthase 5", "gene_name": "SUS5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FX32-1", "protein_name": "Sucrose synthase 6", "gene_name": "SUS6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q00917-1", "protein_name": "Sucrose synthase 2", "gene_name": "SUS2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49040-1", "protein_name": "Sucrose synthase 1", "gene_name": "SUS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M111-1", "protein_name": "Sucrose synthase 3", "gene_name": "SUS3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXL5", "url": "https://www.uniprot.org/uniprotkb/Q9LXL5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18635527", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Modulation of sugar metabolism by an INDETERMINATE DOMAIN transcription factor contributes to photoperiodic flowering in Arabidopsis.", "journal": "Plant J.", "date": "2011", "authors": "Seo Pil Joon, Ryu Jaeyong, Kang Seok Ki, Park Chung-Mo", "reference": { "type": "PubMed", "id": "21265895", "url": "https://pubmed.ncbi.nlm.nih.gov/21265895" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXL5-1", "protein_name": "Sucrose synthase 4", "gene_name": "SUS4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FFH3-1", "protein_name": "Zinc finger protein NUTCRACKER", "gene_name": "NUC", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49040-1", "protein_name": "Sucrose synthase 1", "gene_name": "SUS1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZWA6-1", "protein_name": "Zinc finger protein MAGPIE", "gene_name": "MGP", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXL5", "url": "https://www.uniprot.org/uniprotkb/Q9LXL5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21265895", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of CLE40, a protein functionally equivalent to the stem cell restricting signal CLV3, enhances root waving in Arabidopsis.", "journal": "Development genes and evolution", "date": "2003-08", "authors": "Hobe Martin, M\u00fcller Ralf, Gr\u00fcnewald Margit, Brand Ulrike, Simon R\u00fcdiger", "reference": { "type": "PubMed", "id": "12743822", "url": "https://pubmed.ncbi.nlm.nih.gov/12743822" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXU0-1", "protein_name": "CLAVATA3/ESR (CLE)-related protein 40", "gene_name": "CLE40", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXU0", "url": "https://www.uniprot.org/uniprotkb/Q9LXU0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12743822", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The 14-amino acid CLV3, CLE19, and CLE40 peptides trigger consumption of the root meristem in Arabidopsis through a CLAVATA2-dependent pathway.", "journal": "The Plant cell", "date": "2005-09", "authors": "Fiers Martijn, Golemiec Elzbieta, Xu Jian, van der Geest Lonneke, Heidstra Renze, Stiekema Willem, Liu Chun-Ming", "reference": { "type": "PubMed", "id": "16055633", "url": "https://pubmed.ncbi.nlm.nih.gov/16055633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXU0-1", "protein_name": "CLAVATA3/ESR (CLE)-related protein 40", "gene_name": "CLE40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W261-1", "protein_name": "CLAVATA3/ESR (CLE)-related protein 19", "gene_name": "CLE19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XF04-1", "protein_name": "Protein CLAVATA 3", "gene_name": "CLV3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80809-1", "protein_name": "Receptor-like protein CLAVATA2", "gene_name": "CLV2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXU0", "url": "https://www.uniprot.org/uniprotkb/Q9LXU0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16055633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A signaling module controlling the stem cell niche in Arabidopsis root meristems.", "journal": "Current biology : CB", "date": "2009-06-09", "authors": "Stahl Yvonne, Wink Ren\u00e9 H, Ingram Gwyneth C, Simon R\u00fcdiger", "reference": { "type": "PubMed", "id": "19398337", "url": "https://pubmed.ncbi.nlm.nih.gov/19398337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXU0-1", "protein_name": "CLAVATA3/ESR (CLE)-related protein 40", "gene_name": "CLE40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LX29-1", "protein_name": "Serine/threonine-protein kinase-like protein ACR4", "gene_name": "ACR4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXU0", "url": "https://www.uniprot.org/uniprotkb/Q9LXU0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19398337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Is the Arabidopsis root niche protected by sequestration of the CLE40 signal by its putative receptor ACR4?", "journal": "Plant signaling & behavior", "date": "2009-07", "authors": "Stahl Yvonne, Simon R\u00fcdiger", "reference": { "type": "PubMed", "id": "19820344", "url": "https://pubmed.ncbi.nlm.nih.gov/19820344" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXU0-1", "protein_name": "CLAVATA3/ESR (CLE)-related protein 40", "gene_name": "CLE40", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXU0", "url": "https://www.uniprot.org/uniprotkb/Q9LXU0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19820344", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Receptor-like cytoplasmic kinase MAZZA mediates developmental processes with CLAVATA1 family receptors in Arabidopsis.", "journal": "Journal of experimental botany", "date": "2021-06-22", "authors": "Bl\u00fcmke Patrick, Schlegel Jenia, Gonzalez-Ferrer Carmen, Becher Sabine, Pinto Karine Gustavo, Monaghan Jacqueline, Simon R\u00fcdiger", "reference": { "type": "PubMed", "id": "33909893", "url": "https://pubmed.ncbi.nlm.nih.gov/33909893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXU0-1", "protein_name": "CLAVATA3/ESR (CLE)-related protein 40", "gene_name": "CLE40", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O49545-1", "protein_name": "Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM1", "gene_name": "BAM1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65440-1", "protein_name": "Leucine-rich repeat receptor-like serine/threonine-protein kinase BAM3", "gene_name": "BAM3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SYQ8-1", "protein_name": "Receptor protein kinase CLAVATA1", "gene_name": "CLV1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4HWU0-1", "protein_name": "Protein CYTOSOLIC ABA RECEPTOR KINASE 11", "gene_name": "CARK11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80809-1", "protein_name": "Receptor-like protein CLAVATA2", "gene_name": "CLV2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZW72-1", "protein_name": "Protein CYTOSOLIC ABA RECEPTOR KINASE 6", "gene_name": "CARK6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B9DFG5-1", "protein_name": "Protein CYTOSOLIC ABA RECEPTOR KINASE 5", "gene_name": "CARK5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WVM4-1", "protein_name": "Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 2", "gene_name": "CIK2; CLERK", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LUT0-1", "protein_name": "Protein CYTOSOLIC ABA RECEPTOR KINASE 1", "gene_name": "CARK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LYU7-1", "protein_name": "Inactive leucine-rich repeat receptor-like protein kinase CORYNE", "gene_name": "CRN", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXU0", "url": "https://www.uniprot.org/uniprotkb/Q9LXU0" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 48, "end_pos": 48, "sequence_org": "C", "sequence_mut": "W", "comment": "Abnormal cytoplasmic localization at the expense of plasma membrane positioning; when associated with W-49. Loss of plasma membrane positioning leading to exclusive cytoplasmic localization, and impaired CLE40 sensitivity leading to an increased columella stem cell (CSC) number; when associated with W-49 and W-51.", "evidence": [ { "database": "UniProtKB", "id": "B9DFG5", "url": "https://www.uniprot.org/uniprotkb/B9DFG5" }, { "database": "PubMed", "id": "33909893", "url": "https://pubmed.ncbi.nlm.nih.gov/33909893" } ], "uniprot_canonical_ac": "B9DFG5-1" }, { "start_pos": 49, "end_pos": 49, "sequence_org": "C", "sequence_mut": "W", "comment": "Abnormal cytoplasmic localization at the expense of plasma membrane positioning; when associated with W-48. Loss of plasma membrane positioning leading to exclusive cytoplasmic localization, and impaired CLE40 sensitivity leading to an increased columella stem cell (CSC) number; when associated with W-48 and W-51.", "evidence": [ { "database": "UniProtKB", "id": "B9DFG5", "url": "https://www.uniprot.org/uniprotkb/B9DFG5" }, { "database": "PubMed", "id": "33909893", "url": "https://pubmed.ncbi.nlm.nih.gov/33909893" } ], "uniprot_canonical_ac": "B9DFG5-1" }, { "start_pos": 51, "end_pos": 51, "sequence_org": "C", "sequence_mut": "W", "comment": "Loss of plasma membrane positioning leading to exclusive cytoplasmic localization, and impaired CLE40 sensitivity leading to an increased columella stem cell (CSC) number; when associated with W-48 and W-49.", "evidence": [ { "database": "UniProtKB", "id": "B9DFG5", "url": "https://www.uniprot.org/uniprotkb/B9DFG5" }, { "database": "PubMed", "id": "33909893", "url": "https://pubmed.ncbi.nlm.nih.gov/33909893" } ], "uniprot_canonical_ac": "B9DFG5-1" } ], "record_id": "pubmed.33909893", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Coexpression-based clustering of Arabidopsis root genes predicts functional modules in early phosphate deficiency signaling.", "journal": "Plant Physiol.", "date": "2011", "authors": "Lin Wen-Dar, Liao Ya-Yun, Yang Thomas J W, Pan Chao-Yu, Buckhout Thomas J, Schmidt Wolfgang", "reference": { "type": "PubMed", "id": "21248074", "url": "https://pubmed.ncbi.nlm.nih.gov/21248074" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXW3-1", "protein_name": "Probable cysteine protease RDL3", "gene_name": "RDL3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4KBY0-1", "protein_name": "Gibberellin 20-oxidase-like protein", "gene_name": "MWD22.26", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LVC0-1", "protein_name": "Arabinogalactan protein 14", "gene_name": "AGP14", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXW3", "url": "https://www.uniprot.org/uniprotkb/Q9LXW3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21248074", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Thioredoxin targets of the plant chloroplast lumen and their implications for plastid function.", "journal": "Proteomics", "date": "2010-03", "authors": "Hall Michael, Mata-Cabana Alejandro, Akerlund Hans-Erik, Florencio Francisco J, Schr\u00f6der Wolfgang P, Lindahl Marika, Kieselbach Thomas", "reference": { "type": "PubMed", "id": "20049866", "url": "https://pubmed.ncbi.nlm.nih.gov/20049866" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXX5-1", "protein_name": "PsbP domain-containing protein 6, chloroplastic", "gene_name": "PPD6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1Q1-1", "protein_name": "Thylakoid lumenal protein TL20.3, chloroplastic", "gene_name": "TL20.3; TL203", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39249-1", "protein_name": "Violaxanthin de-epoxidase, chloroplastic", "gene_name": "VDE1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXX5", "url": "https://www.uniprot.org/uniprotkb/Q9LXX5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20049866", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification, crystallization and preliminary X-ray analysis of PPD6, a PsbP-domain protein from Arabidopsis thaliana.", "journal": "Acta Crystallogr. F", "date": "2012", "authors": "Hall Michael, Kieselbach Thomas, Sauer Uwe H, Schr\u00f6der Wolfgang P", "reference": { "type": "PubMed", "id": "22442221", "url": "https://pubmed.ncbi.nlm.nih.gov/22442221" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LXX5-1", "protein_name": "PsbP domain-containing protein 6, chloroplastic", "gene_name": "PPD6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LXX5", "url": "https://www.uniprot.org/uniprotkb/Q9LXX5" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22442221", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glycosylphosphatidylinositol-anchored cell-surface proteins from Arabidopsis.", "journal": "Electrophoresis", "date": "1999", "authors": "Sherrier D J, Prime T A, Dupree P", "reference": { "type": "PubMed", "id": "10451111", "url": "https://pubmed.ncbi.nlm.nih.gov/10451111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LY91-1", "protein_name": "Classical arabinogalactan protein 6", "gene_name": "AGP6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZT16-1", "protein_name": "Classical arabinogalactan protein 4", "gene_name": "AGP4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LY91", "url": "https://www.uniprot.org/uniprotkb/Q9LY91" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10451111", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis AT-hook protein TEK positively regulates the expression of arabinogalactan proteins in controlling nexine layer formation in the pollen wall.", "journal": "Molecular plant", "date": "2014-10-20", "authors": "Jia Qi-Shi, Zhu Jun, Xu Xiao-Feng, Lou Yue, Zhang Zhan-Lin, Zhang Zhi-Ping, Yang Zhong-Nan", "reference": { "type": "PubMed", "id": "25336567", "url": "https://pubmed.ncbi.nlm.nih.gov/25336567" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LY91-1", "protein_name": "Classical arabinogalactan protein 6", "gene_name": "AGP6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJG4-1", "protein_name": "AT-hook motif nuclear-localized protein 16", "gene_name": "AHL16", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LY91", "url": "https://www.uniprot.org/uniprotkb/Q9LY91" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 57, "end_pos": 59, "sequence_org": "GRP", "sequence_mut": "AAA", "comment": "Reduces DNA-binding activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9SJG4", "url": "https://www.uniprot.org/uniprotkb/Q9SJG4" }, { "database": "PubMed", "id": "25336567", "url": "https://pubmed.ncbi.nlm.nih.gov/25336567" } ], "uniprot_canonical_ac": "Q9SJG4-1" } ], "record_id": "pubmed.25336567", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deubiquitinating Enzyme OTU5 Contributes to DNA Methylation Patterns and Is Critical for Phosphate Nutrition Signals.", "journal": "Plant physiology", "date": "2017-12", "authors": "Yen Ming-Ren, Suen Der-Fen, Hsu Fei-Man, Tsai Yi-Hsiu, Fu Hongyong, Schmidt Wolfgang, Chen Pao-Yang", "reference": { "type": "PubMed", "id": "29061907", "url": "https://pubmed.ncbi.nlm.nih.gov/29061907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LYC7-1", "protein_name": "OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 5", "gene_name": "OTU5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LYC7", "url": "https://www.uniprot.org/uniprotkb/Q9LYC7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.29061907", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Deubiquitinase OTU5 Regulates Root Responses to Phosphate Starvation.", "journal": "Plant physiology", "date": "2018-03", "authors": "Suen Der-Fen, Tsai Yi-Hsiu, Cheng Ya-Tan, Radjacommare Ramalingam, Ahirwar Ram Nivas, Fu Hongyong, Schmidt Wolfgang", "reference": { "type": "PubMed", "id": "29301952", "url": "https://pubmed.ncbi.nlm.nih.gov/29301952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LYC7-1", "protein_name": "OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 5", "gene_name": "OTU5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LYC7", "url": "https://www.uniprot.org/uniprotkb/Q9LYC7" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.29301952", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The classical arabinogalactan protein gene family of arabidopsis.", "journal": "The Plant cell", "date": "2000-09", "authors": "Schultz C J, Johnson K L, Currie G, Bacic A", "reference": { "type": "PubMed", "id": "11006345", "url": "https://pubmed.ncbi.nlm.nih.gov/11006345" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LYF6-1", "protein_name": "Arabinogalactan protein 15", "gene_name": "AGP15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M0S4-1", "protein_name": "Classical arabinogalactan protein 10", "gene_name": "AGP10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22126-1", "protein_name": "Fasciclin-like arabinogalactan protein 8", "gene_name": "FLA8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O82337-1", "protein_name": "Arabinogalactan protein 16", "gene_name": "AGP16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZT17-1", "protein_name": "Classical arabinogalactan protein 3", "gene_name": "AGP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5S0-1", "protein_name": "Classical arabinogalactan protein 9", "gene_name": "AGP9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LG54-1", "protein_name": "Classical arabinogalactan protein 7", "gene_name": "AGP7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LJD9-1", "protein_name": "Arabinogalactan protein 12", "gene_name": "AGP12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJY7-1", "protein_name": "Classical arabinogalactan protein 2", "gene_name": "AGP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9STQ3-1", "protein_name": "Arabinogalactan protein 13", "gene_name": "AGP13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZT16-1", "protein_name": "Classical arabinogalactan protein 4", "gene_name": "AGP4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LCE4-1", "protein_name": "Classical arabinogalactan protein 5", "gene_name": "AGP5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LCN5-1", "protein_name": "Classical arabinogalactan protein 1", "gene_name": "AGP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LVC0-1", "protein_name": "Arabinogalactan protein 14", "gene_name": "AGP14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FVE0-1", "protein_name": "Classical arabinogalactan protein 11", "gene_name": "AGP11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LYF6", "url": "https://www.uniprot.org/uniprotkb/Q9LYF6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11006345", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]